BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031P21

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      323   1e-106   Fragaria vesca subsp. vesca
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         321   1e-105   Jatropha curcas
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    315   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      314   6e-103   Cucumis melo [Oriental melon]
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    309   3e-102   
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    311   5e-102   Sesamum indicum [beniseed]
ref|XP_007027514.1|  O-methyltransferase family protein                 311   7e-102   
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             311   9e-102   Prunus persica
gb|KJB62321.1|  hypothetical protein B456_009G411600                    307   1e-101   Gossypium raimondii
gb|KJB62322.1|  hypothetical protein B456_009G411600                    307   1e-101   Gossypium raimondii
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             307   2e-101   
gb|KJB62324.1|  hypothetical protein B456_009G411600                    306   2e-101   Gossypium raimondii
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      310   3e-101   Prunus mume [ume]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    310   4e-101   Pyrus x bretschneideri [bai li]
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      308   8e-101   Populus euphratica
gb|KJB62323.1|  hypothetical protein B456_009G411600                    307   2e-100   Gossypium raimondii
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    304   3e-100   
gb|KJB62320.1|  hypothetical protein B456_009G411600                    306   4e-100   Gossypium raimondii
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             306   4e-100   
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      306   8e-100   Gossypium arboreum [tree cotton]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    303   1e-98    Cicer arietinum [garbanzo]
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             299   1e-98    
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       302   3e-98    Cucumis sativus [cucumbers]
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      300   9e-98    Nelumbo nucifera [Indian lotus]
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      301   9e-98    Vitis vinifera
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    302   9e-98    
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    300   1e-97    Solanum tuberosum [potatoes]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     300   1e-97    Vitis vinifera
ref|XP_002519426.1|  o-methyltransferase, putative                      300   2e-97    Ricinus communis
gb|AFK33955.1|  unknown                                                 294   2e-97    Medicago truncatula
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    298   2e-97    Glycine max [soybeans]
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    299   4e-97    
gb|KEH38506.1|  caffeic acid O-methyltransferase                        298   5e-97    Medicago truncatula
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    295   2e-95    Glycine max [soybeans]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             293   5e-95    Phaseolus vulgaris [French bean]
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    293   7e-95    Solanum lycopersicum
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    289   4e-93    Eucalyptus grandis [rose gum]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        288   6e-93    Nicotiana tomentosiformis
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      283   2e-92    Nicotiana sylvestris
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    287   2e-92    Solanum tuberosum [potatoes]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 286   3e-92    Morus notabilis
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    286   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    286   6e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        283   6e-91    Tarenaya hassleriana [spider flower]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             283   1e-90    Capsella rubella
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             278   5e-89    Eutrema salsugineum [saltwater cress]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             278   6e-89    Eutrema salsugineum [saltwater cress]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    277   9e-89    Camelina sativa [gold-of-pleasure]
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              275   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    272   9e-87    Sesamum indicum [beniseed]
emb|CDX76223.1|  BnaA04g04870D                                          264   9e-85    
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    267   9e-85    Arabis alpina [alpine rockcress]
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      264   2e-83    Brassica rapa
emb|CDX95399.1|  BnaC04g27590D                                          263   6e-83    
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    261   2e-82    
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      259   5e-82    Glycine soja [wild soybean]
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    246   1e-78    Nelumbo nucifera [Indian lotus]
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    246   5e-78    Nelumbo nucifera [Indian lotus]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    239   1e-73    Limonium latifolium
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    238   2e-73    Cicer arietinum [garbanzo]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   232   7e-72    Citrus sinensis [apfelsine]
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             228   3e-70    
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   228   4e-70    Citrus sinensis [apfelsine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    228   1e-69    Citrus sinensis [apfelsine]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             227   1e-69    Citrus clementina [clementine]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             225   7e-69    
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    223   2e-68    
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 224   7e-68    
gb|AFK47565.1|  unknown                                                 219   2e-67    Medicago truncatula
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 218   1e-66    
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        219   3e-66    Medicago sativa subsp. x varia
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 218   1e-65    Medicago truncatula
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    213   1e-65    Limonium latifolium
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      216   1e-64    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGW45465.1|  beta-alanine n-methyltransferase                        209   7e-64    Reaumuria trigyna
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      214   1e-63    Beta vulgaris subsp. vulgaris [field beet]
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    203   5e-62    Limonium latifolium
dbj|BAJ96291.1|  predicted protein                                      206   1e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    204   4e-60    Setaria italica
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    201   3e-59    
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    201   1e-58    Elaeis guineensis
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          198   7e-58    Sorghum bicolor [broomcorn]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      196   8e-58    
gb|EEC74273.1|  hypothetical protein OsI_09508                          195   7e-57    Oryza sativa Indica Group [Indian rice]
ref|NP_001048569.1|  Os02g0823400                                       195   1e-56    
ref|NP_001149617.1|  LOC100283243                                       192   1e-55    
gb|ACN25427.1|  unknown                                                 192   2e-55    Zea mays [maize]
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   186   4e-55    Citrus sinensis [apfelsine]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      190   1e-54    Brachypodium distachyon [annual false brome]
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     186   3e-54    Eucalyptus grandis [rose gum]
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    185   7e-54    
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             178   7e-51    
gb|AES72848.2|  caffeic acid O-methyltransferase                        173   1e-48    Medicago truncatula
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     172   3e-48    Eucalyptus grandis [rose gum]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   162   3e-45    Citrus sinensis [apfelsine]
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          160   3e-43    Amborella trichopoda
