BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032F10

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769985.1|  PREDICTED: uncharacterized protein LOC104220752    180   1e-50   Nicotiana sylvestris
ref|XP_009594216.1|  PREDICTED: uncharacterized protein LOC104090749    177   9e-50   Nicotiana tomentosiformis
ref|XP_006360143.1|  PREDICTED: uncharacterized protein LOC102590255    175   7e-49   Solanum tuberosum [potatoes]
emb|CDP05871.1|  unnamed protein product                                158   2e-42   Coffea canephora [robusta coffee]
ref|XP_010545803.1|  PREDICTED: uncharacterized protein LOC104818056    156   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_004244201.1|  PREDICTED: uncharacterized protein LOC101247444    155   1e-41   Solanum lycopersicum
ref|XP_010268765.1|  PREDICTED: uncharacterized protein LOC104605628    155   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010092169.1|  Peroxisomal membrane protein 2                     150   3e-39   
ref|XP_010644223.1|  PREDICTED: uncharacterized protein LOC100253...    148   7e-39   Vitis vinifera
ref|XP_002284644.1|  PREDICTED: mpv17-like protein isoform X1           148   7e-39   Vitis vinifera
ref|XP_011098348.1|  PREDICTED: mpv17-like protein isoform X2           145   1e-37   Sesamum indicum [beniseed]
ref|XP_011098346.1|  PREDICTED: mpv17-like protein isoform X1           145   1e-37   Sesamum indicum [beniseed]
ref|XP_011029433.1|  PREDICTED: mpv17-like protein                      144   3e-37   Populus euphratica
ref|XP_002317517.2|  hypothetical protein POPTR_0011s12440g             143   5e-37   Populus trichocarpa [western balsam poplar]
gb|KDP38924.1|  hypothetical protein JCGZ_00681                         143   9e-37   Jatropha curcas
gb|KDO74166.1|  hypothetical protein CISIN_1g017634mg                   139   1e-36   Citrus sinensis [apfelsine]
ref|XP_006841712.1|  hypothetical protein AMTR_s00003p00254020          141   3e-36   
ref|XP_007211442.1|  hypothetical protein PRUPE_ppa007209mg             141   3e-36   Prunus persica
ref|XP_008226678.1|  PREDICTED: uncharacterized protein LOC103326248    141   3e-36   Prunus mume [ume]
ref|XP_011042502.1|  PREDICTED: uncharacterized protein LOC105138177    140   5e-36   Populus euphratica
ref|XP_010278296.1|  PREDICTED: uncharacterized protein LOC104612557    140   6e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009147654.1|  PREDICTED: uncharacterized protein LOC103871177    140   7e-36   Brassica rapa
gb|EYU26408.1|  hypothetical protein MIMGU_mgv1a007901mg                140   8e-36   Erythranthe guttata [common monkey flower]
ref|XP_006392859.1|  hypothetical protein EUTSA_v10011607mg             139   3e-35   Eutrema salsugineum [saltwater cress]
gb|KDO74165.1|  hypothetical protein CISIN_1g017634mg                   137   3e-35   Citrus sinensis [apfelsine]
gb|KDO74164.1|  hypothetical protein CISIN_1g017634mg                   137   3e-35   Citrus sinensis [apfelsine]
emb|CDY53804.1|  BnaA06g01790D                                          139   3e-35   Brassica napus [oilseed rape]
gb|KDO74155.1|  hypothetical protein CISIN_1g017634mg                   137   5e-35   Citrus sinensis [apfelsine]
ref|XP_007021315.1|  Peroxisomal membrane 22 kDa family protein i...    138   5e-35   Theobroma cacao [chocolate]
ref|XP_007021317.1|  Peroxisomal membrane 22 kDa family protein i...    138   5e-35   
ref|NP_564616.1|  peroxisomal membrane Mpv17/PMP22 family protein       137   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006464706.1|  PREDICTED: uncharacterized protein LOC102611604    137   1e-34   Citrus sinensis [apfelsine]
gb|KDO74161.1|  hypothetical protein CISIN_1g017634mg                   137   1e-34   Citrus sinensis [apfelsine]
gb|KDO74162.1|  hypothetical protein CISIN_1g017634mg                   137   1e-34   Citrus sinensis [apfelsine]
ref|NP_564615.3|  peroxisomal membrane Mpv17/PMP22 family protein       136   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006370309.1|  hypothetical protein POPTR_0001s41510g             136   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004291669.1|  PREDICTED: uncharacterized protein LOC101306984    136   3e-34   Fragaria vesca subsp. vesca
ref|XP_010060525.1|  PREDICTED: uncharacterized protein LOC104448413    135   5e-34   Eucalyptus grandis [rose gum]
gb|KCW67302.1|  hypothetical protein EUGRSUZ_F01090                     135   6e-34   Eucalyptus grandis [rose gum]
ref|XP_003539587.1|  PREDICTED: uncharacterized protein LOC100805057    135   7e-34   Glycine max [soybeans]
ref|XP_008366686.1|  PREDICTED: uncharacterized protein LOC103430324    134   1e-33   Malus domestica [apple tree]
ref|XP_010462139.1|  PREDICTED: uncharacterized protein LOC104742787    134   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006451945.1|  hypothetical protein CICLE_v10008646mg             132   2e-33   
ref|XP_010924061.1|  PREDICTED: uncharacterized protein LOC105046...    132   3e-33   
ref|XP_010500911.1|  PREDICTED: mpv17-like protein                      133   4e-33   Camelina sativa [gold-of-pleasure]
gb|KJB62720.1|  hypothetical protein B456_009G432500                    131   6e-33   Gossypium raimondii
ref|XP_010479814.1|  PREDICTED: uncharacterized protein LOC104758621    132   7e-33   Camelina sativa [gold-of-pleasure]
gb|KJB62723.1|  hypothetical protein B456_009G432500                    131   7e-33   Gossypium raimondii
ref|XP_006451942.1|  hypothetical protein CICLE_v10008646mg             132   8e-33   
gb|KJB62724.1|  hypothetical protein B456_009G432500                    131   9e-33   Gossypium raimondii
ref|XP_004487676.1|  PREDICTED: uncharacterized protein LOC101505712    132   9e-33   Cicer arietinum [garbanzo]
ref|XP_006451944.1|  hypothetical protein CICLE_v10008646mg             132   1e-32   
ref|XP_010924060.1|  PREDICTED: uncharacterized protein LOC105046...    132   1e-32   Elaeis guineensis
ref|XP_009334618.1|  PREDICTED: uncharacterized protein LOC103927419    131   2e-32   Pyrus x bretschneideri [bai li]
gb|KJB62721.1|  hypothetical protein B456_009G432500                    131   2e-32   Gossypium raimondii
ref|XP_003543260.1|  PREDICTED: uncharacterized protein LOC100786706    131   2e-32   Glycine max [soybeans]
ref|XP_009378494.1|  PREDICTED: uncharacterized protein LOC103966...    131   2e-32   Pyrus x bretschneideri [bai li]
gb|KJB62718.1|  hypothetical protein B456_009G432500                    131   2e-32   Gossypium raimondii
ref|XP_009378495.1|  PREDICTED: uncharacterized protein LOC103966...    131   3e-32   
gb|KJB62719.1|  hypothetical protein B456_009G432500                    130   3e-32   Gossypium raimondii
gb|KJB62726.1|  hypothetical protein B456_009G432500                    130   3e-32   Gossypium raimondii
gb|KJB62714.1|  hypothetical protein B456_009G432500                    131   3e-32   Gossypium raimondii
gb|KJB62715.1|  hypothetical protein B456_009G432500                    130   3e-32   Gossypium raimondii
ref|XP_009397791.1|  PREDICTED: uncharacterized protein LOC103982557    130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006305136.1|  hypothetical protein CARUB_v10009510mg             130   5e-32   Capsella rubella
emb|CDY26037.1|  BnaC06g05870D                                          129   5e-32   Brassica napus [oilseed rape]
gb|KHN36788.1|  Peroxisomal membrane protein 2                          129   7e-32   Glycine soja [wild soybean]
ref|XP_002891718.1|  hypothetical protein ARALYDRAFT_474411             127   4e-31   
gb|KHF98025.1|  Peroxisomal membrane 2                                  127   4e-31   Gossypium arboreum [tree cotton]
ref|XP_010921049.1|  PREDICTED: uncharacterized protein LOC105044749    126   1e-30   Elaeis guineensis
ref|XP_007149619.1|  hypothetical protein PHAVU_005G085000g             124   5e-30   Phaseolus vulgaris [French bean]
ref|XP_008452277.1|  PREDICTED: uncharacterized protein LOC103493...    123   1e-29   Cucumis melo [Oriental melon]
ref|XP_008452276.1|  PREDICTED: uncharacterized protein LOC103493...    123   2e-29   Cucumis melo [Oriental melon]
ref|XP_010687649.1|  PREDICTED: uncharacterized protein LOC104901742    121   7e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN56219.1|  hypothetical protein Csa_3G100790                       120   3e-28   Cucumis sativus [cucumbers]
ref|XP_008800139.1|  PREDICTED: uncharacterized protein LOC103714610    119   3e-28   
ref|XP_004149288.1|  PREDICTED: uncharacterized protein LOC101205134    119   3e-28   Cucumis sativus [cucumbers]
gb|KEH38794.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    118   7e-28   Medicago truncatula
gb|KFK35762.1|  hypothetical protein AALP_AA4G033000                    115   6e-27   Arabis alpina [alpine rockcress]
ref|XP_010675607.1|  PREDICTED: protein SYM1-like                       114   2e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO74163.1|  hypothetical protein CISIN_1g017634mg                   111   7e-26   Citrus sinensis [apfelsine]
emb|CBI20352.3|  unnamed protein product                                109   3e-25   Vitis vinifera
gb|EPS62403.1|  hypothetical protein M569_12387                         108   8e-25   Genlisea aurea
ref|XP_006447326.1|  hypothetical protein CICLE_v10015813mg             108   1e-24   
gb|KDO40773.1|  hypothetical protein CISIN_1g019056mg                   108   1e-24   Citrus sinensis [apfelsine]
gb|KDO40772.1|  hypothetical protein CISIN_1g019056mg                   108   2e-24   Citrus sinensis [apfelsine]
ref|XP_006447327.1|  hypothetical protein CICLE_v10015813mg             108   3e-24   Citrus clementina [clementine]
gb|KDO40771.1|  hypothetical protein CISIN_1g019056mg                   108   3e-24   Citrus sinensis [apfelsine]
ref|NP_001062843.2|  Os09g0315000                                       101   8e-24   
gb|ABR17136.1|  unknown                                                 106   1e-23   Picea sitchensis
ref|XP_008386298.1|  PREDICTED: uncharacterized protein LOC103448811    105   1e-23   
ref|XP_008230250.1|  PREDICTED: uncharacterized protein LOC103329...    102   2e-22   Prunus mume [ume]
ref|XP_009766316.1|  PREDICTED: protein SYM1                            103   2e-22   Nicotiana sylvestris
ref|XP_008230249.1|  PREDICTED: uncharacterized protein LOC103329...    102   2e-22   
ref|XP_008230251.1|  PREDICTED: uncharacterized protein LOC103329...    102   2e-22   Prunus mume [ume]
ref|XP_009623041.1|  PREDICTED: protein SYM1                            102   2e-22   Nicotiana tomentosiformis
gb|ABF97329.1|  peroxisomal membrane protein, putative, expressed       102   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230252.1|  PREDICTED: uncharacterized protein LOC103329...    102   2e-22   
ref|XP_010657274.1|  PREDICTED: mpv17-like protein                      102   2e-22   Vitis vinifera
gb|ABF97328.1|  peroxisomal membrane protein, putative, expressed       102   2e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27617.1|  hypothetical protein OsJ_11561                          102   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050563.1|  Os03g0583800                                       102   3e-22   
gb|EEC75642.1|  hypothetical protein OsI_12389                          102   3e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_007217251.1|  hypothetical protein PRUPE_ppa007825mg             102   4e-22   Prunus persica
ref|XP_010095804.1|  Protein SYM1                                       102   5e-22   Morus notabilis
ref|XP_008230248.1|  PREDICTED: mpv17-like protein isoform X2           101   6e-22   
ref|XP_008230247.1|  PREDICTED: mpv17-like protein isoform X1           101   6e-22   
ref|NP_001151402.1|  mpv17 / PMP22 family protein                       101   6e-22   Zea mays [maize]
ref|XP_006366011.1|  PREDICTED: protein SYM1-like                       101   7e-22   Solanum tuberosum [potatoes]
ref|XP_006650305.1|  PREDICTED: peroxisomal membrane protein 2-like     100   7e-22   Oryza brachyantha
dbj|BAJ94190.1|  predicted protein                                      101   7e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009357078.1|  PREDICTED: uncharacterized protein LOC103947838    101   8e-22   Pyrus x bretschneideri [bai li]
gb|KDP24169.1|  hypothetical protein JCGZ_25826                         100   1e-21   Jatropha curcas
ref|XP_004248154.1|  PREDICTED: protein SYM1                            100   1e-21   Solanum lycopersicum
ref|XP_008379554.1|  PREDICTED: uncharacterized protein LOC103442533    100   1e-21   
gb|ADM21186.1|  peroxisomal membrane-like protein                     99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039752.1|  PREDICTED: uncharacterized protein LOC105136...    100   1e-21   Populus euphratica
ref|XP_002517962.1|  Peroxisomal membrane protein, putative             100   1e-21   
ref|XP_009134349.1|  PREDICTED: protein SYM1                            100   1e-21   Brassica rapa
ref|XP_004982515.1|  PREDICTED: uncharacterized protein LOC101756875    100   1e-21   
emb|CDY48204.1|  BnaCnng15950D                                          100   1e-21   Brassica napus [oilseed rape]
ref|XP_006371588.1|  hypothetical protein POPTR_0019s13430g             100   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006396570.1|  hypothetical protein EUTSA_v10028802mg             100   2e-21   Eutrema salsugineum [saltwater cress]
emb|CDX90887.1|  BnaA03g25670D                                          100   2e-21   
ref|XP_011039751.1|  PREDICTED: protein SYM1 isoform X1                 100   2e-21   Populus euphratica
gb|AFW68287.1|  hypothetical protein ZEAMMB73_230689                  99.8    2e-21   
gb|EMT03498.1|  Peroxisomal membrane protein 2                        99.0    2e-21   
gb|KCW89501.1|  hypothetical protein EUGRSUZ_A01792                   99.4    2e-21   Eucalyptus grandis [rose gum]
ref|NP_001136458.1|  hypothetical protein                               100   2e-21   
ref|XP_003562336.1|  PREDICTED: uncharacterized protein LOC100846887    100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_008681255.1|  PREDICTED: hypothetical protein isoform X2         100   2e-21   
ref|XP_002466876.1|  hypothetical protein SORBIDRAFT_01g015680          100   2e-21   Sorghum bicolor [broomcorn]
ref|XP_004487310.1|  PREDICTED: protein SYM1-like isoform X1          99.8    3e-21   
gb|KJB79963.1|  hypothetical protein B456_013G074900                  99.4    3e-21   Gossypium raimondii
ref|XP_010422462.1|  PREDICTED: LOW QUALITY PROTEIN: mpv17-like p...  99.8    3e-21   
gb|AAD11583.1|  hypothetical protein                                  98.6    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79962.1|  hypothetical protein B456_013G074900                  99.4    3e-21   Gossypium raimondii
ref|XP_004487311.1|  PREDICTED: protein SYM1-like isoform X2          99.4    3e-21   Cicer arietinum [garbanzo]
ref|NP_974505.1|  peroxisomal membrane (Mpv17/PMP22) family protein   99.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79961.1|  hypothetical protein B456_013G074900                  99.0    5e-21   Gossypium raimondii
gb|KJB79964.1|  hypothetical protein B456_013G074900                  99.0    5e-21   Gossypium raimondii
ref|XP_010522636.1|  PREDICTED: protein SYM1                          98.6    6e-21   Tarenaya hassleriana [spider flower]
gb|AAP40491.1|  unknown protein                                       98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874865.1|  hypothetical protein ARALYDRAFT_490222           98.6    6e-21   
ref|NP_192250.2|  peroxisomal membrane (Mpv17/PMP22) family protein   98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051684.1|  PREDICTED: uncharacterized protein LOC104440...  98.2    7e-21   Eucalyptus grandis [rose gum]
gb|KHG05370.1|  Peroxisomal membrane 2                                98.6    8e-21   Gossypium arboreum [tree cotton]
ref|XP_011085340.1|  PREDICTED: peroxisomal membrane protein 2        98.6    8e-21   Sesamum indicum [beniseed]
ref|XP_007043533.1|  Peroxisomal membrane 22 kDa family protein       99.4    8e-21   
ref|XP_008353524.1|  PREDICTED: PXMP2/4 family protein 1-like         98.6    8e-21   Malus domestica [apple tree]
gb|EMS63851.1|  Peroxisomal membrane protein 2                        97.1    9e-21   Triticum urartu
ref|XP_010051673.1|  PREDICTED: uncharacterized protein LOC104440...  98.2    1e-20   
ref|XP_010455892.1|  PREDICTED: protein SYM1-like                     97.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006288235.1|  hypothetical protein CARUB_v10001476mg           97.4    1e-20   Capsella rubella
gb|KFK30935.1|  hypothetical protein AALP_AA6G045100                  96.7    3e-20   Arabis alpina [alpine rockcress]
gb|KEH39092.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  96.3    4e-20   Medicago truncatula
gb|EYU26133.1|  hypothetical protein MIMGU_mgv1a009627mg              96.3    4e-20   Erythranthe guttata [common monkey flower]
gb|KEH39090.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  96.3    4e-20   Medicago truncatula
gb|KEH39091.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  96.3    5e-20   Medicago truncatula
gb|EMT31197.1|  Peroxisomal membrane protein 2                        94.7    6e-20   
gb|ACU17682.1|  unknown                                               93.6    9e-20   Glycine max [soybeans]
ref|XP_004155526.1|  PREDICTED: uncharacterized protein LOC101223761  95.5    1e-19   
ref|XP_004137017.1|  PREDICTED: uncharacterized protein LOC101214701  95.5    1e-19   Cucumis sativus [cucumbers]
ref|XP_004304121.1|  PREDICTED: protein SYM1                          95.1    1e-19   Fragaria vesca subsp. vesca
ref|XP_007149878.1|  hypothetical protein PHAVU_005G106400g           94.7    1e-19   Phaseolus vulgaris [French bean]
gb|ACJ84916.1|  unknown                                               93.6    1e-19   Medicago truncatula
ref|XP_008455339.1|  PREDICTED: mpv17-like protein                    95.1    1e-19   Cucumis melo [Oriental melon]
ref|XP_003543349.1|  PREDICTED: peroxisomal membrane protein 2        94.7    1e-19   Glycine max [soybeans]
dbj|BAD34004.1|  peroxisomal membrane protein-like                    94.7    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KHN36615.1|  Peroxisomal membrane protein 2                        95.1    2e-19   Glycine soja [wild soybean]
gb|EMS63743.1|  Protein SYM1                                          93.6    2e-19   Triticum urartu
emb|CDP14740.1|  unnamed protein product                              92.4    9e-19   Coffea canephora [robusta coffee]
gb|KHN04274.1|  Peroxisomal membrane protein 2                        92.0    1e-18   Glycine soja [wild soybean]
ref|XP_003539526.1|  PREDICTED: peroxisomal membrane protein 2-like   92.0    1e-18   
gb|EEE59409.1|  hypothetical protein OsJ_11557                        86.7    3e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001765838.1|  predicted protein                                79.3    1e-14   
ref|XP_002530181.1|  conserved hypothetical protein                   79.7    2e-14   
ref|XP_001774069.1|  predicted protein                                78.2    5e-14   
ref|XP_002966359.1|  hypothetical protein SELMODRAFT_66864            65.9    8e-10   
ref|XP_002978201.1|  hypothetical protein SELMODRAFT_56885            64.7    2e-09   
ref|XP_006374188.1|  hypothetical protein POPTR_0015s04090g           60.8    1e-08   
gb|EMT24041.1|  hypothetical protein F775_24733                       57.8    2e-07   
gb|KJB62727.1|  hypothetical protein B456_009G432500                  58.5    6e-07   Gossypium raimondii
ref|XP_008363403.1|  PREDICTED: beta-glucosidase 13-like              57.4    2e-06   
gb|ADM25596.1|  peroxisomal membrane-like protein                     47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25574.1|  peroxisomal membrane-like protein                     47.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25570.1|  peroxisomal membrane-like protein                     47.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EWM27713.1|  peroxisomal membrane 22 kda (mpv17 pmp22) family ...  50.4    5e-04   Nannochloropsis gaditana
gb|ADM25609.1|  peroxisomal membrane-like protein                     46.6    7e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25608.1|  peroxisomal membrane-like protein                     46.6    7e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ADM25601.1|  peroxisomal membrane-like protein                     46.2    8e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009769985.1| PREDICTED: uncharacterized protein LOC104220752 [Nicotiana sylvestris]
Length=375