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   3e-35    
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    136   1e-34    
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    121   8e-31    Nelumbo nucifera [Indian lotus]
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                   121   1e-30    Citrus sinensis [apfelsine]
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122             122   3e-30    
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100              122   6e-30    
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205             121   1e-29    
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    122   4e-29    Selaginella moellendorffii
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             118   8e-29    
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   120   2e-28    Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   120   2e-28    Selaginella moellendorffii
ref|XP_010027213.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    111   4e-27    Eucalyptus grandis [rose gum]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   114   7e-27    Citrus sinensis [apfelsine]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             115   1e-26    Capsella rubella
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             113   1e-26    Citrus clementina [clementine]
gb|AAB96879.1|  O-methyltransferase 1                                   113   7e-26    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    113   7e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864309.1|  O-methyltransferase 1                              112   1e-25    
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     111   3e-25    Pinus pinaster [cluster pine]
gb|ABR18380.1|  unknown                                                 111   4e-25    Picea sitchensis
gb|AFM73596.1|  caffeate O-methyltransferase                            110   4e-25    Populus simonii
prf||1906376A  O-methyltransferase                                      110   6e-25 
gb|AAF60951.1|  O-methyltransferase                                     110   6e-25    Populus trichocarpa x Populus deltoides
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      110   6e-25    Populus deltoides
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    110   7e-25    Ginkgo biloba [ginkgo]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    110   8e-25    Nelumbo nucifera [Indian lotus]
ref|XP_002864307.1|  O-methyltransferase 1                              109   1e-24    Arabidopsis lyrata subsp. lyrata
gb|AIJ28474.1|  O-methyltransferase                                     109   2e-24    Vaccinium corymbosum [American blueberry]
emb|CAI30878.1|  caffeate O-methyltransferase                           109   2e-24    Picea abies
gb|ABK22490.1|  unknown                                                 108   2e-24    Picea sitchensis
ref|XP_002317838.1|  Chain A family protein                             108   2e-24    Populus trichocarpa [western balsam poplar]
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    108   2e-24    Populus euphratica
emb|CDY70033.1|  BnaCnng66420D                                          107   2e-24    Brassica napus [oilseed rape]
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        108   2e-24    Populus tomentosa [Chinese white poplar]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    108   2e-24    Populus tremuloides
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             108   3e-24    Eutrema salsugineum [saltwater cress]
dbj|BAJ34520.1|  unnamed protein product                                108   3e-24    Eutrema halophilum
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    108   4e-24    Phoenix dactylifera
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      107   6e-24    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             107   7e-24    Phaseolus vulgaris [French bean]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      107   7e-24    Gossypium arboreum [tree cotton]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    107   8e-24    Arabis alpina [alpine rockcress]
gb|AFK40372.1|  unknown                                                 107   8e-24    Lotus japonicus
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                      106   1e-23    Gossypium arboreum [tree cotton]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               106   1e-23    Betula pendula [white birch]
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      106   1e-23    Populus tomentosa [Chinese white poplar]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    106   1e-23    Populus sieboldii x Populus grandidentata
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      106   1e-23    Gossypium hirsutum [American cotton]
gb|AHA44835.1|  caffeate O-methyltransferase                            106   2e-23    Larix kaempferi [karamatsu]
gb|AAD29845.1|AF064697_1  O-methyltransferase                           106   2e-23    Thalictrum tuberosum
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      106   2e-23    Betula platyphylla [Asian white birch]
ref|XP_002525818.1|  o-methyltransferase, putative                      105   2e-23    Ricinus communis
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                      104   3e-23    Gossypium arboreum [tree cotton]
emb|CDY43839.1|  BnaC03g14720D                                          105   3e-23    Brassica napus [oilseed rape]
gb|ABK21417.1|  unknown                                                 105   3e-23    Picea sitchensis
gb|ABO41840.1|  putative caffeic acid methyltransferase                 105   4e-23    Gossypium arboreum [tree cotton]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        105   4e-23    Brassica rapa
gb|KJB16304.1|  hypothetical protein B456_002G222400                    105   4e-23    Gossypium raimondii
gb|ABI54119.1|  caffeic acid O-methyltransferase                        105   5e-23    Malus domestica [apple tree]
gb|ABO41845.1|  putative caffeic acid methyltransferase                 105   5e-23    Gossypium hirsutum [American cotton]
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    104   6e-23    Catharanthus roseus [chatas]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         104   6e-23    Jatropha curcas
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918              105   6e-23    
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    105   6e-23    
gb|ACT87981.1|  caffeic acid O-methyltransferase                        104   7e-23    Jatropha curcas
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630              104   7e-23    
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase                 103   8e-23    
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 104   9e-23    Pyrus x bretschneideri [bai li]
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         104   9e-23    Anthriscus sylvestris
gb|ABO41834.1|  putative caffeic acid methyltransferase                 104   9e-23    Gossypium raimondii
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     104   9e-23    Ipomoea nil [qian niu]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     104   1e-22    Ipomoea nil [qian niu]
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   1e-22    Pyrus x bretschneideri [bai li]
ref|XP_001762717.1|  predicted protein                                  104   1e-22    
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    103   1e-22    Rosa chinensis [China rose]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       103   1e-22    Rosa chinensis var. spontanea
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   1e-22    
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      103   1e-22    Mesembryanthemum crystallinum
gb|AHM25237.1|  noraucuparin O-methyltransferase                        103   1e-22    Sorbus aucuparia [European mountain ash]
gb|ABO41846.1|  putative caffeic acid methyltransferase                 103   1e-22    Gossypium hirsutum [American cotton]
gb|ABI54117.1|  caffeic acid O-methyltransferase                        103   1e-22    Malus domestica [apple tree]
gb|KJB52493.1|  hypothetical protein B456_008G264900                    102   2e-22    Gossypium raimondii
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    103   2e-22    Medicago sativa [alfalfa]
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  103   2e-22    Thalictrum tuberosum
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                  103   2e-22    Thalictrum tuberosum
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    103   2e-22    Camelina sativa [gold-of-pleasure]
gb|ACD56610.1|  putative caffeic acid protein                           103   2e-22    Gossypioides kirkii
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   103   2e-22    Medicago truncatula
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...    102   2e-22    Ginkgo biloba [ginkgo]
gb|ADN27527.1|  caffeic acid O-methyltransferase                        103   2e-22    Camellia sinensis [black tea]
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...    102   2e-22    Ginkgo biloba [ginkgo]
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  103   2e-22    Thalictrum tuberosum
gb|AFK39235.1|  unknown                                                 103   2e-22    Medicago truncatula
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-22    Malus domestica [apple tree]
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    103   2e-22    Sesamum indicum [beniseed]
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        103   2e-22    Camelina sativa [gold-of-pleasure]
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    103   2e-22    Brassica rapa
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    102   3e-22    Camelina sativa [gold-of-pleasure]
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  102   3e-22    Thalictrum tuberosum
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      102   3e-22    Gossypium arboreum [tree cotton]
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    102   3e-22    Ocimum basilicum [basil]
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         102   3e-22    Jatropha curcas
gb|AEV93478.1|  caffeic acid O-methyltransferase                        102   3e-22    Caragana korshinskii
gb|KJB23956.1|  hypothetical protein B456_004G125600                    101   3e-22    Gossypium raimondii
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      102   3e-22    Vitis vinifera
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      102   4e-22    Prunus mume [ume]
gb|ABK23795.1|  unknown                                                 102   4e-22    Picea sitchensis
gb|KJB52492.1|  hypothetical protein B456_008G264900                    102   4e-22    Gossypium raimondii
gb|ABO41852.1|  putative caffeic acid methyltransferase                 102   4e-22    Gossypium hirsutum [American cotton]
gb|ABK25932.1|  unknown                                                 102   5e-22    Picea sitchensis
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg            100   5e-22    
gb|KJB23955.1|  hypothetical protein B456_004G125600                    101   5e-22    Gossypium raimondii
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    102   5e-22    Medicago sativa [alfalfa]
prf||2119166A  caffeic acid O-methyltransferase                         102   5e-22 
gb|KJB23957.1|  hypothetical protein B456_004G125600                    101   5e-22    Gossypium raimondii
gb|AEO14871.1|  caffeic acid O-methyltransferase                        102   5e-22    Salvia miltiorrhiza [Chinese salvia]
gb|AAF28353.1|AF220491_1  O-methyltransferase                           102   5e-22    Fragaria x ananassa
gb|AEO14870.1|  caffeic acid O-methyltransferase                        102   5e-22    Salvia miltiorrhiza [Chinese salvia]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    102   6e-22    Glycine max [soybeans]
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    102   6e-22    Coffea canephora [robusta coffee]
gb|AGR85824.1|  caffeic acid O-methyltransferase                        101   6e-22    Hibiscus cannabinus [bimli-jute]
gb|AAN03726.1|  caffeic acid O-methyltransferase                        101   7e-22    Coffea canephora [robusta coffee]
gb|ADO16247.1|  caffeic acid O-methyltransferase                        101   7e-22    Ocimum tenuiflorum [holy basil]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               101   7e-22    Hibiscus cannabinus [bimli-jute]
dbj|BAA13683.1|  O-methyltransferase                                    101   7e-22    Glycyrrhiza echinata [hedgehog licorice]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    101   7e-22    Elaeis guineensis
gb|ABG27066.1|  caffeic acid O-methyltransferase                        101   8e-22    Boehmeria nivea [Chinese silk-plant]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   8e-22    Cicer arietinum [garbanzo]
ref|NP_001240003.1|  uncharacterized protein LOC100780100               101   8e-22    Glycine max [soybeans]
gb|KJB23954.1|  hypothetical protein B456_004G125600                    101   8e-22    Gossypium raimondii
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               101   8e-22    
emb|CDY18306.1|  BnaC09g30560D                                          101   9e-22    Brassica napus [oilseed rape]
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   9e-22    Phoenix dactylifera
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    101   1e-21    
ref|XP_003621323.1|  Isoliquiritigenin 2'-O-methyltransferase           101   1e-21    Medicago truncatula
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      101   1e-21    Gossypium hirsutum [American cotton]
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      101   1e-21    Nicotiana sylvestris
emb|CAA52461.1|  catechol O-methyltransferase                           101   1e-21    Nicotiana tabacum [American tobacco]
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    101   1e-21    Elaeis guineensis
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...  99.8    1e-21    Limonium latifolium
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    100   1e-21    Cucumis melo [Oriental melon]
gb|EPS67212.1|  hypothetical protein M569_07558                         100   1e-21    Genlisea aurea
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      100   1e-21    Miscanthus sinensis
dbj|BAO31650.1|  O-methyltransferase                                    100   1e-21    Sesamum indicum [beniseed]
gb|ABS57468.1|  caffeic acid O-methyl transferase                       100   1e-21    Leucaena leucocephala [cassie]
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...    100   1e-21    Ammi majus [ameo mayor]
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    100   2e-21    Brassica rapa
gb|AAY86361.1|  caffeic acid O-methyltransferase                        100   2e-21    Acacia auriculiformis x Acacia mangium
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    100   2e-21    Citrus sinensis [apfelsine]
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          100   2e-21    Amborella trichopoda
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      100   2e-21    Fragaria vesca subsp. vesca
ref|NP_001242325.1|  uncharacterized protein LOC100805999               100   2e-21    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    100   2e-21    Phoenix dactylifera
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 100   2e-21    Anthriscus sylvestris
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    100   2e-21    Chrysosplenium americanum [water-carpet]
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    100   2e-21    Prunus dulcis [sweet almond]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      100   2e-21    Glycine soja [wild soybean]
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     100   3e-21    Rosa chinensis var. spontanea
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    100   3e-21    Eucalyptus gunnii
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.8    3e-21    
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.8    3e-21    
gb|AGS49216.1|  O-methyltransferase                                   99.8    3e-21    Zea mays [maize]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     100   3e-21    Eucalyptus grandis [rose gum]
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.8    4e-21    
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg           99.8    4e-21    
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg           99.8    4e-21    Prunus persica
gb|AFK39562.1|  unknown                                               99.4    4e-21    Lotus japonicus
dbj|BAO31651.1|  O-methyltransferase                                  99.4    4e-21    Sesamum radiatum
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             99.4    4e-21    Citrus aurantium [bitter orange]
emb|CAA52462.1|  catechol O-methyltransferase                         99.4    4e-21    Nicotiana tabacum [American tobacco]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  99.4    4e-21    Glycine max [soybeans]
gb|ADB82906.1|  caffeic O-methyltransferase1                          99.4    5e-21    Eucalyptus camaldulensis
gb|ACY66932.1|  caffeic O-methyltransferase 1                         99.4    5e-21    Eucalyptus camaldulensis
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    99.4    5e-21    Saccharum hybrid cultivar [sugarcane]
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  99.4    5e-21    Saccharum officinarum [noble cane]
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.4    5e-21    Eucalyptus grandis [rose gum]
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    99.0    5e-21    Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  99.0    5e-21    Chrysosplenium americanum [water-carpet]
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  99.0    6e-21    Ocimum basilicum [basil]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.0    6e-21    Malus domestica [apple tree]
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    99.0    7e-21    Solanum lycopersicum