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 136/203 (67%), Gaps = 18/203 (9%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  219
            MATINGL +PQ   SLSKP PK  S SHFKP K Q+  + + +Q           + A E
Sbjct  1    MATINGLTSPQPFLSLSKPKPKP-SYSHFKPLKPQILSKGLKQQNQQLRDWAVVGSVANE  59

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             D+IPVQS+D+TDQQ GVV   ERE EGG D+D +   V   G  G   RLSFE     G
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPEGG-DMDLVNQVVGGFGNEG---RLSFE-----G  110

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            ++   SS++S S G   +  M +V+DRAINATIVLAAG+FAIT LLTI H+YWHGWT++E
Sbjct  111  AAGGFSSSSSGSNGKLEQEDMNRVIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTVYE  170

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNW AYEEALK NPVL
Sbjct  171  ILRYAPQHNWIAYEEALKRNPVL  193



>ref|XP_009594216.1| PREDICTED: uncharacterized protein LOC104090749 [Nicotiana tomentosiformis]
Length=375

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 135/203 (67%), Gaps = 18/203 (9%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  219
            M+TINGL +PQ   SL KP P   S SHFKP K ++  + + +Q          ++ A E
Sbjct  1    MSTINGLTSPQPFLSLPKPKPNP-SYSHFKPLKPRILSKGLKQQNQQLRDWAVVSSVANE  59

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             D+IPVQS+D+TDQQ GVV   ERE EGG D+D +   V   G  G   RLSFEG     
Sbjct  60   TDLIPVQSNDTTDQQSGVVIGLEREPEGG-DMDLVNQVVGGFGNEG---RLSFEG-----  110

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            ++    S++S S G   +  M++V+DRAINATIVLAAG+FAIT LLTI H+YWHGWT++E
Sbjct  111  AAGGFRSSSSGSNGKSEQEDMDRVIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTIYE  170

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNW AYEEALK NPVL
Sbjct  171  ILRYAPQHNWIAYEEALKRNPVL  193



>ref|XP_006360143.1| PREDICTED: uncharacterized protein LOC102590255 [Solanum tuberosum]
Length=371

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 126/204 (62%), Gaps = 24/204 (12%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  219
            MATINGL +PQ   SL K N K    S  KP K Q   + + +Q           +   E
Sbjct  1    MATINGLTSPQPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWVVVGSVTNE  59

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  396
             DVIPVQS+D TDQQ GVV   ERE E GGG++D +   V   G  G   RLSFEG  GF
Sbjct  60   ADVIPVQSTDVTDQQNGVVIGLEREPELGGGEMDIVNQVVGGFGNEG---RLSFEGAGGF  116

Query  397  gsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLF  576
             S+S    +            +EK++DRAINATIVLAAG+FAIT LLTI H+YWHGWTLF
Sbjct  117  SSASGVGGSD-----------VEKLIDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLF  165

Query  577  EILRYAPXHNWSAYEEALKENPVL  648
            EILRYAP HNW AYEEALK NPVL
Sbjct  166  EILRYAPQHNWVAYEEALKRNPVL  189



>emb|CDP05871.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 124/209 (59%), Gaps = 21/209 (10%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT-KLQLFPRPV----------SKQFAAAA  210
            MA+IN L TPQT  SL  P PK+      KPT K+Q FP P           S     + 
Sbjct  1    MASINSLTTPQTFLSL--PKPKSSLCFQPKPTSKIQSFPHPFNLLLSKHHKDSSFIVGSV  58

Query  211  AKELDVIPVQSSDSTDQQGGVVDA-TEREAEG--GGDIDSIvnqvvvvggfgnegRLSFE  381
            + E D+IPVQSSD TDQQ GV+    E E EG  G DI        VV GF N+GRLSFE
Sbjct  59   SNEPDIIPVQSSDYTDQQDGVLGGIVEIETEGLSGEDI-----LNQVVNGFSNKGRLSFE  113

Query  382  GPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
              T            SS  G   E  ME+++D AINA+IVLAAGTFA+T LLTI  +YWH
Sbjct  114  AATSSSGYCGGGGTGSSVEGEKGEQEMERLMDSAINASIVLAAGTFAVTKLLTIDSDYWH  173

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWTL+EILRY P HNWSAYEEALK NPV 
Sbjct  174  GWTLYEILRYVPQHNWSAYEEALKTNPVF  202



>ref|XP_010545803.1| PREDICTED: uncharacterized protein LOC104818056 [Tarenaya hassleriana]
Length=377

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 120/203 (59%), Gaps = 16/203 (8%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKP------NPKTGSPSHFKPTKLQLFPR--PVSKQFAAAAAKE  219
            MA+++   +P++L SLSKP      +P   SP+  KP + Q+FPR   +S+   A    E
Sbjct  1    MASLHTSISPRSLLSLSKPRKPTSISPPVFSPAAQKPPRTQVFPRNKQISRVPYAVVRDE  60

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
            LDVIPVQS D TDQQ GVV         G D                EGRLSFEG +   
Sbjct  61   LDVIPVQSGDRTDQQEGVVVVGGEAEREGSDAQ---VAGFGGAAAAGEGRLSFEGFSS--  115

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
               S+               MEK++DR INATIVLAAG++AIT LLTI H+YWHGWTLFE
Sbjct  116  ---SAVVTDDGEERRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFE  172

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNW+AYEEALK NP+L
Sbjct  173  ILRYAPQHNWTAYEEALKRNPIL  195



>ref|XP_004244201.1| PREDICTED: uncharacterized protein LOC101247444 [Solanum lycopersicum]
Length=376

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 116/204 (57%), Gaps = 19/204 (9%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQ--------FAAAAAKE  219
            MATINGL +P    SL K N K    S  KP K Q   + + +Q           + + E
Sbjct  1    MATINGLTSPHPFLSLQKSNSKP-FLSLSKPMKSQFLFKGLKQQNQQLRDWAVVGSVSNE  59

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAE-GGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  396
             D I VQSSD  DQQ GVV   ERE + GGGD+  +   V              EG   F
Sbjct  60   ADEIRVQSSDVMDQQNGVVIGLEREPKLGGGDMGIVNQVVGG---------FGNEGRLSF  110

Query  397  gsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLF  576
                  SSA+   G    E  +EK++DR INATIVLAAG+FAIT LLTI H+YWHGWTLF
Sbjct  111  EGGGGFSSASGVGGSESKEEDVEKLIDRTINATIVLAAGSFAITKLLTIDHDYWHGWTLF  170

Query  577  EILRYAPXHNWSAYEEALKENPVL  648
            EILRYAP HNW AYEEALK NPVL
Sbjct  171  EILRYAPQHNWVAYEEALKRNPVL  194



>ref|XP_010268765.1| PREDICTED: uncharacterized protein LOC104605628 [Nelumbo nucifera]
Length=386

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 124/185 (67%), Gaps = 10/185 (5%)
 Frame = +1

Query  97   TLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVV  276
            T++ LS  + +    +H K        R  +     + A+ELDVIPV+SSDSTDQQ GVV
Sbjct  29   TVKGLSGSSLQNSCKAH-KSGNSGFLRRKRTDWVVLSVAEELDVIPVRSSDSTDQQDGVV  87

Query  277  DATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaass-sggagxE  453
               ERE EG          +  VGGF NEGRLSFEG   F   SSSSS++S  S   G E
Sbjct  88   ARIEREREG--------ESLNQVGGFANEGRLSFEGAGDFQGFSSSSSSSSVPSDRKGEE  139

Query  454  LGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALK  633
              ++K++DRAINATIVLAAGTFAIT LLTI H+YWHGWTL+EILRYAP HNWSAYEEALK
Sbjct  140  EDIDKLIDRAINATIVLAAGTFAITKLLTIDHDYWHGWTLYEILRYAPQHNWSAYEEALK  199

Query  634  ENPVL  648
             NPVL
Sbjct  200  TNPVL  204



>ref|XP_010092169.1| Peroxisomal membrane protein 2 [Morus notabilis]
 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis]
Length=393

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 122/209 (58%), Gaps = 31/209 (15%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKL--------QLFPRPVSK----QFAAA  207
            MA++N +  PQ+  S+SKP PK   P++  P  +         +F R   K       + 
Sbjct  1    MASVNTI-APQSFLSISKPKPK---PTNAYPKSIPCSNFPNHSIFSRNKQKVKGWALNSV  56

Query  208  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-  384
              +ELDVIPVQSSD TDQQ GVV +     EGGG    + +QV      G   R SFEG 
Sbjct  57   VNEELDVIPVQSSDGTDQQEGVVVS---RVEGGGLESELASQVGGFVSEG---RFSFEGG  110

Query  385  -PTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
               GFGS S       S         MEK+VDR INATIVLAAGT+AIT LLTI  +YWH
Sbjct  111  AELGFGSGSGVGDVRESE-------SMEKMVDRTINATIVLAAGTYAITRLLTIDQDYWH  163

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWTLFEILRYAP HNWSAYEEALK NPV 
Sbjct  164  GWTLFEILRYAPQHNWSAYEEALKTNPVF  192



>ref|XP_010644223.1| PREDICTED: uncharacterized protein LOC100253839 isoform X2 [Vitis 
vinifera]
Length=370

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 119/179 (66%), Gaps = 9/179 (5%)
 Frame = +1

Query  112  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  291
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  292  EAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagxELGMEKV  471
            E EG          V  VGGF  EGR SFEG   F   SSSSS+++SS G G    +E++
Sbjct  79   EEEG--------ELVNQVGGFSGEGRFSFEGAGEFQGFSSSSSSSTSSEGQGEAEDVERL  130

Query  472  VDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +DR+INATIVLAAG+FA+T LLTI  +YWHGWT+FEILRYAP HNWSAYEEALK NPV 
Sbjct  131  IDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYEEALKTNPVF  189



>ref|XP_002284644.1| PREDICTED: mpv17-like protein isoform X1 [Vitis vinifera]
Length=371

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 119/179 (66%), Gaps = 9/179 (5%)
 Frame = +1

Query  112  SKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATER  291
            SKP P    P    P    +F     K++  A A+ELDVIPVQSSDSTDQQ GV+   E 
Sbjct  20   SKPRPTIFLPKGL-PQTSGIFSGTNRKRWVVAVAEELDVIPVQSSDSTDQQDGVLARIEV  78

Query  292  EAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssggagxELGMEKV  471
            E EG          V  VGGF  EGR SFEG   F   SSSSS+++SS G G    +E++
Sbjct  79   EEEG--------ELVNQVGGFSGEGRFSFEGAGEFQGFSSSSSSSTSSEGQGEAEDVERL  130