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.0    7e-21    Elaeis guineensis
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  99.0    7e-21    Cucumis sativus [cucumbers]
gb|ABK23414.1|  unknown                                               99.0    7e-21    
gb|ABR18103.1|  unknown                                               98.6    7e-21    
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      98.6    8e-21    
gb|ABI54118.1|  caffeic acid O-methyltransferase                      98.6    8e-21    
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    98.6    1e-20    
gb|AFK45226.1|  unknown                                               98.2    1e-20    
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       98.2    1e-20    
gb|AAL57301.1|AF387790_1  O-methyltransferase                         98.2    1e-20    
gb|AAO43609.1|  caffeic acid O-methyltransferase                      98.2    1e-20    
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  97.8    1e-20    
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            97.8    1e-20    
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   97.8    1e-20    
gb|ABI54120.1|  caffeic acid O-methyltransferase                      97.8    1e-20    
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  97.8    1e-20    
gb|AFO69477.1|  caffeic acid O-methyltransferase                      97.8    2e-20    
gb|AGS49209.1|  O-methyltransferase                                   97.4    2e-20    
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.1    2e-20    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           97.4    3e-20    
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  97.1    3e-20    
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                    97.1    3e-20    
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.7    3e-20    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  96.7    3e-20    
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   97.4    4e-20    
gb|AGS49206.1|  O-methyltransferase                                   96.7    4e-20    
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.7    4e-20    
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   97.1    4e-20    
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   96.3    4e-20    
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        96.7    4e-20    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  96.3    5e-20    
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  96.3    5e-20    
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   95.9    5e-20    
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    96.3    5e-20    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  96.3    5e-20    
ref|XP_002321948.1|  Chain A family protein                           96.3    6e-20    
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            95.9    6e-20    
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.9    6e-20    
gb|AGS49210.1|  O-methyltransferase                                   95.9    8e-20    
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       95.9    8e-20    
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.5    8e-20    
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  96.3    8e-20    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  95.9    9e-20    
gb|AGS49204.1|  O-methyltransferase                                   95.5    9e-20    
gb|AGS49202.1|  O-methyltransferase                                   95.5    9e-20    
gb|AGS49201.1|  O-methyltransferase                                   95.5    9e-20    
gb|AAQ24345.1|  O-methyltransferase                                   95.5    9e-20    
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                94.4    9e-20    
gb|AAQ24337.1|  O-methyltransferase                                   95.5    9e-20    
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                95.5    1e-19    
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg           93.2    1e-19    
gb|AGS49214.1|  O-methyltransferase                                   95.5    1e-19    
gb|AAQ24355.1|  O-methyltransferase                                   95.5    1e-19    
gb|AAQ24339.1|  O-methyltransferase                                   95.5    1e-19    
gb|AAQ24338.1|  O-methyltransferase                                   95.1    1e-19    
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    1e-19    
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  95.1    1e-19    
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    1e-19    
gb|AAV36348.1|  caffeate O-methyltransferase                          93.2    1e-19    
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     95.1    1e-19    
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  95.1    2e-19    
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      95.1    2e-19    
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  95.1    2e-19    
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                    94.7    2e-19    
gb|KEH43550.1|  caffeic acid O-methyltransferase                      94.7    2e-19    
ref|XP_004496361.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  94.7    2e-19    
gb|AGS49196.1|  O-methyltransferase                                   94.7    2e-19    
gb|AGS49187.1|  O-methyltransferase                                   94.7    2e-19    
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    94.4    2e-19    
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           94.4    2e-19    
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  94.4    3e-19    
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  94.4    3e-19    
gb|KEH21637.1|  caffeic acid O-methyltransferase                      93.2    3e-19    
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.4    3e-19    
gb|AGS49199.1|  O-methyltransferase                                   94.0    3e-19    
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  94.0    3e-19    
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   94.0    3e-19    
gb|AGS49190.1|  O-methyltransferase                                   94.0    3e-19    
gb|AGS49186.1|  O-methyltransferase                                   94.0    3e-19    
gb|AGS49184.1|  O-methyltransferase                                   94.0    3e-19    
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           94.0    4e-19    
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1             94.0    4e-19    
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747           94.0    4e-19    
gb|AHY28755.1|  caffeate O-methyltransferase                          91.7    4e-19    
gb|AAV36304.1|  caffeate O-methyltransferase                          91.7    4e-19    
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           93.6    4e-19    
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  93.6    4e-19    
gb|AGO50639.1|  caffeic acid O-methyltransferase                      93.6    5e-19    
gb|KEH21636.1|  caffeic acid O-methyltransferase                      93.2    5e-19    
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                 92.0    5e-19    
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      93.2    5e-19    
gb|AFX98069.1|  caffeic acid O-methyltransferase                      93.2    6e-19    
sp|P93324.1|CHOMT_MEDSA  RecName: Full=Isoliquiritigenin 2'-O-met...  93.2    7e-19    
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             93.2    7e-19    
gb|AAV36354.1|  caffeate O-methyltransferase                          90.9    7e-19    
ref|XP_003621334.1|  O-methyltransferase                              93.2    7e-19    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                    92.8    8e-19    
gb|AAV36346.1|  caffeate O-methyltransferase                          90.9    8e-19    
gb|AGS49197.1|  O-methyltransferase                                   92.8    8e-19    
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  92.8    9e-19    
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 92.8    9e-19    
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  92.8    9e-19    
gb|AAQ01670.1|  catechol O-methyltransferase                          92.8    1e-18    
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           92.4    1e-18    
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.4    1e-18    
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           91.7    1e-18    
ref|XP_007212477.1|  hypothetical protein PRUPE_ppa015120mg           92.0    1e-18    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...  92.4    1e-18    
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           91.7    1e-18    
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg           92.4    1e-18    
gb|AGS49198.1|  O-methyltransferase                                   92.4    1e-18    
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           92.4    1e-18    
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                 92.4    1e-18    