Query  472  VDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +DR+INATIVLAAG+FA+T LLTI  +YWHGWT+FEILRYAP HNWSAYEEALK NPV 
Sbjct  131  IDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYEEALKTNPVF  189



>ref|XP_011098348.1| PREDICTED: mpv17-like protein isoform X2 [Sesamum indicum]
Length=376

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 123/203 (61%), Gaps = 18/203 (9%)
 Frame = +1

Query  64   MATINGLPTPQTL-RSLSKPNPKTGSPSHFKP-------TKLQLFPRPVSKQFAAAAAKE  219
            MA      TP ++ +S +KPN     PS  +P         L+   R  S Q   + A E
Sbjct  1    MAAAAASITPLSISKSKTKPN---NVPSFKQPPLPAAGKISLKSSLRRQSLQLVGSVANE  57

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             DVIPVQS D  DQQ GVV   +RE E   ++D +V             RLSFEG  GF 
Sbjct  58   FDVIPVQSDDIVDQQDGVV-CIQREGEAT-EVDQMVGGFGSEASG----RLSFEGAAGFS  111

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            S++SS+    S  G   E  ME++VDRAINATIVLAAG+FAIT LLTI H+YWHGWTL+E
Sbjct  112  SAASSAGGPGSGDGKSQE-DMERLVDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLYE  170

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNWSAYEEALK NPVL
Sbjct  171  ILRYAPQHNWSAYEEALKTNPVL  193



>ref|XP_011098346.1| PREDICTED: mpv17-like protein isoform X1 [Sesamum indicum]
Length=379

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 123/203 (61%), Gaps = 18/203 (9%)
 Frame = +1

Query  64   MATINGLPTPQTL-RSLSKPNPKTGSPSHFKP-------TKLQLFPRPVSKQFAAAAAKE  219
            MA      TP ++ +S +KPN     PS  +P         L+   R  S Q   + A E
Sbjct  1    MAAAAASITPLSISKSKTKPN---NVPSFKQPPLPAAGKISLKSSLRRQSLQLVGSVANE  57

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             DVIPVQS D  DQQ GVV   +RE E   ++D +V             RLSFEG  GF 
Sbjct  58   FDVIPVQSDDIVDQQDGVV-CIQREGEAT-EVDQMVGGFGSEASG----RLSFEGAAGFS  111

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            S++SS+    S  G   E  ME++VDRAINATIVLAAG+FAIT LLTI H+YWHGWTL+E
Sbjct  112  SAASSAGGPGSGDGKSQE-DMERLVDRAINATIVLAAGSFAITKLLTIDHDYWHGWTLYE  170

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNWSAYEEALK NPVL
Sbjct  171  ILRYAPQHNWSAYEEALKTNPVL  193



>ref|XP_011029433.1| PREDICTED: mpv17-like protein [Populus euphratica]
Length=370

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 122/204 (60%), Gaps = 28/204 (14%)
 Frame = +1

Query  73   INGLPT--PQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPRPV-SKQFAAAAAK  216
            +  LPT  P +L  LSKP         NP+  SP   K  K Q F R + S    +   +
Sbjct  1    MAALPTISPHSLLPLSKPKKTISKNLQNPQFLSP---KLPKSQAFSRNIPSWHLNSVFQE  57

Query  217  ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  396
            E+DVIPVQS DS DQQ G+V A + E EG            V G  G EG+LSFEG +  
Sbjct  58   EVDVIPVQSGDSVDQQEGMV-AIQVEREG------TELAPQVSGFGGKEGQLSFEGFSS-  109

Query  397  gsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLF  576
                 +SS+         EL  E+++DR INATIVLAAGT+AIT LLTI H+YWHGWTLF
Sbjct  110  -----ASSSGLDGETRERELESERLIDRTINATIVLAAGTYAITKLLTIDHDYWHGWTLF  164

Query  577  EILRYAPXHNWSAYEEALKENPVL  648
            EILRYAP HNWSAYEEALK NPVL
Sbjct  165  EILRYAPQHNWSAYEEALKTNPVL  188



>ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
 gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
Length=370

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 125/205 (61%), Gaps = 27/205 (13%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPRPV-SKQFAAAAA  213
            MA ++ + +P++L  LSKP         NP+  SP   K  K Q F R + S    +   
Sbjct  1    MAALHTI-SPRSLLPLSKPKKTISKNLQNPQFLSP---KLPKSQAFSRNIPSWHLNSVFQ  56

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            +E DVIPVQS DS DQQ G+V A + E EG            V G  G+EG+LSFEG + 
Sbjct  57   EEFDVIPVQSGDSVDQQEGMV-ANQVEREG------TELAPQVSGFGGSEGQLSFEGFSS  109

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTL  573
                  +SS+         EL  ++++DR INATIVLAAGT+AIT LLTI H+YWHGWTL
Sbjct  110  ------ASSSGLDGESRERELESDRLIDRTINATIVLAAGTYAITKLLTIDHDYWHGWTL  163

Query  574  FEILRYAPXHNWSAYEEALKENPVL  648
            FEILRYAP HNWSAYEEALK NPVL
Sbjct  164  FEILRYAPQHNWSAYEEALKTNPVL  188



>gb|KDP38924.1| hypothetical protein JCGZ_00681 [Jatropha curcas]
Length=375

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 124/205 (60%), Gaps = 22/205 (11%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKLQLFP-------RPVSKQFAAAAA  213
            MA+++ + +P +L  LSK   P  K    SHF  TK+   P       +  S    +   
Sbjct  1    MASLHTI-SPHSLLPLSKSKKPTSKILPNSHFLGTKILHSPIFWTNKQKTESWLLNSVVQ  59

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            +ELDVIPVQS DSTDQQ GVV  ++ E+EG            V G   NEG+LSFEG + 
Sbjct  60   EELDVIPVQSGDSTDQQDGVV-VSQVESEGN------ELATQVSGFGSNEGQLSFEGFSS  112

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTL  573
                +SS+           EL M+K +DR+INA IVLAAG++A+T LLTI H+YW GWT+
Sbjct  113  ----ASSAGMEGDGQRTQSELEMDKFIDRSINALIVLAAGSYAVTKLLTIDHDYWQGWTI  168

Query  574  FEILRYAPXHNWSAYEEALKENPVL  648
            +EILRYAP HNWSAYEEALK NPVL
Sbjct  169  YEILRYAPQHNWSAYEEALKTNPVL  193



>gb|KDO74166.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=244

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>ref|XP_006841712.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
 gb|ERN03387.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
Length=367

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 111/208 (53%), Gaps = 34/208 (16%)
 Frame = +1

Query  49   PFPPQMATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAA--------  204
            P P  + +  G   P   +S    NPK              F R  S  F A        
Sbjct  6    PKPIFLHSFKGFLDP-NFQSFRTQNPK--------------FCRAPSSNFYAGRRNWALG  50

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  384
            + + ELDVIPVQS++S DQQ GV+    REA+    ++ +              RLSFEG
Sbjct  51   SVSDELDVIPVQSNNSVDQQDGVMVRINREADEEQSLNRVGGFSNEG-------RLSFEG  103

Query  385  PTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHG  564
                        +AS S     E   +K+VDRAINATIVLAAG+FAIT LLTI H+YWHG
Sbjct  104  GV----MDVRGFSASFSSSLEIEEDGDKLVDRAINATIVLAAGSFAITKLLTIDHDYWHG  159

Query  565  WTLFEILRYAPXHNWSAYEEALKENPVL  648
            WTLFEILRYAP HNW AYEEALK NPVL
Sbjct  160  WTLFEILRYAPQHNWIAYEEALKTNPVL  187



>ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
 gb|EMJ12641.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
Length=378

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 122/211 (58%), Gaps = 31/211 (15%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKP-----------TKLQLFPRPVSKQF----  198
            MA+I+ +  PQ+   L    P+  + +H KP           +K Q F R   K      
Sbjct  1    MASIHSI-APQSFLPLPNSKPRKPTNAHPKPILSSNLCNSKLSKNQTFLRNKRKDRWILK  59

Query  199  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEG-GGDIDSIvnqvvvvggfgnegRLS  375
            +    +E DVIPVQS+D TDQQ G+      E EG  G++ S      V G   +EGRLS
Sbjct  60   SLVDQEECDVIPVQSTDCTDQQEGMA-VCRVECEGVEGELAS-----QVGGFGASEGRLS  113

Query  376  FEGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            FEG  GFGSS   +   S           E++VDR INATIVLAAGTFAIT LLTI  +Y
Sbjct  114  FEGAGGFGSSGVGNERESEE--------FERLVDRTINATIVLAAGTFAITKLLTIDQDY  165

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            WHGWTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  166  WHGWTLYEILRYAPQHNWSAYEEALKTNPVL  196



>ref|XP_008226678.1| PREDICTED: uncharacterized protein LOC103326248 [Prunus mume]
Length=378

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 121/211 (57%), Gaps = 31/211 (15%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKP-----------TKLQLFPRPVSKQF----  198
            MA+I+ +  PQ+   L    P+  + +H KP           +K Q F R   K      
Sbjct  1    MASIHSI-APQSFLPLPNSKPRKPTNAHPKPILSSNLCSSKLSKNQTFLRNKRKDRWILK  59

Query  199  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEG-GGDIDSIvnqvvvvggfgnegRLS  375
            +    +E DVIP+QS+D TDQQ G+      E EG  G++ S      V G    EGRLS
Sbjct  60   SLVDQEECDVIPLQSTDCTDQQEGMA-VCRVECEGVEGELAS-----QVGGFGATEGRLS  113

Query  376  FEGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            FEG  GFGSS   +   S           E++VDR INATIVLAAGTFAIT LLTI  +Y
Sbjct  114  FEGAGGFGSSGVGNERESEE--------FERLVDRTINATIVLAAGTFAITKLLTIDQDY  165

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            WHGWTLFEILRYAP HNWSAYEEALK NPVL
Sbjct  166  WHGWTLFEILRYAPQHNWSAYEEALKTNPVL  196



>ref|XP_011042502.1| PREDICTED: uncharacterized protein LOC105138177 [Populus euphratica]
Length=369

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 115/200 (58%), Gaps = 35/200 (18%)
 Frame = +1

Query  82   LPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSK-QFAAAAAKELDVIPVQSSDSTD  258
            LP  +T +++SK N +     + K  K+Q F R   + Q  +   +ELDV+PVQS DS D
Sbjct  13   LPLSKTKKTISK-NLQNLQLLNSKLPKIQTFSRNKQRWQLNSVVQEELDVVPVQSGDSVD  71

Query  259  QQGGVV------DATEREAE----GGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsss  408
            QQ G+V      + TE  A+    GG D                 GR SFEG +      
Sbjct  72   QQEGMVAIPVEREGTELAAQVSGFGGSD-----------------GRFSFEGFSS-----  109

Query  409  ssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILR  588
             +SS+   +     +   E+++DR INA IVL AGT+AIT LLTI HNYWHGWTLFEILR
Sbjct  110  -ASSSGIDAESIERQSESERLIDRTINAMIVLGAGTYAITKLLTIDHNYWHGWTLFEILR  168

Query  589  YAPXHNWSAYEEALKENPVL  648
            YAP HNWSAYEEALK NPVL
Sbjct  169  YAPQHNWSAYEEALKTNPVL  188



>ref|XP_010278296.1| PREDICTED: uncharacterized protein LOC104612557 [Nelumbo nucifera]
Length=379

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  384
            +  +E DVIPV+SSDSTD Q GVV   E E EGG            VGGF NEGRLS EG
Sbjct  60   SVVEEFDVIPVRSSDSTDLQNGVVARIEIEQEGGSS--------NQVGGFANEGRLSLEG  111

Query  385  PTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHG  564
               F   SSSSS+  S G    E  ++K++DRAINA IVL AGTFAIT LLTI H+YWHG
Sbjct  112  AGEFQGFSSSSSSVLSDGKGE-EDDIDKLIDRAINAAIVLVAGTFAITKLLTIDHDYWHG  170

Query  565  WTLFEILRYAPXHNWSAYEEALKENPVL  648
            WTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  171  WTLYEILRYAPQHNWSAYEEALKTNPVL  198



>ref|XP_009147654.1| PREDICTED: uncharacterized protein LOC103871177 [Brassica rapa]
Length=362

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 113/190 (59%), Gaps = 24/190 (13%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPVQSSDSTD  258
            +P++  SLSKP+ K        P + Q+F R   ++   + A    E DVIPVQS D TD
Sbjct  11   SPRSFLSLSKPSRK--------PHRSQVFLRINKRRSCVSCALVHDETDVIPVQSGDRTD  62

Query  259  QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssg  438
             + G + A   E E   D++        V       +LSFEG   F SSS ++       
Sbjct  63   HEEGSLVAMSSETER--DVNE------PVVVGFGAEQLSFEG---FPSSSPTADLGDEKS  111

Query  439  gagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAY  618
                E  MEK++DR+INATIVLAAGT+AIT LLTI H+YWHGWTLFEILRYAP HNW AY
Sbjct  112  RESEE--MEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWLAY  169

Query  619  EEALKENPVL  648
            EEALK NPVL
Sbjct  170  EEALKRNPVL  179



>gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Erythranthe guttata]
Length=392

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 117/203 (58%), Gaps = 25/203 (12%)
 Frame = +1

Query  94   QTLRSLSKPNPKTGSPSH---FKPTKLQLFPRPVSKQFA------------AAAAKELDV  228
            Q+  SL  P PK+ S +    FKP      P   S  F+             + A ELDV
Sbjct  14   QSFFSLPNPKPKSSSSNRPSSFKPQSPP--PAATSNNFSKSNRRRQSLLLICSVANELDV  71

Query  229  IPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsss  408
            IPVQS D  DQ  GVV    REAE      ++   V   G     GRLSFEG  GF S++
Sbjct  72   IPVQSEDRVDQHDGVV-CIGREAEP----TAVDQVVGGFGSDAAPGRLSFEGAAGFSSAA  126

Query  409  sss---saasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            S +   + +S  G    +  M+K++DR INATIVLAAGTFAIT LLTI H+YWHGWTL E
Sbjct  127  SGAGGPARSSGGGDGESQEEMDKLIDRTINATIVLAAGTFAITKLLTIDHDYWHGWTLLE  186

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            ILRYAP HNWSAYE ALK NPVL
Sbjct  187  ILRYAPQHNWSAYESALKTNPVL  209



>ref|XP_006392859.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
 gb|ESQ30145.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
Length=359

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 117/189 (62%), Gaps = 19/189 (10%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQSSDSTDQ  261
            +P++  SLSKP+         KP + Q+F R   + F + A    E+DVIPVQS D TD 
Sbjct  11   SPRSFLSLSKPS--------LKPHRSQIFLRNKQRDFVSRALIHDEIDVIPVQSRDRTDH  62

Query  262  QGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssgg  441
            + G V     E E     D   + VV  GG  +EGRLS EG      SSSSS+A      
Sbjct  63   EEGSVVVMSTETEK----DVNESVVVGFGGATSEGRLSLEG-----FSSSSSAADLGDER  113

Query  442  agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYE  621
                  MEK++DR+INATIVLAAGT+AIT LLTI H+YWHGWTLFEILRYAP HNW AYE
Sbjct  114  RSESEEMEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWIAYE  173

Query  622  EALKENPVL  648
            EALK NPVL
Sbjct  174  EALKRNPVL  182



>gb|KDO74165.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=316

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 109/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +        
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSS-------  109

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
                +S+        ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  110  ----ASADERRGNEEMERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>gb|KDO74164.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=314

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>emb|CDY53804.1| BnaA06g01790D [Brassica napus]
Length=373