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                92.4    1e-18    
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg           92.0    1e-18    
gb|AGS49181.1|  O-methyltransferase                                   92.4    1e-18    
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                    92.0    1e-18    
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...  92.0    1e-18    
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.0    1e-18    
gb|AGS49219.1|  O-methyltransferase                                   92.0    1e-18    
gb|AGS49183.1|  O-methyltransferase                                   92.0    1e-18    
gb|AGS49185.1|  O-methyltransferase                                   92.0    1e-18    
gb|AAQ24361.1|  O-methyltransferase                                   92.0    1e-18    
gb|AGS49200.1|  O-methyltransferase                                   92.0    1e-18    
gb|AAQ24348.1|  O-methyltransferase                                   92.0    1e-18    
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       92.0    2e-18    
gb|AAQ24343.1|  O-methyltransferase                                   92.0    2e-18    
gb|AAQ24342.1|  O-methyltransferase                                   92.0    2e-18    
gb|AAQ24344.1|  O-methyltransferase                                   92.0    2e-18    
gb|AGS49182.1|  O-methyltransferase                                   92.0    2e-18    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)            92.0    2e-18    
ref|NP_001106047.1|  catechol O-methyltransferase                     92.0    2e-18    
gb|AGS49208.1|  O-methyltransferase                                   92.0    2e-18    
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                   91.7    2e-18    
gb|AAV36308.1|  caffeate O-methyltransferase                          90.1    2e-18    
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.0    2e-18    
gb|AGS49188.1|  O-methyltransferase                                   92.0    2e-18    
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  92.0    2e-18    
gb|AAQ24351.1|  O-methyltransferase                                   92.0    2e-18    
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           91.3    2e-18    
gb|AGS49215.1|  O-methyltransferase                                   92.0    2e-18    
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           91.7    2e-18    
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.7    2e-18    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  91.7    2e-18    
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.7    2e-18    
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.3    2e-18    
ref|XP_003536383.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  91.7    3e-18    
gb|AGS49205.1|  O-methyltransferase                                   91.3    3e-18    
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           91.3    3e-18    
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.5    3e-18    
gb|AHY28752.1|  caffeate O-methyltransferase                          91.3    3e-18    
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...  90.9    3e-18    
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.5    3e-18    
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  91.7    3e-18    
gb|AGS49191.1|  O-methyltransferase                                   91.3    3e-18    
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.3    3e-18    
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           90.9    3e-18    
ref|XP_008343466.1|  PREDICTED: anthranilate N-methyltransferase-...  90.9    4e-18    
gb|AHY28754.1|  caffeate O-methyltransferase                          90.9    4e-18    
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...  90.9    4e-18    
gb|KCW89065.1|  hypothetical protein EUGRSUZ_A01392                   90.1    4e-18    
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase         90.9    4e-18    
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       90.9    4e-18    
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               90.9    4e-18    
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                     90.9    5e-18    
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           90.5    5e-18    
ref|XP_010256417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.5    5e-18    
gb|AID68566.1|  caffeic O-methyltransferase                           90.5    6e-18    
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...  90.5    6e-18    
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           90.5    6e-18    
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.1    7e-18    
emb|CDM87233.1|  unnamed protein product                              90.1    7e-18    
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                    90.1    7e-18    
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              89.4    7e-18    
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                   89.7    7e-18    
gb|AAS64572.1|  caffeic acid O-methyltransferase                      90.1    7e-18    
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase              90.1    7e-18    
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  90.1    8e-18    
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.1    8e-18    
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              89.0    8e-18    
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                    89.7    9e-18    
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           89.0    9e-18    
gb|AAD10253.1|  caffeic acid O-methyltransferase                      89.7    1e-17    
gb|AAK68907.1|  caffeic acid O-methyltransferase                      89.7    1e-17    
gb|AGS49203.1|  O-methyltransferase                                   89.7    1e-17    
gb|AHY28757.1|  caffeate O-methyltransferase                          89.7    1e-17    
pdb|3P9C|A  Chain A, Crystal Structure Of Perennial Ryegrass Lpom...  89.7    1e-17    
ref|XP_010107137.1|  Caffeic acid 3-O-methyltransferase               89.4    1e-17    
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  89.4    1e-17    
ref|XP_006443081.1|  hypothetical protein CICLE_v10023965mg           89.4    1e-17    
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.4    1e-17    
gb|AGS49207.1|  O-methyltransferase                                   89.4    1e-17    
gb|AGS49211.1|  O-methyltransferase                                   89.4    1e-17    
gb|AGS49195.1|  O-methyltransferase                                   89.4    1e-17    
gb|ABP94018.1|  O-methyltransferase                                   89.4    1e-17    
ref|XP_010247677.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.4    1e-17    
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  89.4    2e-17    
emb|CDY19037.1|  BnaC01g20310D                                        89.4    2e-17    
ref|XP_006494183.1|  PREDICTED: anthranilate N-methyltransferase-...  89.4    2e-17    
dbj|BAM05580.1|  caffeic acid O-methyltransferase 1                   88.6    2e-17    
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           89.0    2e-17    
gb|AGS49217.1|  O-methyltransferase                                   89.0    2e-17    
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  89.0    2e-17    
ref|XP_009420747.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    2e-17    
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  87.8    2e-17    
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           89.0    2e-17    
gb|AET00984.2|  caffeic acid O-methyltransferase                      89.0    2e-17    
ref|XP_004169230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  88.2    2e-17    
ref|XP_003573470.1|  PREDICTED: flavone O-methyltransferase 1         89.0    2e-17    
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    2e-17    
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  89.0    2e-17    
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  89.0    2e-17    
ref|XP_010025890.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  87.8    2e-17    
ref|XP_003556202.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  88.6    2e-17    
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  88.6    2e-17    
gb|ABQ58825.1|  flavonoid O-methyltransferase                         88.6    2e-17    
gb|AAR09601.1|  flavonoid 3'-O-methyltransferase                      88.6    2e-17    
gb|AGS49213.1|  O-methyltransferase                                   88.6    2e-17    
ref|XP_010107135.1|  Caffeic acid 3-O-methyltransferase               89.0    3e-17    
ref|XP_002966220.1|  hypothetical protein SELMODRAFT_85878            88.2    3e-17    
ref|XP_003626615.1|  Caffeic acid 3-O-methyltransferase               87.4    3e-17    
gb|AGS49194.1|  O-methyltransferase                                   88.6    3e-17    
ref|XP_009418619.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  86.7    3e-17    