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 112/190 (59%), Gaps = 24/190 (13%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPVQSSDSTD  258
            +P++  SLSKP+ K        P + Q+F R   ++   + A    E DVIPVQS D TD
Sbjct  11   SPRSFLSLSKPSRK--------PHRSQVFLRINKRRSCVSCALVHDETDVIPVQSGDRTD  62

Query  259  QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaasssg  438
             + G +     E E   D++        V       +LSFE   GF SSS ++       
Sbjct  63   HEEGSLVVMSSETE--RDVNE------PVVVGFGAEQLSFE---GFPSSSPTADLGDEKS  111

Query  439  gagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAY  618
                E  MEK++DR+INATIVLAAGT+AIT LLTI H+YWHGWTLFEILRYAP HNW AY
Sbjct  112  RESEE--MEKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWLAY  169

Query  619  EEALKENPVL  648
            EEALK NPVL
Sbjct  170  EEALKRNPVL  179



>gb|KDO74155.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=327

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 123/210 (59%), Gaps = 25/210 (12%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKL------------QLFPRPVSKQF  198
            MA+++   TPQ L  LSK   P  +  S S    +KL            +   R  +   
Sbjct  1    MASLHTTITPQGLLYLSKSGNPISRQASASPLTSSKLPESLTFSRNKWRKNSNRKANSVV  60

Query  199  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  378
              + A+ELDVIPVQS D TD Q GV  +       GG++ S       VGGFGNEGRLSF
Sbjct  61   VNSLAEELDVIPVQSEDVTDMQEGVAVSQVESEPAGGELAS------QVGGFGNEGRLSF  114

Query  379  EGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
            EG +  GS+S S       G       MEK++DR INATIVLAAGTFA+T LLTI HNYW
Sbjct  115  EGFSASGSASGSGFGDGEGGAE----DMEKLIDRTINATIVLAAGTFALTKLLTIDHNYW  170

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
             GWTL+EILRYAP HNWSAYEE LK NPVL
Sbjct  171  QGWTLYEILRYAPQHNWSAYEEVLKTNPVL  200



>ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
 gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
Length=391

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 123/210 (59%), Gaps = 25/210 (12%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSK---PNPKTGSPSHFKPTKL------------QLFPRPVSKQF  198
            MA+++   TPQ L  LSK   P  +  S S    +KL            +   R  +   
Sbjct  1    MASLHTTITPQGLLYLSKSGNPISRQASASPLTSSKLPESLTFSRNKWRKNSNRKANSVV  60

Query  199  AAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  378
              + A+ELDVIPVQS D TD Q GV  +       GG++ S       VGGFGNEGRLSF
Sbjct  61   VNSLAEELDVIPVQSEDVTDMQEGVAVSQVESEPAGGELAS------QVGGFGNEGRLSF  114

Query  379  EGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
            EG +  GS+S S       G       MEK++DR INATIVLAAGTFA+T LLTI HNYW
Sbjct  115  EGFSASGSASGSGFGDGEGGAE----DMEKLIDRTINATIVLAAGTFALTKLLTIDHNYW  170

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
             GWTL+EILRYAP HNWSAYEE LK NPVL
Sbjct  171  QGWTLYEILRYAPQHNWSAYEEVLKTNPVL  200



>ref|NP_564616.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAM61632.1| unknown [Arabidopsis thaliana]
 gb|AEE32861.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=306

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 120/198 (61%), Gaps = 22/198 (11%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQ  240
            A+++   +P++   LSKP+         KP + Q+  R   +   + A    E+D+IPVQ
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQILLRNKQRNCVSCALIRDEIDLIPVQ  55

Query  241  SSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            S D TD + G  VV +TE   +G   +      VV      +EG+LS EG   F SSSSS
Sbjct  56   SRDRTDHEEGSVVVMSTETAVDGNESV------VVGFSAATSEGQLSLEG---FPSSSSS  106

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +          E  MEK++DR INATIVLAAG++AIT LLTI H+YWHGWTLFEILRYA
Sbjct  107  GADLGDEKRRENE-EMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW AYEEALK+NPVL
Sbjct  166  PQHNWIAYEEALKQNPVL  183



>ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis]
 gb|KDO74156.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74157.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74158.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74159.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74160.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=365

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>gb|KDO74161.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=367

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>gb|KDO74162.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=368

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +               LSF+G +   +    
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFSDGT--------LSFDGFSSASADERR  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +             ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  117  GNEE-----------MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYEEALK NPVL
Sbjct  166  PLHNWTAYEEALKTNPVL  183



>ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAG52277.1|AC019018_14 unknown protein; 54928-56750 [Arabidopsis thaliana]
 gb|AAK60317.1|AF385726_1 At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AAN72239.1| At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AEE32862.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=366

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 120/198 (61%), Gaps = 22/198 (11%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQ  240
            A+++   +P++   LSKP+         KP + Q+  R   +   + A    E+D+IPVQ
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQILLRNKQRNCVSCALIRDEIDLIPVQ  55

Query  241  SSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            S D TD + G  VV +TE   +G   +      VV      +EG+LS EG   F SSSSS
Sbjct  56   SRDRTDHEEGSVVVMSTETAVDGNESV------VVGFSAATSEGQLSLEG---FPSSSSS  106

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
             +          E  MEK++DR INATIVLAAG++AIT LLTI H+YWHGWTLFEILRYA
Sbjct  107  GADLGDEKRRENE-EMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  165

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW AYEEALK+NPVL
Sbjct  166  PQHNWIAYEEALKQNPVL  183



>ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
 gb|ABK96261.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP66878.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
Length=369

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 117/215 (54%), Gaps = 47/215 (22%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKP---------NPKTGSPSHFKPTKLQLFPR-PVSKQFAAAAA  213
            MA ++ + +P  L SLSK          NP+  SP   K  K Q F R   S    +   
Sbjct  1    MAALHAI-SPHGLLSLSKTKKTISKSLQNPQFLSP---KLPKSQTFCRNKQSWHLNSVVQ  56

Query  214  KELDVIPVQSSDSTDQQGGVV------DATEREAE----GGGDIDSIvnqvvvvggfgne  363
            +ELDVIPVQS DS DQQ G++      + TE  A+    GG D                 
Sbjct  57   EELDVIPVQSGDSVDQQEGMLAIPVEREGTELAAQVSGFGGSD-----------------  99

Query  364  gRLSFEGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTI  543
            G+ SFEG +       +SS+         +   E+++DR INA IVL AGT+AIT LLTI
Sbjct  100  GQFSFEGFSS------ASSSGIDGESIDRQSESERLIDRTINAMIVLGAGTYAITKLLTI  153

Query  544  XHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
             HNYWHGWTLFEILRYAP HNWSAYEEALK NPVL
Sbjct  154  DHNYWHGWTLFEILRYAPQHNWSAYEEALKTNPVL  188



>ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306984 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 124/210 (59%), Gaps = 30/210 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT-----------KLQLFP-RPVSKQFAAA  207
            MA+I+ +  PQ+  +L  P P+     H KPT           K Q FP R  ++   + 
Sbjct  1    MASIHAI-APQSFLNLPNPKPRKPITPHSKPTSSSNLYTLKPPKTQSFPSRKPTRVLTSV  59

Query  208  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  387
            A    DVIPVQSSD  DQQ G+V  +  E EG   ++S      V G   +EGRLSFE  
Sbjct  60   ADHHHDVIPVQSSDCVDQQEGMV-VSRAECEG---VES-ELASQVGGFGASEGRLSFE--  112

Query  388  TGFgsssssssaasssggagxELGME---KVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
                    +    SSS G G E G E   ++VDR+INATIVLAAG+FA+T LLTI  +YW
Sbjct  113  -------GAGGFGSSSSGVGNERGNEELYRLVDRSINATIVLAAGSFALTKLLTIDQDYW  165

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            HGWT++EILRYAP HNW+AYEEALK NPVL
Sbjct  166  HGWTIYEILRYAPQHNWTAYEEALKANPVL  195



>ref|XP_010060525.1| PREDICTED: uncharacterized protein LOC104448413 [Eucalyptus grandis]
 gb|KCW67301.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=373

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 117/203 (58%), Gaps = 21/203 (10%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFP-----RPVS---KQFAAAAAKE  219
            MA+I    +P++L  L K  P    P    P KL   P     RP     +  A +  +E
Sbjct  1    MASI----SPRSLLPLPKMGPNPLHPPSLSPAKLAKLPPFPRNRPRLGGLRLVANSVVEE  56

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             DVIPVQS DSTDQQ G+  + ER  E    +  +       G      +  F+G   F 
Sbjct  57   FDVIPVQSGDSTDQQEGLSVSLERAGEAAELVSQVGGFATSEG------QFPFDG---FS  107

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            S+SS +S++SS        GM +++DR+IN  IVLAAGT+AIT LLTI  +YWHGWT++E
Sbjct  108  SASSGASSSSSGVEKDGSEGMARLIDRSINGMIVLAAGTYAITKLLTIDSDYWHGWTIYE  167

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            I+RYAP HNWSAYEEALK NPVL
Sbjct  168  IVRYAPLHNWSAYEEALKTNPVL  190



>gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=381

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 117/203 (58%), Gaps = 21/203 (10%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFP-----RPVS---KQFAAAAAKE  219
            MA+I    +P++L  L K  P    P    P KL   P     RP     +  A +  +E
Sbjct  1    MASI----SPRSLLPLPKMGPNPLHPPSLSPAKLAKLPPFPRNRPRLGGLRLVANSVVEE  56

Query  220  LDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFg  399
             DVIPVQS DSTDQQ G+  + ER  E    +  +       G      +  F+G   F 
Sbjct  57   FDVIPVQSGDSTDQQEGLSVSLERAGEAAELVSQVGGFATSEG------QFPFDG---FS  107

Query  400  sssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFE  579
            S+SS +S++SS        GM +++DR+IN  IVLAAGT+AIT LLTI  +YWHGWT++E
Sbjct  108  SASSGASSSSSGVEKDGSEGMARLIDRSINGMIVLAAGTYAITKLLTIDSDYWHGWTIYE  167

Query  580  ILRYAPXHNWSAYEEALKENPVL  648
            I+RYAP HNWSAYEEALK NPVL
Sbjct  168  IVRYAPLHNWSAYEEALKTNPVL  190



>ref|XP_003539587.1| PREDICTED: uncharacterized protein LOC100805057 [Glycine max]
Length=375

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 122/204 (60%), Gaps = 20/204 (10%)
 Frame = +1

Query  64   MATINGLPTPQT-LRSLSKPNPK-------TGSPSHFKPTKLQLFPRPVSKQFAA-AAAK  216
            MA+++    P+T L S+ KP           G   +F+     L      +  AA +AA+
Sbjct  1    MASVHSTVAPRTFLPSIPKPRAPLHAAKFVAGGAHNFRRLSRNLILSGNKRAVAANSAAE  60

Query  217  ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGF  396
            E DVI VQS D TDQQ GVV    R    GGD +       V G   NEG LS EG    
Sbjct  61   EFDVISVQSDDITDQQEGVV--VSRVEMEGGDCE---LATQVSGFGANEGLLSLEG----  111

Query  397  gsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLF  576
               SSSSS++SS  G   E  MEK++DR INATIVLAAGTFA+T LLTI  +YWHGWTL+
Sbjct  112  --FSSSSSSSSSLVGNESEEDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWHGWTLY  169

Query  577  EILRYAPXHNWSAYEEALKENPVL  648
            EILRYAP HNWSAYEEALK NPVL
Sbjct  170  EILRYAPQHNWSAYEEALKTNPVL  193



>ref|XP_008366686.1| PREDICTED: uncharacterized protein LOC103430324 [Malus domestica]
Length=374

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 118/205 (58%), Gaps = 23/205 (11%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  213
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  1    MAAIHSIAA-QSFLSLPNPKPRKPIAAHPKPILTSKLPKNPTFPRNKQKSRWVLNSAVER  59

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            +E DVIPV SSD TDQQ GVV A+  E+EGG   D       V G   +EGRLSFE    
Sbjct  60   EECDVIPVHSSDRTDQQEGVV-ASRVESEGG---DQGELVSQVGGFGASEGRLSFE----  111

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTL  573
                 +    +S  G        E++VDR INA IVLAAGTFA+T L+T+  +YWHGWTL
Sbjct  112  ----GAGGFGSSGVGSERESEEFERLVDRTINAAIVLAAGTFALTKLVTVDQDYWHGWTL  167

Query  574  FEILRYAPXHNWSAYEEALKENPVL  648
            +EILRYAP HNWSAYE+ALK NPVL
Sbjct  168  YEILRYAPQHNWSAYEDALKTNPVL  192



>ref|XP_010462139.1| PREDICTED: uncharacterized protein LOC104742787 [Camelina sativa]
Length=370

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 117/199 (59%), Gaps = 21/199 (11%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  237
            A+++   +P++   LSKP       S  KP + Q+  R   ++   + A    E+DVIPV
Sbjct  5    ASLHTSISPRSFLPLSKP-------SLMKPHRSQILLRKNKQRSCVSCALIRDEIDVIPV  57

Query  238  QSSDSTD-QQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgssss  411
            QS D TD ++G VV  +  E E  G+    V          ++G+LS EG P+  G+   
Sbjct  58   QSRDHTDHEEGSVVFMSAAETERDGN--EAVVVGFGPAATTSDGQLSLEGFPSSSGADLG  115

Query  412  sssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRY  591
                  +         MEK++DR INATIVLAAG++AIT LLTI H+YWHGWTLFEILRY
Sbjct  116  DEKRRENEE-------MEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRY  168

Query  592  APXHNWSAYEEALKENPVL  648
            AP HNW AYEEALK+NPVL
Sbjct  169  APQHNWIAYEEALKQNPVL  187



>ref|XP_006451945.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65185.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=317

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 111/198 (56%), Gaps = 27/198 (14%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
            SSA++       E+G  +++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYE ALK NPVL
Sbjct  169  PLHNWTAYEAALKTNPVL  186



>ref|XP_010924061.1| PREDICTED: uncharacterized protein LOC105046999 isoform X2 [Elaeis 
guineensis]
Length=328

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 120/210 (57%), Gaps = 25/210 (12%)
 Frame = +1

Query  55   PPQMATINGLPTPQTLRSLSKPNPK------TGSPSHFKPTKLQLFPRPVSKQFAAAAAK  216
            P +   +   P P +L S SKP         T +P  ++P + +   R ++   +  AA+
Sbjct  10   PSRFLPLPSRPRPSSLPSTSKPCLSSSRFHGTLAPPPWRPDRAR---RDLAVAASGTAAE  66

Query  217  ELDVIPVQSSDSTDQQGGVVDA---TEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  387
            +LDVIPV+S DSTD+Q GVV      E+E E GG   S              G  +FE  
Sbjct  67   DLDVIPVKSPDSTDRQDGVVAVGAVREQEDEDGGGSSS----------HNQVGGFAFENG  116

Query  388  TGFgsssssssaasssggagx-ELG--MEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
               G +     +  SS  +   E G  +E++VDRAINA IVLAAGT+AIT LLTI  +YW
Sbjct  117  GVGGVTGGGGGSLYSSPLSSSLEEGEDVERLVDRAINAAIVLAAGTYAITKLLTIDRDYW  176

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            HGWTL+EILRYAP HNW+AYEEALK NPVL
Sbjct  177  HGWTLYEILRYAPQHNWTAYEEALKTNPVL  206



>ref|XP_010500911.1| PREDICTED: mpv17-like protein [Camelina sativa]
Length=370

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 111/198 (56%), Gaps = 17/198 (9%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  237
            AT   L T  + RS     P+   PS  KP + Q+  R   ++   + A    E DV+PV
Sbjct  3    ATAASLHTSISPRSF----PRLSKPSLMKPHRSQILLRKNKQRSCVSCALIRDETDVLPV  58