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  88   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  267
            + A   AR+ I+ELANMISVPMSLNAVVRLNVADAIWQ GSN PLSAS+IL  VLP+G G
Sbjct  8    KEASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSG  67

Query  268  DAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
            DA+NLQRILRMLTSYGVF EH NAD SER++SL EVG+TLVT++DGLSYG YVLQHHQD 
Sbjct  68   DAENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDV  127

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
            LM AWPLVHEAV+D S EPFVKANGEPAY YYGK+PEMNGLM KAMSGVSVPF+KA LDG
Sbjct  128  LMGAWPLVHEAVIDPSVEPFVKANGEPAYQYYGKRPEMNGLMQKAMSGVSVPFIKAVLDG  187

Query  628  YHGFEGVTRLV  660
            Y GF+GVTRLV
Sbjct  188  YDGFQGVTRLV  198



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            AM  ES  ++  ARL I+ELANMISVPMSLNA+VRLNVAD IWQGG+NAPLSASEIL+ V
Sbjct  2    AMEDESSESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARV  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
             PSGG D +NLQRILRMLTSY VF EH+N+DA+ERRYSL E+GKTLVTD +GLSY +YVL
Sbjct  62   HPSGG-DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVL  120

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFM  609
            QHHQDALM+AWPLVHEAVVD ++EPFVKAN EPAY+YYGK+PEMNGLM KAMSGVSVPFM
Sbjct  121  QHHQDALMRAWPLVHEAVVDPTTEPFVKANDEPAYAYYGKQPEMNGLMQKAMSGVSVPFM  180

Query  610  KAFLDGYHGFEGVTRLV  660
            KA L+GY GF+G+ +LV
Sbjct  181  KAILNGYDGFQGMEKLV  197



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 170/195 (87%), Gaps = 3/195 (2%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  265  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKA  615
            HQD LM AWP+VHEAVVDS+ EPFVKANGEPAY YYGKKPEMNGLM KAMSGVSVPFMKA
Sbjct  135  HQDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFMKA  194

Query  616  FLDGYHGFEGVTRLV  660
             LDGY GFEGV RLV
Sbjct  195  ILDGYDGFEGVERLV  209



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   314 bits (805),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGGGDA 
Sbjct  24   QNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGGDAH  83

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  84   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDALMR  143

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWP VHEA +DS++EPFV+ANGEPAYSYYGKK EMN LM +AM+GVSVPFMKA LDGY G
Sbjct  144  AWPRVHEAAIDSTTEPFVRANGEPAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDG  203

Query  637  FEGVTRLV  660
            F+GV +LV
Sbjct  204  FKGVEKLV  211



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 173/208 (83%), Gaps = 3/208 (1%)
 Frame = +1

Query  46   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  225
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  226  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  396
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            ++GLSYG YVLQHHQD LM AWP+VHEAVVDS+ EPFVKANGE AY YYGKKPEMNGLM 
Sbjct  121  QNGLSYGPYVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQ  180

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            KAMSGVSVPFMKA LDGY GFEGV RLV
Sbjct  181  KAMSGVSVPFMKAILDGYDGFEGVERLV  208



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   311 bits (797),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = +1

Query  88   ESAQKNARLT-IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            E++Q N+  T IMELANMISVPM+LNAVVRLNVADAIWQGGSN PLSA+EILS+     G
Sbjct  2    ENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGPG  61

Query  265  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            GDA+NLQRILR+LTS+GVF EH+NADA++RRYSL EVGKTL TD++GLSYGAYVLQHHQD
Sbjct  62   GDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQD  121

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
            ALM+AW LVHEAV+D SSEPFVKANGE AYSYYGKKPEMN LMLKAMSGVSVPFMKAFL+
Sbjct  122  ALMRAWTLVHEAVLDPSSEPFVKANGEGAYSYYGKKPEMNELMLKAMSGVSVPFMKAFLN  181

Query  625  GYHGFEGVTRLV  660
             Y GF+GV  LV
Sbjct  182  SYDGFQGVGTLV  193



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   311 bits (797),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+ELANM+SVPMSLNAVVRLNV DAIWQGG+N PLSA++ILS VL
Sbjct  1    MEDETADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            PSGGGD +NLQRILRMLTSYGVF EH++++  ERR+SL ++GKTLVTD DGLS   YVLQ
Sbjct  61   PSGGGDPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQ  120

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQDALM+ WPL+HEAV+D +SEPFVK NGE AYSYYGKKPEMNGLM KAMSGVSVPFM+
Sbjct  121  HHQDALMRVWPLMHEAVLDPTSEPFVKVNGEAAYSYYGKKPEMNGLMQKAMSGVSVPFMR  180

Query  613  AFLDGYHGFEGVTRLV  660
            A L+ Y GF+GV RLV
Sbjct  181  AILNSYDGFKGVKRLV  196



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   311 bits (797),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 172/207 (83%), Gaps = 5/207 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            +  +  + + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQGGSN+PLSAS 
Sbjct  2    ENHVSHVTTTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASA  61

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREH-INAD----ASERRYSLGEVGKTLVTDK  399
            ILS VLP GGGDA+NLQRILRMLTSYGVF EH ++AD    + +R++SL E+GKTLVTD+
Sbjct  62   ILSHVLPDGGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQ  121

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            +GLSYG Y+LQHHQD LM AWP+VHEAVVD + EPFVK NGEPAY YYGKKPEMNGLM +
Sbjct  122  NGLSYGPYILQHHQDVLMGAWPMVHEAVVDPTIEPFVKVNGEPAYEYYGKKPEMNGLMQR  181

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            AMSGVSVPFMKA LDGY GFEGV RLV
Sbjct  182  AMSGVSVPFMKAILDGYDGFEGVGRLV  208



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPF
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPF  184

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+A LDGY G +GV RLV
Sbjct  185  MRAILDGYDGLKGVKRLV  202



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPF
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPF  184

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+A LDGY G +GV RLV
Sbjct  185  MRAILDGYDGLKGVKRLV  202



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 8/204 (4%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADAS-------ERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+  ++S       ER+YSL EVGKTLVTD +GL
Sbjct  62   A-STGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMS  588
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMS
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMS  180

Query  589  GVSVPFMKAFLDGYHGFEGVTRLV  660
            GVSVPFM+A LDGY GF+GV RLV
Sbjct  181  GVSVPFMEAMLDGYDGFKGVERLV  204



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPF
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPF  184

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+A LDGY G +GV RLV
Sbjct  185  MRAILDGYDGLKGVKRLV  202



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   310 bits (794),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 166/199 (83%), Gaps = 5/199 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQ GSN PLSAS IL+ VLP 
Sbjct  10   TTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPD  69