Query  238  QSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssss  414
            QS D TD + G +     E E  G+    V          +EG+LS EG P+  G+    
Sbjct  59   QSRDRTDHEEGSLVLMSVETERDGN--EAVVVGFGAAATTSEGQLSLEGFPSSSGADLGD  116

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
                 +         M+K++DR INATIVLAAG++AIT LLTI H+YWHGWTLFEILRYA
Sbjct  117  EKRRENEE-------MDKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  169

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW AYEEALK+NPVL
Sbjct  170  PQHNWIAYEEALKQNPVL  187



>gb|KJB62720.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=316

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 119/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNP---KTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_010479814.1| PREDICTED: uncharacterized protein LOC104758621 [Camelina sativa]
Length=367

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 117/198 (59%), Gaps = 22/198 (11%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA---KELDVIPV  237
            A+++   +P++   LSKP       S  KP + Q   R   ++   + A    E+DVIPV
Sbjct  5    ASLHTSISPRSFLPLSKP-------SLMKPHRSQTLLRKNKQRSCVSCALIRDEVDVIPV  57

Query  238  QSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssss  414
            QS D TD +  ++ A   E E  G+ +++V   V      +EG+LS EG P+        
Sbjct  58   QSRDRTDHEVVLMSA---ETERDGN-EAVVVGFVPAATTTSEGQLSLEGFPSS-------  106

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
            S A            MEK++DR INATIVLAAG++AIT LLTI H+YWHGWTLFEILRYA
Sbjct  107  SGADLGDEKRRENEEMEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYA  166

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW AYEEALK+NPVL
Sbjct  167  PQHNWIAYEEALKQNPVL  184



>gb|KJB62723.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=317

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 119/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNP---KTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=368

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 111/198 (56%), Gaps = 27/198 (14%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
            SSA++       E+G  +++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYE ALK NPVL
Sbjct  169  PLHNWTAYEAALKTNPVL  186



>gb|KJB62724.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=339

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 119/209 (57%), Gaps = 25/209 (12%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +               LSFE
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGGFSNEGM-------LSFE  113

Query  382  GPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            G +    SS S S      G G +  +++++DR INATIVLAAGT+AIT LLTI  NYW 
Sbjct  114  GVS----SSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNYWQ  169

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  170  GWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_004487676.1| PREDICTED: uncharacterized protein LOC101505712 [Cicer arietinum]
Length=366

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 126/206 (61%), Gaps = 28/206 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLR-SLSKPNPKTGSPSHFKPTKLQLFP------RPVSKQFAAA---AA  213
            MA+++    PQ+   S+SKP  K  S S     KLQ FP       P++K+   +   +A
Sbjct  1    MASVHSTVPPQSFFPSISKPKSKPNSIS-----KLQNFPASIFSTNPINKRVMVSTKSSA  55

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFEGPT  390
            +E DVI VQS D TDQQ G++     E EGG G++ +      V G   NEG LS EG  
Sbjct  56   EEFDVITVQSDDVTDQQEGLM-VRRVEMEGGDGELAT-----QVNGFGANEGLLSLEG--  107

Query  391  GFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWT  570
                 SSS  ++S   G   E  +EK++DR INA+IVLAAGTFA+T LLTI  +YWHGWT
Sbjct  108  ----FSSSPPSSSGLVGNENEESVEKLLDRTINASIVLAAGTFALTKLLTIDSDYWHGWT  163

Query  571  LFEILRYAPXHNWSAYEEALKENPVL  648
            ++EI+RYAP HNWSAYEEALK NPV 
Sbjct  164  IYEIVRYAPQHNWSAYEEALKTNPVF  189



>ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=380

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 111/198 (56%), Gaps = 27/198 (14%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGS--PSHF----KPTKLQLFPRPVSKQFAA-----AAAKELDVIP  234
            +PQTL S+SKPN       PSH     K ++   F R   ++  +        +ELDV+P
Sbjct  5    SPQTLLSISKPNKPNSKQLPSHACLLSKLSQNPNFSRNKQRKLNSWVVNSVVNEELDVLP  64

Query  235  VQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssss  414
            VQS D TD Q GVV   E + E    +  +                  +G   F   SS+
Sbjct  65   VQSQDLTDMQEGVVVGREEDGELASQVSQVSGFS--------------DGTLSFDGFSSA  110

Query  415  ssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYA  594
            SSA++       E+G  +++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYA
Sbjct  111  SSASADERRGNEEMG--RLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYA  168

Query  595  PXHNWSAYEEALKENPVL  648
            P HNW+AYE ALK NPVL
Sbjct  169  PLHNWTAYEAALKTNPVL  186



>ref|XP_010924060.1| PREDICTED: uncharacterized protein LOC105046999 isoform X1 [Elaeis 
guineensis]
Length=389

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 120/210 (57%), Gaps = 25/210 (12%)
 Frame = +1

Query  55   PPQMATINGLPTPQTLRSLSKPNPK------TGSPSHFKPTKLQLFPRPVSKQFAAAAAK  216
            P +   +   P P +L S SKP         T +P  ++P + +   R ++   +  AA+
Sbjct  10   PSRFLPLPSRPRPSSLPSTSKPCLSSSRFHGTLAPPPWRPDRAR---RDLAVAASGTAAE  66

Query  217  ELDVIPVQSSDSTDQQGGVVDA---TEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  387
            +LDVIPV+S DSTD+Q GVV      E+E E GG   S              G  +FE  
Sbjct  67   DLDVIPVKSPDSTDRQDGVVAVGAVREQEDEDGGGSSS----------HNQVGGFAFENG  116

Query  388  TGFgsssssssaasssggagx-ELG--MEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
               G +     +  SS  +   E G  +E++VDRAINA IVLAAGT+AIT LLTI  +YW
Sbjct  117  GVGGVTGGGGGSLYSSPLSSSLEEGEDVERLVDRAINAAIVLAAGTYAITKLLTIDRDYW  176

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            HGWTL+EILRYAP HNW+AYEEALK NPVL
Sbjct  177  HGWTLYEILRYAPQHNWTAYEEALKTNPVL  206



>ref|XP_009334618.1| PREDICTED: uncharacterized protein LOC103927419 [Pyrus x bretschneideri]
Length=379

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 114/210 (54%), Gaps = 28/210 (13%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR---PVSKQFAAAAAK------  216
            MA I+ +   Q+  SL  P P+    +H KP     FP    P +  F     K      
Sbjct  1    MAAIHSIAA-QSFPSLPNPKPRKPIAAHVKPILTCAFPTSKLPKNPTFTRNKQKSRWVLN  59

Query  217  ------ELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSF  378
                  E DVIPVQSS+ TDQQ GVV A+  E+EGG   D       V G   +EGR SF
Sbjct  60   SVVEREECDVIPVQSSNRTDQQEGVV-ASRVESEGG---DQGELVSQVGGFGASEGRFSF  115

Query  379  EGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
            E              +S  G        E++VDR INA IVLAAGTFA+T L+T+  +YW
Sbjct  116  E--------GPGGFGSSGVGSERESEEFERLVDRTINAAIVLAAGTFALTKLITVDQDYW  167

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            HGWTL+EILRYAP HNWSAYE+ALK NPVL
Sbjct  168  HGWTLYEILRYAPQHNWSAYEDALKTNPVL  197



>gb|KJB62721.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=351

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 119/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNP---KTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_003543260.1| PREDICTED: uncharacterized protein LOC100786706 [Glycine max]
Length=376

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 103/149 (69%), Gaps = 13/149 (9%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFE  381
            +A++E DVI VQS D TDQQ GVV  +  E EGG G++ +      V     NEG LS E
Sbjct  57   SASEEFDVISVQSEDITDQQEGVV-VSRVEMEGGDGELAT-----QVSRFGANEGLLSLE  110

Query  382  GPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            G       SSSSS +SSS      + MEK++DR INATIVLAAGTFA+T LLTI  +YWH
Sbjct  111  G------FSSSSSPSSSSLIGSESVDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWH  164

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  165  GWTLYEILRYAPQHNWSAYEEALKTNPVL  193



>ref|XP_009378494.1| PREDICTED: uncharacterized protein LOC103966976 isoform X1 [Pyrus 
x bretschneideri]
Length=380

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 120/212 (57%), Gaps = 31/212 (15%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSP--SHFKPTKLQLFPR---------PVSKQ-----  195
            MATI+ + + Q+   LS PN K   P  +H KP     FP          P +KQ     
Sbjct  1    MATIHCIAS-QSF--LSHPNHKPRKPITAHPKPISTSNFPTSKLPKNPSFPRNKQKSRWL  57

Query  196  -FAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRL  372
              +    +E DVIPVQS+D TDQ+ G V A   +++GG   D       V G   +EGRL
Sbjct  58   LNSVVEREECDVIPVQSTDCTDQKEGAVAARRADSDGG---DQGELVSQVGGFGESEGRL  114

Query  373  SFEGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHN  552
            SFE         +    +S  G        E++VDR INAT+VLAAGTFA+T L+T+  +
Sbjct  115  SFE--------GAGGFGSSGVGSERESEEFERLVDRTINATVVLAAGTFALTKLITVDQD  166

Query  553  YWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            YWHGWTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  167  YWHGWTLYEILRYAPQHNWSAYEEALKTNPVL  198



>gb|KJB62718.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=391

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 118/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_009378495.1| PREDICTED: uncharacterized protein LOC103966976 isoform X2 [Pyrus 
x bretschneideri]
Length=379

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 120/212 (57%), Gaps = 31/212 (15%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSP--SHFKPTKLQLFPR---------PVSKQ-----  195
            MATI+ + + Q+   LS PN K   P  +H KP     FP          P +KQ     
Sbjct  1    MATIHCIAS-QSF--LSHPNHKPRKPITAHPKPISTSNFPTSKLPKNPSFPRNKQKSRWL  57

Query  196  -FAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRL  372
              +    +E DVIPVQS+D TDQ+ G V A   +++GG   D       V G   +EGRL
Sbjct  58   LNSVVEREECDVIPVQSTDCTDQKEGAVAARRADSDGG---DQGELVSQVGGFGESEGRL  114

Query  373  SFEGPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHN  552
            SFE         +    +S  G        E++VDR INAT+VLAAGTFA+T L+T+  +
Sbjct  115  SFE--------GAGGFGSSGVGSERESEEFERLVDRTINATVVLAAGTFALTKLITVDQD  166

Query  553  YWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            YWHGWTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  167  YWHGWTLYEILRYAPQHNWSAYEEALKTNPVL  198



>gb|KJB62719.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62725.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=380

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 118/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>gb|KJB62726.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 118/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>gb|KJB62714.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=418

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 119/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNP---KTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>gb|KJB62715.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62716.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62717.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62722.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62728.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 118/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTG---SPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP        S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRANSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D TD Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVTDMQEGVAVSQVPRESPGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSPSGNGFGDGQGSQEELDRLIDRTINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_009397791.1| PREDICTED: uncharacterized protein LOC103982557 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 96/168 (57%), Gaps = 34/168 (20%)
 Frame = +1

Query  187  SKQFAAAAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgneg  366
            S    + A ++LDVIPVQSSDSTDQQ G++    RE +   +                  
Sbjct  56   SSVIVSVATEDLDVIPVQSSDSTDQQDGLIPMVGREQQEEEN------------------  97

Query  367  RLSFEGPT----GFgs----------ssssssaasssggagxELGMEKVVDRAINATIVL  504
              S +GP+    GF            SS     +SSS     E  M K+VDRAINA IVL
Sbjct  98   --SLQGPSSPVGGFALESGGGVMGGGSSGGVGFSSSSATVIGEEDMNKLVDRAINAAIVL  155

Query  505  AAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            AAGTFAIT LLTI   YWHGWTL+EILRYAP HNW+AYEEALK NPVL
Sbjct  156  AAGTFAITKLLTIDSEYWHGWTLYEILRYAPQHNWTAYEEALKTNPVL  203



>ref|XP_006305136.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
 gb|EOA38034.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
Length=366

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 117/201 (58%), Gaps = 30/201 (15%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKL-QLFPRPVSKQFAAAAA---KELDVIP  234
            A+++   +P++   LSK        S  KP +  Q+  R + ++   + A    E+DVIP
Sbjct  6    ASLHTSISPRSFLPLSKH-------SLLKPHRSSQILLRKIKQRNCVSCALIGDEIDVIP  58

Query  235  VQSSDSTDQQGG--VVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgss  405
            VQS D TD + G  V+ +TE E +G   +      V       +EG+LS EG P+  G  
Sbjct  59   VQSRDRTDHEDGSVVLMSTETERDGNETV-----VVGFGAAATSEGQLSLEGFPSSSGDE  113

Query  406  sssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEIL  585
                +             MEK++DR INATIVLAAG++AI+ LLTI H+YWHGWTLFEIL
Sbjct  114  KRRENEE-----------MEKMIDRTINATIVLAAGSYAISKLLTIDHDYWHGWTLFEIL  162

Query  586  RYAPXHNWSAYEEALKENPVL  648
            RYAP HNW AYEEALK+NPVL
Sbjct  163  RYAPQHNWVAYEEALKQNPVL  183



>emb|CDY26037.1| BnaC06g05870D [Brassica napus]
Length=352

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 109/192 (57%), Gaps = 38/192 (20%)
 Frame = +1

Query  88   TPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAA--KELDVIPVQSSDSTDQ  261
            +P++   LSKP+PK        P + Q+F R   +   + A    E DVIPV+S D    
Sbjct  11   SPRSFLPLSKPSPK--------PQRSQVFLRNKQRSCVSCALINDETDVIPVKSHD----  58

Query  262  QGGVV---DATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaass  432
             G VV   + TER+                       G+LSFEG   F SSS ++     
Sbjct  59   DGSVVVMSNETERDVN----------------EPVVVGQLSFEG---FPSSSPAADMGDD  99

Query  433  sggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWS  612
                  E  M+K++DR+INATIVLAAGT+AIT LLTI H+YWHGWTLFEILRYAP HNW 
Sbjct  100  KSRESEE--MDKMIDRSINATIVLAAGTYAITKLLTIDHDYWHGWTLFEILRYAPQHNWL  157

Query  613  AYEEALKENPVL  648
            AYEEALK NPVL
Sbjct  158  AYEEALKRNPVL  169



>gb|KHN36788.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=372

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 97/149 (65%), Gaps = 17/149 (11%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGG-GDIDSIvnqvvvvggfgnegRLSFE  381
            +A++E DVI VQS D TDQQ GVV  +  E EGG G++ +               ++S  
Sbjct  57   SASEEFDVISVQSEDITDQQEGVV-VSRVEMEGGDGELAT---------------QVSGF  100

Query  382  GPTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            G      S    S++SSS      + MEK++DR INATIVLAAGTFA+T LLTI  +YWH
Sbjct  101  GANEGLLSLEGFSSSSSSLIGSESVDMEKLIDRTINATIVLAAGTFAVTKLLTIDSDYWH  160

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWTL+EILRYAP HNWSAYEEALK NPVL
Sbjct  161  GWTLYEILRYAPQHNWSAYEEALKTNPVL  189



>ref|XP_002891718.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67977.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 113/196 (58%), Gaps = 24/196 (12%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAK-ELDVIPVQS  243
            A+++   +P++   LSKP+         KP + Q+F R  +KQ   A  + E+DVIPVQS
Sbjct  4    ASLHTSISPRSFLPLSKPS--------LKPHRSQIFLR--NKQRTCALIRDEIDVIPVQS  53

Query  244  SDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG-PTGFgsssssss  420
             D TD + G V     E E     D   + VV      +EG+LS EG P+  G       
Sbjct  54   RDRTDHEEGSVVVMSTETER----DVNESVVVGFSAATSEGQLSLEGFPSSGGDLGDEKR  109

Query  421  aasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPX  600
              +           EK++DR INATIVLAAG++AIT LLTI H+YWH WTL EILRYAP 
Sbjct  110  GENEER--------EKMIDRTINATIVLAAGSYAITKLLTIDHDYWHVWTLLEILRYAPQ  161

Query  601  HNWSAYEEALKENPVL  648
            HNW AYEEALK+NPVL
Sbjct  162  HNWIAYEEALKQNPVL  177



>gb|KHF98025.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=381

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 118/211 (56%), Gaps = 29/211 (14%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPN---PKTGSPSHFKPTKL----------QLFPRPVSKQFAA  204
            MA+++   +PQ+L SL+KP     +  S S    +KL          Q   R  S     
Sbjct  1    MASLHPTISPQSLLSLTKPRKPISRHLSASSLTTSKLPEGLAFSGTKQKNKRENSVVVVK  60

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFE  381
            + A+ELDVIPVQS D  D Q GV V    RE+ GG  +  +                S E
Sbjct  61   SLAEELDVIPVQSEDVIDIQEGVAVSQAPRESSGGELVTQVGG-------------FSNE  107

Query  382  GPTGFgsssssssaasssgg--agxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNY  555
            G   F   SSS S + +  G   G +  +++++DR INATIVLAAGT+AIT LLTI  NY
Sbjct  108  GMLSFEGVSSSGSTSGNGFGDGQGSQEELDRLMDRIINATIVLAAGTYAITKLLTIDQNY  167

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            W GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  168  WQGWTIYEIVRYAPQHNWSAYEEALRTNPVL  198



>ref|XP_010921049.1| PREDICTED: uncharacterized protein LOC105044749 [Elaeis guineensis]
Length=391

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 92/157 (59%), Gaps = 17/157 (11%)
 Frame = +1

Query  199  AAAAAKELDVIPVQSSDSTDQQGGVVDAT---EREAEGGGDIDSIvnqvvvvggfgnegR  369
            +  AA++LDVIPVQS DSTDQQ GVV      E+E E GG   S              G 
Sbjct  67   SVTAAEDLDVIPVQSPDSTDQQDGVVAVAAGREQEEEDGGGSSS----------HSQVGG  116

Query  370  LSFEGPTGFgsssssssaasssggagxEL----GMEKVVDRAINATIVLAAGTFAITXLL  537
             +F+       +        SS  +   L     + + VDRAINA IVLA GTFAIT LL
Sbjct  117  FAFQSGGVGSVTGGGGGGDFSSSPSSSSLEEGEDVHRFVDRAINAAIVLAVGTFAITKLL  176

Query  538  TIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            TI  +YWHGWTL+EILRYAP HNW+AYEEALK NPVL
Sbjct  177  TIDRDYWHGWTLYEILRYAPQHNWTAYEEALKTNPVL  213



>ref|XP_007149619.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 ref|XP_007149620.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21613.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21614.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
Length=378

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 123/205 (60%), Gaps = 20/205 (10%)
 Frame = +1

Query  64   MATINGLPTPQT-LRSLSKPNPKTGSPSHFKPTKLQLFPR---------PVSKQFAAAAA  213
            M +++    P+  L S+SKP P+      F    +  FPR               A AA 
Sbjct  1    MTSVHSTVAPRAFLPSISKPKPRAPHTKSFAGGVVHDFPRFSRSCIFSGNNRAVAANAAG  60

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            ++L+VI V+S D TDQQ GV+  +  E +G   +DS      + G    EG LS EG   
Sbjct  61   EDLNVISVKSDDITDQQEGVL-VSRVEIDG---VDS-ELATRINGFGAKEGLLSLEG---  112

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTL  573
               SSSSS+++S+  G+  E  +EK++DR INATIVLAAG FAIT LLTI  +YWHGWTL
Sbjct  113  --FSSSSSTSSSALVGSESEEDVEKLIDRTINATIVLAAGAFAITKLLTIDSDYWHGWTL  170

Query  574  FEILRYAPXHNWSAYEEALKENPVL  648
            +EILRYAP HNWSAYEEALK NPVL
Sbjct  171  YEILRYAPQHNWSAYEEALKTNPVL  195



>ref|XP_008452277.1| PREDICTED: uncharacterized protein LOC103493348 isoform X2 [Cucumis 
melo]
Length=376

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 117/211 (55%), Gaps = 33/211 (16%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT---------KLQLFPRPVSKQFAA--AA  210
            MA+++    PQT  S +    +  +PSH +P          +  +F R   K   A  +A
Sbjct  1    MASVHA-TAPQTFTSFTTAK-RAPAPSHPRPAINFHVPKLPQRSIFSRNGRKSNWALNSA  58

Query  211  AKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRLSF  378
             +E DVIP++SSDSTDQQ G+ V   ER   E E G  +                  LS 
Sbjct  59   VEEFDVIPLRSSDSTDQQEGLAVGRAERDGAEGELGSAVGGFG-------------ELSL  105

Query  379  EGPTGFgsssssssaasssggagxELGMEKV-VDRAINATIVLAAGTFAITXLLTIXHNY  555
             G       SSS+S     G    E  ME+V +DR INATIVLAAG++A+T LLTI  +Y
Sbjct  106  GGAGEIQGFSSSASVGDGGGTESGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQDY  163

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            WHGWTL+EILRYAP HNWSAYEEALK +PVL
Sbjct  164  WHGWTLYEILRYAPQHNWSAYEEALKTHPVL  194



>ref|XP_008452276.1| PREDICTED: uncharacterized protein LOC103493348 isoform X1 [Cucumis 
melo]
Length=382

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 117/211 (55%), Gaps = 33/211 (16%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPT---------KLQLFPRPVSKQFAA--AA  210
            MA+++    PQT  S +    +  +PSH +P          +  +F R   K   A  +A
Sbjct  1    MASVHA-TAPQTFTSFTTAK-RAPAPSHPRPAINFHVPKLPQRSIFSRNGRKSNWALNSA  58

Query  211  AKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRLSF  378
             +E DVIP++SSDSTDQQ G+ V   ER   E E G  +                  LS 
Sbjct  59   VEEFDVIPLRSSDSTDQQEGLAVGRAERDGAEGELGSAVGGFG-------------ELSL  105

Query  379  EGPTGFgsssssssaasssggagxELGMEKV-VDRAINATIVLAAGTFAITXLLTIXHNY  555
             G       SSS+S     G    E  ME+V +DR INATIVLAAG++A+T LLTI  +Y
Sbjct  106  GGAGEIQGFSSSASVGDGGGTESGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQDY  163

Query  556  WHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            WHGWTL+EILRYAP HNWSAYEEALK +PVL
Sbjct  164  WHGWTLYEILRYAPQHNWSAYEEALKTHPVL  194



>ref|XP_010687649.1| PREDICTED: uncharacterized protein LOC104901742 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 108/194 (56%), Gaps = 7/194 (4%)
 Frame = +1

Query  67   ATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQSS  246
            ++I+ +P PQTL  L+KP            T            FA +A ++ DV+PV+S+
Sbjct  4    SSIHPIP-PQTLSPLTKPLKVKPPTHLTFTTTTL-----RRHSFAISAVRDPDVLPVKST  57

Query  247  DSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssaa  426
            D TDQ GG +     + E  G I+        + G  +  +LS EG  G  S     +  
Sbjct  58   DITDQPGGSMMIMTIQNETDGSING-GVGGGALVGGFDGQQLSLEGIGGGTSGGGGGNDG  116

Query  427  sssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHN  606
               G  G    +EK++DR IN + VLAAGTFAIT LLT+ H+YWHGWT++EILRYAP HN
Sbjct  117  GGRGNDGGGNDLEKLIDRGINVSFVLAAGTFAITKLLTVDHDYWHGWTVYEILRYAPLHN  176

Query  607  WSAYEEALKENPVL  648
            W+AYEE LK NP+ 
Sbjct  177  WNAYEEILKTNPLF  190



>gb|KGN56219.1| hypothetical protein Csa_3G100790 [Cucumis sativus]
Length=412

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 93/149 (62%), Gaps = 12/149 (8%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  384
            +A +E DVIPVQSSD TDQQ GV           G++ +           G  G LS  G
Sbjct  93   SAVEEFDVIPVQSSDFTDQQEGVALGRAERDGAEGEMGT---------AVGGFGELSLGG  143

Query  385  PTGFgsssssssaasssggagxELGMEKV-VDRAINATIVLAAGTFAITXLLTIXHNYWH  561
                   SSS+S A   G    E  ME+V +DR INATIVLAAG++A+T LLTI  +YWH
Sbjct  144  AGEIQGFSSSASVADGGGTETGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQDYWH  201

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWTL+EILRYAP HNWSAYEEALK +PVL
Sbjct  202  GWTLYEILRYAPQHNWSAYEEALKTHPVL  230



>ref|XP_008800139.1| PREDICTED: uncharacterized protein LOC103714610, partial [Phoenix 
dactylifera]
Length=351

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 94/155 (61%), Gaps = 19/155 (12%)
 Frame = +1

Query  208  AAKELDVIPVQSSDSTDQQGGVVDAT----EREAEGGGDIDSIvnqvvvvggfgnegRLS  375
            AA++L+VIPV+S DSTDQQ GVV       + E +GGG                  G  +
Sbjct  24   AAEDLNVIPVKSPDSTDQQDGVVAVAAGREQEEGDGGGS-----------SSHNEVGGFA  72

Query  376  FEGPTGFgsssssssaasssggagxELG----MEKVVDRAINATIVLAAGTFAITXLLTI  543
            FE     G ++     +  S  +   L     ++++VDRAINA IVLAAGT+AIT LLTI
Sbjct  73   FENGRVGGVTAGGGGGSLYSSPSSSSLEEGEGVDRLVDRAINAAIVLAAGTYAITKLLTI  132

Query  544  XHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
              +YW GWTL+EILRYAP HNW+AYEEALK NPVL
Sbjct  133  DSDYWQGWTLYEILRYAPQHNWTAYEEALKTNPVL  167



>ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205134 [Cucumis sativus]
 ref|XP_004171301.1| PREDICTED: uncharacterized protein LOC101228605 [Cucumis sativus]
Length=376

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 94/153 (61%), Gaps = 20/153 (13%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGV-VDATER---EAEGGGDIDSIvnqvvvvggfgnegRL  372
            +A +E DVIPVQSSD TDQQ GV +   ER   E E G  +                  L
Sbjct  57   SAVEEFDVIPVQSSDFTDQQEGVALGRAERDGAEGEMGTAVGGFG-------------EL  103

Query  373  SFEGPTGFgsssssssaasssggagxELGMEKV-VDRAINATIVLAAGTFAITXLLTIXH  549
            S  G       SSS+S A   G    E  ME+V +DR INATIVLAAG++A+T LLTI  
Sbjct  104  SLGGAGEIQGFSSSASVADGGGTETGE--MERVMIDRIINATIVLAAGSYALTKLLTIDQ  161

Query  550  NYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +YWHGWTL+EILRYAP HNWSAYEEALK +PVL
Sbjct  162  DYWHGWTLYEILRYAPQHNWSAYEEALKTHPVL  194



>gb|KEH38794.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=367

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 92/149 (62%), Gaps = 13/149 (9%)
 Frame = +1

Query  205  AAAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEG  384
             + +E DVI VQS+D TDQQ G++  +  E EGG           V G   NEG LS EG
Sbjct  54   VSTEEFDVIAVQSNDITDQQEGLI-VSRVEMEGGDGELGTTMTTQVNGFGANEGLLSLEG  112

Query  385  -PTGFgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
             P+            S   G   E  +EK++DR+INA+IVL AGTFA+T LLTI  +YWH
Sbjct  113  FPSS-----------SGLVGNENEENVEKLLDRSINASIVLVAGTFALTKLLTIDSDYWH  161

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWT++EI+RYAP HNW AYEEALK NPV 
Sbjct  162  GWTIYEIVRYAPLHNWLAYEEALKTNPVF  190



>gb|KFK35762.1| hypothetical protein AALP_AA4G033000 [Arabis alpina]
Length=352

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            MEK++DR+INATIVLAAGT+AI+ LLTI H+YWHGWTLFEILRYAP H+W AYEEALK N
Sbjct  112  MEKMIDRSINATIVLAAGTYAISKLLTIDHDYWHGWTLFEILRYAPQHSWIAYEEALKRN  171

Query  640  PVL  648
            PVL
Sbjct  172  PVL  174



>ref|XP_010675607.1| PREDICTED: protein SYM1-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 111/195 (57%), Gaps = 36/195 (18%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPRPVSKQFAAAAAKELDVIPVQS  243
            MA++  + +PQ+L  L+KP     + +H  PT++ L      ++  A A K+ D+ P +S
Sbjct  1    MASLRPI-SPQSLPPLTKP-----TKTHKPPTQITL--TTTFRRTMAVAGKD-DIFPAKS  51

Query  244  SDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTGFgsssssssa  423
            ++S    G VV        GG D                 G+LS EG  G          
Sbjct  52   AESKVMNGAVV--------GGFD-----------------GQLSLEGVPGRVGGGGGDGN  86

Query  424  asssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXH  603
               +GG G +L  +KVVDRAINATI+LAAGTFA+T LLTI H+YWHGWT++EILRYAP H
Sbjct  87   GPGNGGEGHDL--DKVVDRAINATILLAAGTFALTKLLTIDHDYWHGWTVYEILRYAPQH  144

Query  604  NWSAYEEALKENPVL  648
            NWSAYEE LK NPV 
Sbjct  145  NWSAYEELLKTNPVF  159



>gb|KDO74163.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=257

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ME+++DR INATIVLA GTFAIT LLTI  +YWHGWT+FEI+RYAP HNW+AYEEALK N
Sbjct  13   MERLIDRTINATIVLAVGTFAITKLLTIDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTN  72

Query  640  PVL  648
            PVL
Sbjct  73   PVL  75



>emb|CBI20352.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +E+++DR+INATIVLAAG+FA+T LLTI  +YWHGWT+FEILRYAP HNWSAYEEALK N
Sbjct  18   VERLIDRSINATIVLAAGSFAVTKLLTIDADYWHGWTIFEILRYAPQHNWSAYEEALKTN  77

Query  640  PVL  648
            PV 
Sbjct  78   PVF  80



>gb|EPS62403.1| hypothetical protein M569_12387, partial [Genlisea aurea]
Length=247

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++DR INATIVLAAG+FAIT LLTI H+YWHGWT +E+LRYAP HNW AYEEALK NP
Sbjct  9    KRIMDRVINATIVLAAGSFAITKLLTIDHDYWHGWTFYEVLRYAPQHNWIAYEEALKTNP  68

Query  643  VL  648
            VL
Sbjct  69   VL  70



>ref|XP_006447326.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 gb|ESR60566.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=287

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            +K++ RAINATIVL AGTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKANP  163

Query  643  VL  648
            VL
Sbjct  164  VL  165



>gb|KDO40773.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=287

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            +K++ RAINATIVL AGTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKANP  163

Query  643  VL  648
            VL
Sbjct  164  VL  165



>gb|KDO40772.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=293

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            +K++ RAINATIVL AGTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKANP  163

Query  643  VL  648
            VL
Sbjct  164  VL  165



>ref|XP_006447327.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 ref|XP_006491636.1| PREDICTED: uncharacterized protein LOC102614505 isoform X1 [Citrus 
sinensis]
 gb|ESR60567.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=346

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            +K++ RAINATIVL AGTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKANP  163

Query  643  VL  648
            VL
Sbjct  164  VL  165



>gb|KDO40771.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=346

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            +K++ RAINATIVL AGTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  104  DKLISRAINATIVLGAGTFAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKANP  163