Query  259  GGGDAQNLQRILRMLTSYGVFREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAY  423
            GGGDA+NLQRILRMLTSYGVF EH+     +  + +R++SL E+GKTLVTD++GLSYG Y
Sbjct  70   GGGDAENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPY  129

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  603
            +LQHHQD LM AWP+VHEAVVD + EPFVKANGEPAY YYGKKPEMNGLM +AMSGVSVP
Sbjct  130  ILQHHQDVLMGAWPMVHEAVVDPTVEPFVKANGEPAYEYYGKKPEMNGLMQRAMSGVSVP  189

Query  604  FMKAFLDGYHGFEGVTRLV  660
            FMKA LDGY GFEGV RLV
Sbjct  190  FMKAILDGYDGFEGVGRLV  208



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 170/198 (86%), Gaps = 6/198 (3%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  265  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  436  HQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            HQ   D LM AWP+VHEAVVDS+ EPFVKANGEPAY YYGKKPEMNGLM KAMSGVSVPF
Sbjct  135  HQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPF  194

Query  607  MKAFLDGYHGFEGVTRLV  660
            MKA LDGY GFEGV RLV
Sbjct  195  MKAILDGYDGFEGVERLV  212



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 170/204 (83%), Gaps = 8/204 (4%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I+ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHI-------NADASERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+       +  ASER+YSL EVGKTLVTD +GL
Sbjct  62   -ASTGSDPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMS  588
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMS
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMS  180

Query  589  GVSVPFMKAFLDGYHGFEGVTRLV  660
            GVSVPFM+A LDGY GF+GV RLV
Sbjct  181  GVSVPFMEAMLDGYDGFKGVERLV  204



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 168/198 (85%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPF
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPF  184

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+A LDGY G +GV RLV
Sbjct  185  MRAILDGYDGLKGVKRLV  202



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 173/211 (82%), Gaps = 6/211 (3%)
 Frame = +1

Query  46   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  225
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  226  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  396
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  397  KDGLSYGAYVLQHHQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            ++GLSYG YVLQHHQ   D LM AWP+VHEAVVDS+ EPFVKANGE AY YYGKKPEMNG
Sbjct  121  QNGLSYGPYVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNG  180

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFMKA LDGY GFEGV RLV
Sbjct  181  LMQKAMSGVSVPFMKAILDGYDGFEGVERLV  211



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 168/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  265  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFM  609
            QHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFM  185

Query  610  KAFLDGYHGFEGVTRLV  660
            +A LDGY G +GV RLV
Sbjct  186  RAILDGYDGLKGVKRLV  202



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 8/204 (4%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADAS-------ERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+  ++S       ER+YSL EVGKTLVTD +GL
Sbjct  62   -ASTGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMS  588
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYGK+PEMN LMLKAMS
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMS  180

Query  589  GVSVPFMKAFLDGYHGFEGVTRLV  660
            GVSVPFM+A LDGY GF+GV RLV
Sbjct  181  GVSVPFMEAMLDGYDGFKGVERLV  204



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   306 bits (783),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 168/197 (85%), Gaps = 6/197 (3%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLSA +ILS VLP GG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGG  65

Query  265  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFM  609
            QHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFM  185

Query  610  KAFLDGYHGFEGVTRLV  660
            +A LDGY G +GV RLV
Sbjct  186  RAILDGYDGLKGVKRLV  202



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E   ++K ARL+I+ELANMISVPMSLNAVVRLNVADAIW+GGSNAPLSA +IL  VLP G
Sbjct  3    EDTDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGG  62

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
            GGDA+NLQR+LRMLTSY VF EH+     ER+YSL +VGKTLVTD+ GLSYG+YVLQHHQ
Sbjct  63   GGDAENLQRVLRMLTSYDVFEEHLGG--GERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQ  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
            DALM+AWPLVHEAVVD S EPF +ANGE AY YY KKPEMN LMLKAMSGVSVPFMKA L
Sbjct  121  DALMRAWPLVHEAVVDPSKEPFERANGEAAYDYYLKKPEMNELMLKAMSGVSVPFMKALL  180

Query  622  DGYHGFEGVTRLV  660
              Y+GF+GV +LV
Sbjct  181  ASYNGFQGVEKLV  193



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            +E     K  RL IMELANMISVPMSL A +RL+V DAIWQGG+N PLSAS+IL+ +LPS
Sbjct  4    NECRDGGKKVRLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPS  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            GGGDA+NLQRILR+LTSYGVF EH      ER+YSL E+GK+LVTD +GLSY  YVLQHH
Sbjct  64   GGGDAENLQRILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHH  122

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
            QDALM AWPLVHEAV+D + EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSVPFM + 
Sbjct  123  QDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSV  182

Query  619  LDGYHGFEGVTRLV  660
            LDGY GF+GV RLV
Sbjct  183  LDGYDGFKGVKRLV  196



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  24   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  82

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  83   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  142

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWP VHEA +DS++EPFV+ANGE AYSYYGKK EMN LM +AM+GVSVPFMKA LDGY G
Sbjct  143  AWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDG  202

Query  637  FEGVTRLV  660
            F+GV +LV
Sbjct  203  FKGVEKLV  210



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 163/196 (83%), Gaps = 2/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+   + NARL I+ELANMISVPMSLNA+VRL V DAIWQ GSN PLSASEIL+  L
Sbjct  1    MADETTEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARAL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  D +NLQRILRMLT+Y VF EHI   +SER+YSL E+GKTLVTD +GLSY AYVLQ
Sbjct  61   PTG--DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQDALMKAWP++HEAVVD   EPFVKANGEPAYSYYG K EMN LM KAMSGVSVPFMK
Sbjct  119  HHQDALMKAWPILHEAVVDPKEEPFVKANGEPAYSYYGDKSEMNELMQKAMSGVSVPFMK  178

Query  613  AFLDGYHGFEGVTRLV  660
            A L+GY+GF+GV RLV
Sbjct  179  AILEGYNGFKGVERLV  194



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   301 bits (770),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 168/200 (84%), Gaps = 6/200 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  420
            PSG  D  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PSG--DPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYGKKPEMN LM +AMSGVSV
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSV  178

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA L+GY+GF+GV RLV
Sbjct  179  PFMKAILNGYNGFDGVQRLV  198



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  61   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  119

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  120  NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  179