Query  643  VL  648
            VL
Sbjct  164  VL  165



>ref|NP_001062843.2| Os09g0315000 [Oryza sativa Japonica Group]
 dbj|BAF24757.2| Os09g0315000, partial [Oryza sativa Japonica Group]
Length=88

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
             K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NP
Sbjct  10   NKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNP  69

Query  643  VL  648
            VL
Sbjct  70   VL  71



>gb|ABR17136.1| unknown [Picea sitchensis]
Length=294

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K +DRAINA +V AAG+F +T +LTI H+YWHGWTL+EI+RYAP HNW+AYEEALK NPV
Sbjct  49   KFIDRAINAAVVFAAGSFVVTKMLTIDHDYWHGWTLYEIVRYAPVHNWTAYEEALKTNPV  108

Query  646  L  648
            L
Sbjct  109  L  109



>ref|XP_008386298.1| PREDICTED: uncharacterized protein LOC103448811 [Malus domestica]
Length=246

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
             E++VDR INA ++LAAGTFA+T L+T+  +YWHGWTL+EIL YAP HNWSAYEEALK N
Sbjct  40   FERLVDRTINAAVMLAAGTFALTKLITVDQDYWHGWTLYEILWYAPQHNWSAYEEALKTN  99

Query  640  PVL  648
            PVL
Sbjct  100  PVL  102



>ref|XP_008230250.1| PREDICTED: uncharacterized protein LOC103329543 isoform X4 [Prunus 
mume]
Length=290

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_009766316.1| PREDICTED: protein SYM1 [Nicotiana sylvestris]
Length=335

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            DR +NA IVL AGTFAIT LLTI H+YWHGWT +EILRYAP HNW AYEEALK NPVL
Sbjct  96   DRFLNAAIVLGAGTFAITKLLTIDHDYWHGWTFYEILRYAPEHNWIAYEEALKTNPVL  153



>ref|XP_008230249.1| PREDICTED: uncharacterized protein LOC103329543 isoform X3 [Prunus 
mume]
Length=294

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_008230251.1| PREDICTED: uncharacterized protein LOC103329543 isoform X5 [Prunus 
mume]
Length=289

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_009623041.1| PREDICTED: protein SYM1 [Nicotiana tomentosiformis]
Length=340

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            DR +NA IVL AGTFAIT LLTI H+YWHGWT +EILRYAP HNW AYEEALK NPVL
Sbjct  101  DRFLNAAIVLGAGTFAITKLLTIDHDYWHGWTFYEILRYAPEHNWIAYEEALKTNPVL  158



>gb|ABF97329.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=306

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  179

Query  646  L  648
            L
Sbjct  180  L  180



>ref|XP_008230252.1| PREDICTED: uncharacterized protein LOC103329543 isoform X6 [Prunus 
mume]
 ref|XP_008230253.1| PREDICTED: uncharacterized protein LOC103329543 isoform X7 [Prunus 
mume]
Length=286

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_010657274.1| PREDICTED: mpv17-like protein [Vitis vinifera]
 emb|CBI28907.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
             +++  + INATIVLA GT AIT LLTI H+YWHGWTL+E+LRYAP HNW AYEEALK N
Sbjct  115  FDRLRSKTINATIVLAGGTLAITRLLTIDHDYWHGWTLYEVLRYAPEHNWVAYEEALKTN  174

Query  640  PVL  648
            PVL
Sbjct  175  PVL  177



>gb|ABF97328.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=301

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  179

Query  646  L  648
            L
Sbjct  180  L  180



>gb|EAZ27617.1| hypothetical protein OsJ_11561 [Oryza sativa Japonica Group]
Length=332

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  117  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  176

Query  646  L  648
            L
Sbjct  177  L  177



>ref|NP_001050563.1| Os03g0583800 [Oryza sativa Japonica Group]
 gb|AAS07184.1| putative peroxisomal membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF97327.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12477.1| Os03g0583800 [Oryza sativa Japonica Group]
 dbj|BAG89204.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94010.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  120  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  179

Query  646  L  648
            L
Sbjct  180  L  180



>gb|EEC75642.1| hypothetical protein OsI_12389 [Oryza sativa Indica Group]
Length=369

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  117  KMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  176

Query  646  L  648
            L
Sbjct  177  L  177



>ref|XP_007217251.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
 gb|EMJ18450.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
Length=354

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_010095804.1| Protein SYM1 [Morus notabilis]
 gb|EXB62272.1| Protein SYM1 [Morus notabilis]
Length=349

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++++  RAINA IVL  GTFAIT L TI H+YWHGWTL+E+LRYAP HNW AYE+ALK N
Sbjct  107  LDRLTSRAINAAIVLGFGTFAITKLFTIDHDYWHGWTLYEVLRYAPEHNWIAYEQALKAN  166

Query  640  PVL  648
            PVL
Sbjct  167  PVL  169



>ref|XP_008230248.1| PREDICTED: mpv17-like protein isoform X2 [Prunus mume]
Length=354

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|XP_008230247.1| PREDICTED: mpv17-like protein isoform X1 [Prunus mume]
Length=355

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  110  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  169

Query  640  PVL  648
            PVL
Sbjct  170  PVL  172



>ref|NP_001151402.1| mpv17 / PMP22 family protein [Zea mays]
 gb|ACG42715.1| mpv17 / PMP22 family protein [Zea mays]
 tpg|DAA50134.1| TPA: mpv17 / PMP22 family protein [Zea mays]
Length=353

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVLAA T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  115  KMLDRGINTAIVLAASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  174

Query  646  L  648
            L
Sbjct  175  L  175



>ref|XP_006366011.1| PREDICTED: protein SYM1-like [Solanum tuberosum]
Length=335

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            DR  NA+IVL AGT AIT LLTI H YWHGWTL+EILRYAP HNW AYEEALK NPVL
Sbjct  96   DRFFNASIVLGAGTLAITRLLTIDHEYWHGWTLYEILRYAPEHNWIAYEEALKANPVL  153



>ref|XP_006650305.1| PREDICTED: peroxisomal membrane protein 2-like [Oryza brachyantha]
Length=238

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  469  VVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            ++DR IN  IVL A T+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPVL
Sbjct  1    MLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVL  60



>dbj|BAJ94190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR INA IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  102  KMLDRGINAAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  161

Query  646  L  648
            L
Sbjct  162  L  162



>ref|XP_009357078.1| PREDICTED: uncharacterized protein LOC103947838 [Pyrus x bretschneideri]
Length=352

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  108  LDKLTSRAINALIVLGLGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  167

Query  640  PVL  648
            PV+
Sbjct  168  PVI  170



>gb|KDP24169.1| hypothetical protein JCGZ_25826 [Jatropha curcas]
Length=354

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            EK + RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK NP
Sbjct  112  EKFISRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYEQALKTNP  171

Query  643  VL  648
            VL
Sbjct  172  VL  173



>ref|XP_004248154.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
 ref|XP_010327063.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
Length=335

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            DR  NA+IVL AGT A+T LLTI H YWHGWTL+EILRYAP HNW AYEEALK NPVL
Sbjct  96   DRFFNASIVLGAGTLAVTRLLTIDHEYWHGWTLYEILRYAPEHNWIAYEEALKANPVL  153



>ref|XP_008379554.1| PREDICTED: uncharacterized protein LOC103442533 [Malus domestica]
Length=352

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  108  LDKLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  167

Query  640  PVL  648
            PV 
Sbjct  168  PVF  170



>gb|ADM21186.1| peroxisomal membrane-like protein [Arabidopsis thaliana]
Length=245

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  131  DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNP  190

Query  643  VL  648
            VL
Sbjct  191  VL  192



>ref|XP_011039752.1| PREDICTED: uncharacterized protein LOC105136210 isoform X2 [Populus 
euphratica]
Length=291

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            E++  RAINATIVL  GT A++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYEQALKANP  166

Query  643  VL  648
            VL
Sbjct  167  VL  168



>ref|XP_002517962.1| Peroxisomal membrane protein, putative [Ricinus communis]
 gb|EEF44480.1| Peroxisomal membrane protein, putative [Ricinus communis]
Length=344

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            EK++ RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK NP
Sbjct  99   EKLMTRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYEQALKSNP  158

Query  643  VL  648
            VL
Sbjct  159  VL  160



>ref|XP_009134349.1| PREDICTED: protein SYM1 [Brassica rapa]
Length=317

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LL+I H+YWHGWTL+EILRYAP HNW AYE+ LK NP
Sbjct  82   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNP  141

Query  643  VL  648
            VL
Sbjct  142  VL  143



>ref|XP_004982515.1| PREDICTED: uncharacterized protein LOC101756875 [Setaria italica]
Length=356

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K +DRAIN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  118  KALDRAINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  177

Query  646  L  648
            L
Sbjct  178  L  178



>emb|CDY48204.1| BnaCnng15950D [Brassica napus]
Length=331

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LL+I H+YWHGWTL+EILRYAP HNW AYE+ LK NP
Sbjct  84   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNP  143

Query  643  VL  648
            VL
Sbjct  144  VL  145



>ref|XP_006371588.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
 gb|ERP49385.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
Length=349

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            E++  RAINATIVL  GT A++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYEQALKANP  166

Query  643  VL  648
            VL
Sbjct  167  VL  168



>ref|XP_006396570.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
 gb|ESQ38023.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
Length=323

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LL+I H+YWHGWTL+EILRYAP HNW AYE+ LK NP
Sbjct  86   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNP  145

Query  643  VL  648
            VL
Sbjct  146  VL  147



>emb|CDX90887.1| BnaA03g25670D [Brassica napus]
Length=328

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LL+I H+YWHGWTL+EILRYAP HNW AYE+ LK NP
Sbjct  81   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNP  140

Query  643  VL  648
            VL
Sbjct  141  VL  142



>ref|XP_011039751.1| PREDICTED: protein SYM1 isoform X1 [Populus euphratica]
Length=352

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            E++  RAINATIVL  GT A++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NP
Sbjct  107  ERMTSRAINATIVLGFGTLAVSRLLTIDHDYWHGWTLYEILRYLPEHNWIAYEQALKANP  166

Query  643  VL  648
            VL
Sbjct  167  VL  168



>gb|AFW68287.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=294

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  56   KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  115

Query  646  L  648
            L
Sbjct  116  L  116



>gb|EMT03498.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  469  VVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            ++DR INA IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPVL
Sbjct  1    MLDRGINAAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVL  60



>gb|KCW89501.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=265

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++++V R INAT+VL  GT A+T LLT+ H+YW GWTL+E+LRYAP HNW AYE+ALK N
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTN  173

Query  640  PVL  648
            PVL
Sbjct  174  PVL  176



>ref|NP_001136458.1| hypothetical protein [Zea mays]
 ref|XP_008681254.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81975.1| unknown [Zea mays]
 gb|ACR38508.1| unknown [Zea mays]
 gb|ACR38595.1| unknown [Zea mays]
 gb|AFW68288.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
 gb|AFW68289.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=351

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  113  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  172

Query  646  L  648
            L
Sbjct  173  L  173



>ref|XP_003562336.1| PREDICTED: uncharacterized protein LOC100846887 [Brachypodium 
distachyon]
Length=359

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  122  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKTNPV  181

Query  646  L  648
            L
Sbjct  182  L  182



>ref|XP_008681255.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=348

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  113  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  172

Query  646  L  648
            L
Sbjct  173  L  173



>ref|XP_002466876.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
 gb|EER93874.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
Length=367

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K++DR IN  IVL A T+A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPV
Sbjct  128  KMLDRGINTAIVLGASTYALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPV  187

Query  646  L  648
            L
Sbjct  188  L  188



>ref|XP_004487310.1| PREDICTED: protein SYM1-like isoform X1 [Cicer arietinum]
Length=359

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINATIVL  G FA+T LLTI H+YWHGWTL+EILRY P HNW AYE++LK NPVL
Sbjct  84   RAINATIVLGFGAFAVTKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQSLKANPVL  140



>gb|KJB79963.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
 gb|KJB79965.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=287

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK N
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYEQALKAN  161

Query  640  PVL  648
            PV+
Sbjct  162  PVI  164



>ref|XP_010422462.1| PREDICTED: LOW QUALITY PROTEIN: mpv17-like protein [Camelina 
sativa]
Length=363

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INATIVLAAGT A+T LL+I H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  87   DRLMSRGINATIVLAAGTVAVTKLLSIDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNP  146

Query  643  VL  648
            VL
Sbjct  147  VL  148



>gb|AAD11583.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD14469.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77826.1| hypothetical protein [Arabidopsis thaliana]
Length=236

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  80   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNP  139

Query  643  VL  648
            VL
Sbjct  140  VL  141



>gb|KJB79962.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=303

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK N
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYEQALKAN  161

Query  640  PVL  648
            PV+
Sbjct  162  PVI  164



>ref|XP_004487311.1| PREDICTED: protein SYM1-like isoform X2 [Cicer arietinum]
Length=321

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINATIVL  G FA+T LLTI H+YWHGWTL+EILRY P HNW AYE++LK NPVL
Sbjct  84   RAINATIVLGFGAFAVTKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQSLKANPVL  140



>ref|NP_974505.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AEE82316.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=361

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  80   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNP  139

Query  643  VL  648
            VL
Sbjct  140  VL  141



>gb|KJB79961.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=345

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK N
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYEQALKAN  161

Query  640  PVL  648
            PV+
Sbjct  162  PVI  164



>gb|KJB79964.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=348

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK N
Sbjct  102  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPQHNWIAYEQALKAN  161

Query  640  PVL  648
            PV+
Sbjct  162  PVI  164



>ref|XP_010522636.1| PREDICTED: protein SYM1 [Tarenaya hassleriana]
Length=316

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            +++ R INA IVL AGT A+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NPV
Sbjct  78   RLMSRGINAAIVLGAGTVAVTRLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKTNPV  137

Query  646  L  648
            L
Sbjct  138  L  138



>gb|AAP40491.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01540.1| hypothetical protein [Arabidopsis thaliana]
Length=317

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  80   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNP  139

Query  643  VL  648
            VL
Sbjct  140  VL  141



>ref|XP_002874865.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51124.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  75   DQLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNP  134

Query  643  VL  648
            VL
Sbjct  135  VL  136



>ref|NP_192250.2| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AAU94426.1| At4g03410 [Arabidopsis thaliana]
 gb|AEE82315.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=317

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  80   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNP  139

Query  643  VL  648
            VL
Sbjct  140  VL  141



>ref|XP_010051684.1| PREDICTED: uncharacterized protein LOC104440441 isoform X2 [Eucalyptus 
grandis]
Length=292

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++++V R INAT+VL  GT A+T LLT+ H+YW GWTL+E+LRYAP HNW AYE+ALK N
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTN  173

Query  640  PVL  648
            PVL
Sbjct  174  PVL  176



>gb|KHG05370.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=362

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            +EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTL+E+LRY P HNW AYE+ALK N
Sbjct  105  VEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLYEVLRYVPEHNWIAYEQALKAN  164

Query  640  PVL  648
            PV+
Sbjct  165  PVI  167



>ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [Sesamum indicum]
Length=333

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            D  +NA IVLAAG+ AIT LLTI H+YWHGWTL+E+LRYAP HNW+AYEEALK +PVL
Sbjct  97   DSLLNAAIVLAAGSLAITKLLTIDHDYWHGWTLYEVLRYAPEHNWNAYEEALKTHPVL  154



>ref|XP_007043533.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
 gb|EOX99364.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
Length=451

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
             EK+  RAINA+IVL  GT A++ LLTI H+YWHGWTLFE+ RY P HNW AYE+ALK N
Sbjct  208  FEKLSSRAINASIVLGFGTLAVSKLLTIDHDYWHGWTLFEVFRYVPEHNWIAYEQALKAN  267

Query  640  PVL  648
            PVL
Sbjct  268  PVL  270



>ref|XP_008353524.1| PREDICTED: PXMP2/4 family protein 1-like [Malus domestica]
Length=352

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++K+  RAINA IVL  GT A++ LLTI H+YWHGWTL+EILRY P HNW AYE+ALK N
Sbjct  108  LDKLTSRAINALIVLGFGTLAVSKLLTIDHDYWHGWTLYEILRYVPEHNWIAYEQALKAN  167

Query  640  PVL  648
            PV 
Sbjct  168  PVF  170



>gb|EMS63851.1| Peroxisomal membrane protein 2 [Triticum urartu]
Length=238

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  469  VVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            ++DR INA IVL A T A+T LLT+  +YWHGWT+FEILRY P HNWSAYEEALK NPVL
Sbjct  1    MLDRGINAAIVLGASTCALTKLLTVDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVL  60



>ref|XP_010051673.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010051678.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89498.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89499.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89500.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=350

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  460  MEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKEN  639
            ++++V R INAT+VL  GT A+T LLT+ H+YW GWTL+E+LRYAP HNW AYE+ALK N
Sbjct  114  LQRLVGRGINATLVLGFGTLAVTKLLTVDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTN  173

Query  640  PVL  648
            PVL
Sbjct  174  PVL  176



>ref|XP_010455892.1| PREDICTED: protein SYM1-like [Camelina sativa]
Length=322

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLAAGT A+T LL+I H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  87   DRLMSRGINAAIVLAAGTVAVTKLLSIDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNP  146

Query  643  VL  648
            VL
Sbjct  147  VL  148



>ref|XP_006288235.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
 gb|EOA21133.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
Length=319

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            +++ R INA IVLAAGT A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NPV
Sbjct  85   RLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNPV  144

Query  646  L  648
            L
Sbjct  145  L  145



>gb|KFK30935.1| hypothetical protein AALP_AA6G045100 [Arabis alpina]
Length=316

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++++ R INA IVLA G+ A+T LLTI H+YW GWTL+EILRYAP HNW AYE+ LK NP
Sbjct  79   DRLMSRGINAAIVLATGSIAVTKLLTIDHDYWQGWTLYEILRYAPEHNWDAYEQILKTNP  138

Query  643  VL  648
            VL
Sbjct  139  VL  140



>gb|KEH39092.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=318

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINA IVL  G FA+T LLTI H+YWHGWTL+EIL+Y P HNW AYE++LK NPVL
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVL  136



>gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Erythranthe guttata]
Length=336

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            DR INA IVL AG+ AIT LLTI H+YWHGWTL+E+LRYAP H+W+AYEE LK +PVL
Sbjct  97   DRLINAAIVLGAGSLAITKLLTIDHDYWHGWTLYEVLRYAPEHSWNAYEETLKTHPVL  154



>gb|KEH39090.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=344

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINA IVL  G FA+T LLTI H+YWHGWTL+EIL+Y P HNW AYE++LK NPVL
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVL  136



>gb|KEH39091.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=339

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINA IVL  G FA+T LLTI H+YWHGWTL+EIL+Y P HNW AYE++LK NPVL
Sbjct  80   RAINAAIVLGFGAFAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVL  136



>gb|EMT31197.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  469  VVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            ++DR INA IVL A TFA+T LLT+   YWHGWT+ EILRY P HNWSAYEEALK NP+L
Sbjct  1    MLDRGINAAIVLGAITFALTKLLTVDQEYWHGWTILEILRYMPQHNWSAYEEALKANPLL  60



>gb|ACU17682.1| unknown [Glycine max]
Length=196

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  484  INATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +NA I L  GTFA+T LLTI H+YWHGWTLFEI+RY P HNW AYE+ALK NPVL
Sbjct  87   VNAIIALGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVL  141



>ref|XP_004155526.1| PREDICTED: uncharacterized protein LOC101223761 [Cucumis sativus]
Length=375

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RA+NATIVL  GT  +T LLTI H  WHGWTL+E+LRYAP HNW AYEEALK NPVL
Sbjct  113  RAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVL  169



>ref|XP_004137017.1| PREDICTED: uncharacterized protein LOC101214701 [Cucumis sativus]
 gb|KGN43598.1| hypothetical protein Csa_7G047330 [Cucumis sativus]
Length=353

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RA+NATIVL  GT  +T LLTI H  WHGWTL+E+LRYAP HNW AYEEALK NPVL
Sbjct  113  RAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVL  169



>ref|XP_004304121.1| PREDICTED: protein SYM1 [Fragaria vesca subsp. vesca]
Length=341

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K+  RAINA IVL  GTFA++ LLTI H+YWHGWTL+EI++Y P HNW AYE+AL  NPV
Sbjct  99   KLTSRAINALIVLGFGTFAVSKLLTIDHDYWHGWTLYEIVKYVPEHNWIAYEQALNANPV  158

Query  646  L  648
            L
Sbjct  159  L  159



>ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
 gb|ESW21872.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
Length=316

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  484  INATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            INA IVL  GTFA+T LLTI H+YWHGWTL+EILRY P HNW AYE+ALK NPVL
Sbjct  81   INAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEILRYIPEHNWIAYEQALKANPVL  135



>gb|ACJ84916.1| unknown [Medicago truncatula]
Length=205

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RAINA IVL  G  A+T LLTI H+YWHGWTL+EIL+Y P HNW AYE++LK NPVL
Sbjct  80   RAINAAIVLGFGASAVTKLLTIDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVL  136



>ref|XP_008455339.1| PREDICTED: mpv17-like protein [Cucumis melo]
Length=352

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  478  RAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            RA+NATIVL  GT  +T LLTI H  WHGWTL+E+LRYAP HNW AYEEALK NPVL
Sbjct  112  RAVNATIVLGFGTLLVTKLLTIDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVL  168



>ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [Glycine max]
Length=322

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  484  INATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +NA IVL  GTFA+T LLTI H+YWHGWTLFEI+RY P HNW AYE+ALK NPVL
Sbjct  87   VNAIIVLGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVL  141



>dbj|BAD34004.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD36403.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
Length=364

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 76/145 (52%), Gaps = 19/145 (13%)
 Frame = +1

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            +E DV+P   ++     GG ++       GG  +D               G L+F+    
Sbjct  98   EEADVLPGPGAEGEMAAGGRLEEQPEGPIGGSQVD--------------IGGLAFQ----  139

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTL  573
             G       A  S G         K++DR IN  IVL A T+A+T LLT+ H+YWHGWT+
Sbjct  140  -GDMGGGGFAGGSGGAGAGGGDGNKMLDRGINTAIVLGASTYALTKLLTVDHDYWHGWTI  198

Query  574  FEILRYAPXHNWSAYEEALKENPVL  648
            FEILRY P HNWSAYEEALK NPVL
Sbjct  199  FEILRYMPEHNWSAYEEALKTNPVL  223



>gb|KHN36615.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=409

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  484  INATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +NA IVL  GTFA+T LLTI H+YWHGWTLFEI+RY P HNW AYE+ALK NPVL
Sbjct  87   VNAIIVLGFGTFAVTKLLTIDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVL  141



>gb|EMS63743.1| Protein SYM1 [Triticum urartu]
Length=250

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  469  VVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            ++D  INA IVL A TFA+T +LT+  +YWHGWT+FEILRY P HNWSAYEEALK NP+L
Sbjct  1    MLDLGINAAIVLGAITFALTKVLTVDQDYWHGWTIFEILRYMPQHNWSAYEEALKANPLL  60



>emb|CDP14740.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  475  DRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            +R +NA IVL  GT AIT LL+I H YWHGWTL+E+L+ AP HNW AYEEALK NPVL
Sbjct  101  ERLLNAAIVLGVGTLAITKLLSIDHEYWHGWTLYEVLKNAPEHNWIAYEEALKSNPVL  158



>gb|KHN04274.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=332

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  487  NATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            NA IVL  GTFA+T LLTI H+YWHGWTL+EI+RY P HNW AYE+ALK NPVL
Sbjct  88   NAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEIVRYIPEHNWIAYEQALKANPVL  141



>ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-like [Glycine max]
Length=322

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  487  NATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
            NA IVL  GTFA+T LLTI H+YWHGWTL+EI+RY P HNW AYE+ALK NPVL
Sbjct  88   NAIIVLGFGTFAVTKLLTIDHDYWHGWTLYEIVRYIPEHNWIAYEQALKANPVL  141



>gb|EEE59409.1| hypothetical protein OsJ_11557 [Oryza sativa Japonica Group]
Length=195

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  505  AAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPVL  648
              GT+A+T LLT+ H+YWHGWT+FEILRY P HNWSAYEEALK NPVL
Sbjct  33   GGGTYALTKLLTVDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVL  80



>ref|XP_001765838.1| predicted protein [Physcomitrella patens]
 gb|EDQ69429.1| predicted protein, partial [Physcomitrella patens]
Length=225

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            +++DR  NA +  AA ++A+T  +T+ H+ WHGWT+FE+L+YAP HNW AYEE L  NPV
Sbjct  5    RLLDRTFNALLAGAAISYAVTKAVTVDHDVWHGWTVFEVLKYAPLHNWHAYEEFLSANPV  64

Query  646  L  648
            L
Sbjct  65   L  65



>ref|XP_002530181.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32195.1| conserved hypothetical protein [Ricinus communis]
Length=306

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 100/187 (53%), Gaps = 29/187 (16%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSK---PNPKTGSPSHF---KPTKLQLFPRPVSKQ------FAAA  207
            MA+++ + +P +L  LSK   P  K    SHF   K T+  +F R   ++        + 
Sbjct  1    MASLHAI-SPHSLLPLSKSKKPTSKILPSSHFLGSKFTQSLIFSRNKQQRGESSWLLNSV  59

Query  208  AAKELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGP  387
              +ELDVIPVQS DS DQQ G+V  ++ E+EG   + + V+              S EG 
Sbjct  60   VQEELDVIPVQSEDSVDQQEGMV-MSQVESEGSDQLATQVSGFG-----------SSEGQ  107

Query  388  TGFgsssssssaass---sggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYW  558
              F   SS+SS++           EL M+++ DR +NA IVLAAG+FAIT LLTI  +YW
Sbjct  108  LSFEGFSSASSSSGIGDDEERRQRELEMDRLADRTLNAMIVLAAGSFAITKLLTIDQDYW  167

Query  559  H-GWTLF  576
            H GW L+
Sbjct  168  HAGWKLW  174



>ref|XP_001774069.1| predicted protein [Physcomitrella patens]
 gb|EDQ61121.1| predicted protein [Physcomitrella patens]
Length=268

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  466  KVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENPV  645
            K +DR +NA +V  A  +AIT  +T+ H+ W GWT+FEIL+YAP HNW AYE  L+ NP+
Sbjct  18   KYLDRTVNALLVGGAILYAITKAVTVDHDVWQGWTMFEILKYAPLHNWKAYELLLQSNPI  77

Query  646  L  648
            L
Sbjct  78   L  78



>ref|XP_002966359.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
 gb|EFJ32386.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
Length=236

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++ VDR +NA+++ AA  +A+  ++T+  +YW GWT +EI++YAP HNWSAYEEALK +P
Sbjct  5    DRQVDRFLNASLIAAAAAYALGKIVTVDQDYWQGWTFYEIIKYAPVHNWSAYEEALKSHP  64

Query  643  VL  648
            VL
Sbjct  65   VL  66



>ref|XP_002978201.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
 gb|EFJ20858.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
Length=236

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKENP  642
            ++ VDR +NA+++ AA  +A+  ++T+  +YW GWT +EI++YAP HNWSAYEEAL+ +P
Sbjct  5    DRQVDRFLNASLIAAAAAYALGKIVTVDQDYWQGWTFYEIIKYAPVHNWSAYEEALRSHP  64

Query  643  VL  648
            VL
Sbjct  65   VL  66



>ref|XP_006374188.1| hypothetical protein POPTR_0015s04090g [Populus trichocarpa]
 gb|ERP51985.1| hypothetical protein POPTR_0015s04090g [Populus trichocarpa]
Length=159

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 52/116 (45%), Gaps = 35/116 (30%)
 Frame = +1

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            KEL+VIPVQS D+ DQ  G+V++  +  EG                     RL       
Sbjct  39   KELNVIPVQSGDNVDQHEGIVESQAKR-EG----------------TKLATRLQV-----  76

Query  394  FgsssssssaasssggagxELGMEKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
                               +L  E ++D+ INA IVL  GT++IT LLT+ HNYWH
Sbjct  77   -------------LVLMERKLESETLIDKTINAMIVLGVGTYSITKLLTVDHNYWH  119



>gb|EMT24041.1| hypothetical protein F775_24733 [Aegilops tauschii]
Length=139

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  562  GWTLFEILRYAPXHNWSAYEEALKENPVL  648
            GWT+FEILRY   HNWSAYEEALK NPVL
Sbjct  24   GWTIFEILRYMSEHNWSAYEEALKANPVL  52



>gb|KJB62727.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=313

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  559  HGWTLFEILRYAPXHNWSAYEEALKENPVL  648
             GWT++EI+RYAP HNWSAYEEAL+ NPVL
Sbjct  100  QGWTIYEIVRYAPQHNWSAYEEALRTNPVL  129



>ref|XP_008363403.1| PREDICTED: beta-glucosidase 13-like [Malus domestica]
Length=649

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 63/121 (52%), Gaps = 15/121 (12%)
 Frame = +1

Query  64   MATINGLPTPQTLRSLSKPNPKTGSPSHFKPTKLQLFPR----PVSKQ------FAAAAA  213
            MA I+ +   Q+  SL  P P+    +H KP      P+    P +KQ       +A   
Sbjct  18   MAAIHSIAA-QSFLSLPNPKPRKRIAAHPKPILTSKLPKNPTFPRNKQKGRRVLNSAVKR  76

Query  214  KELDVIPVQSSDSTDQQGGVVDATEREAEGGGDIDSIvnqvvvvggfgnegRLSFEGPTG  393
            +E DVIPVQSSDSTDQQ GVV A+  E+E G   D       V G   +EGRLSFEG  G
Sbjct  77   EECDVIPVQSSDSTDQQEGVV-ASRVESEAG---DQGELVSQVGGFGASEGRLSFEGAGG  132

Query  394  F  396
            F
Sbjct  133  F  133



>gb|ADM25596.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25606.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>gb|ADM25574.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25576.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25578.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25586.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25587.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25590.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25592.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25593.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25594.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25595.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25597.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25598.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25600.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25602.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25604.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25607.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25610.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25611.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25612.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25613.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>gb|ADM25570.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25571.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25572.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25573.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25575.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25577.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25579.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25580.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25581.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25582.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25583.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25584.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25585.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25588.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25589.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25591.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25599.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25603.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
 gb|ADM25605.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQ  64



>gb|EWM27713.1| peroxisomal membrane 22 kda (mpv17 pmp22) family protein [Nannochloropsis 
gaditana]
Length=570

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 5/64 (8%)
 Frame = +1

Query  472  VDRAI-----NATIVLAAGTFAITXLLTIXHNYWHGWTLFEILRYAPXHNWSAYEEALKE  636
            VD+AI     N  +++AA  +A + L+T+    W GWT+ EI+   P  NW  YE  L  
Sbjct  130  VDKAIMAKWRNLVLLIAAAVYATSILITVDMESWRGWTIQEIMLRIPYDNWQEYEGGLST  189

Query  637  NPVL  648
            +P+ 
Sbjct  190  HPIF  193



>gb|ADM25609.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



>gb|ADM25608.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



>gb|ADM25601.1| peroxisomal membrane-like protein, partial [Arabidopsis thaliana]
Length=64

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  EKVVDRAINATIVLAAGTFAITXLLTIXHNYWH  561
            ++++ R INA IVLAAGT A+T LLTI H+YW 
Sbjct  32   DRLMSRGINAAIVLAAGTGAVTKLLTIDHDYWQ  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625