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWP VHEA +DS++EPFV+ANGE AYSYYGKK EMN LM +AM+GVSVPFMKA LDGY G
Sbjct  180  AWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDG  239

Query  637  FEGVTRLV  660
            F+GV +LV
Sbjct  240  FKGVEKLV  247



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 163/186 (88%), Gaps = 1/186 (1%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAQNL  282
            ARL IMELANMISVPMSLNAVV+L VADAIWQ GSNAPLS  EIL+ +  P GGGDA+NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            QRILRMLTSYGVF+EH+  D+S+RRYSL EVGKTLVTD++GLS+G+YVLQHHQDALM+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFE  642
             +VHEAV DSS EPFVKANGEPAY+YYGK  EMN LML AMSGVSVPFMKA L+GY GF+
Sbjct  135  TMVHEAVNDSSIEPFVKANGEPAYNYYGKNSEMNSLMLNAMSGVSVPFMKAILEGYDGFQ  194

Query  643  GVTRLV  660
            GV  LV
Sbjct  195  GVKTLV  200



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 167/200 (84%), Gaps = 6/200 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  420
            PSG  D  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PSG--DPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYGKKPEMN LM +AMSGVSV
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSV  178

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA L+GY GF+GV RLV
Sbjct  179  PFMKAILNGYSGFDGVQRLV  198



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 3/198 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M +ES   +KNA+L I+ELANMISVPMSLNAVV+LNVADAIWQ G N+PLSASEILS + 
Sbjct  1    MENESSETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRIN  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
             SGG D  NLQRILRML+SY VF EH++A    +ERRYSL E+GKTLVTD +GLSYGAYV
Sbjct  61   LSGG-DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYV  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALM+AWPLVHEAV+DS++EPF KANGEPAY YYGK+PEMN LM KAMSG+SVPF
Sbjct  120  LQHHQDALMRAWPLVHEAVLDSTTEPFAKANGEPAYDYYGKRPEMNELMQKAMSGLSVPF  179

Query  607  MKAFLDGYHGFEGVTRLV  660
            MKA L+GY GF+GV ++V
Sbjct  180  MKAVLNGYDGFQGVEKIV  197



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   294 bits (753),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
             HQDALM+AWPLVHEAV+D S EPF +ANGE AY YY KKPEMN LMLKAM+GVSVPFMK
Sbjct  119  LHQDALMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMK  178

Query  613  AFLDGYHGFEGVTRLV  660
            A  + YHGF+ V +LV
Sbjct  179  ALFESYHGFQNVEKLV  194



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 166/194 (86%), Gaps = 2/194 (1%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+
Sbjct  4    EESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPA  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            GGGDA+NLQR+LRML SYGVF EH++A   ER+YSL +VGKTLVTD+ GLSY  YVLQHH
Sbjct  64   GGGDAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHH  121

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
            QDALM+AWP+VHEAVVD + EPF +ANGEPAY YY K PEMN LM++AMSGVSVPF++A 
Sbjct  122  QDALMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAM  181

Query  619  LDGYHGFEGVTRLV  660
            L+GY GF+GV +LV
Sbjct  182  LEGYDGFQGVEKLV  195



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 166/194 (86%), Gaps = 2/194 (1%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+
Sbjct  4    EESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPA  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            GGGDA+NLQR+LRML SYGVF EH++A   ER+YSL +VGKTLVTD+ GLSY  YVLQHH
Sbjct  64   GGGDAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHH  121

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
            QDALM+AWP+VHEAVVD + EPF +ANGEPAY YY K PEMN LM++AMSGVSVPF++A 
Sbjct  122  QDALMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAM  181

Query  619  LDGYHGFEGVTRLV  660
            L+GY GF+GV +LV
Sbjct  182  LEGYDGFQGVEKLV  195



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQDALM+AWPLVHEAV+D S EPF +ANGE AY YY KKPEMN LMLKAM+GVSVPFMK
Sbjct  119  HHQDALMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMK  178

Query  613  AFLDGYHGFEGVTRLV  660
            A  + YHGF+ V +LV
Sbjct  179  ALFESYHGFQNVEKLV  194



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP-  255
             ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP 
Sbjct  4    EESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPG  63

Query  256  SGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            + G DA+NLQR+LRML SYGVFREH+ A   ER YSL EVGKTLVTD+ GLSY  YVLQH
Sbjct  64   ADGADAENLQRLLRMLASYGVFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQH  121

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKA  615
            HQDALM+AWPLVHEAVVD + EPF  ANGEPAY YY K+PEMN LM++AMSGVSVPFM+A
Sbjct  122  HQDALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRA  181

Query  616  FLDGYHGFEGVTRLV  660
             L+GY GF+GV +LV
Sbjct  182  MLEGYDGFQGVEKLV  196



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   293 bits (751),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++K +RL IMELANMISVPM+LNAVVRLNVADAIW GG+NAPLSA++IL  +L
Sbjct  1    MEEESTDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRIL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P G GDA+NLQR+LR+LTSYGVF EH+ A   ER+YSL +VGK LVTD+ GLSYGAYVLQ
Sbjct  61   PVGDGDAENLQRLLRILTSYGVFHEHLAA--GERKYSLTDVGKALVTDEQGLSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQDALM+AW LVHEAVVD + EPF +ANGE AY+YY K+ EMN LM+KAMSGVSVPFM+
Sbjct  119  HHQDALMRAWTLVHEAVVDPTKEPFERANGEGAYAYYLKQAEMNELMVKAMSGVSVPFMR  178

Query  613  AFLDGYHGFEGVTRLV  660
            A L+GY GF+GV RLV
Sbjct  179  AMLEGYDGFQGVERLV  194



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 164/198 (83%), Gaps = 2/198 (1%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A G  S +   + RL IMELANMISVPMSLNAVV+L V DA+W+ GSNAPLS  EIL+ +
Sbjct  4    ANGEPSNNNNNDERLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKI  63

Query  250  L-PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYV  426
              P GGGDA+NLQRILRMLTSYGVF+EH++ D S+RRYSL +VGKTLVTD++GLS+G+YV
Sbjct  64   RGPQGGGDAENLQRILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYV  122

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            LQHHQDALMKAW +VHEAV DSS EPF KANGEPAYSYYGK  EMN LML AMSGVSVPF
Sbjct  123  LQHHQDALMKAWTMVHEAVNDSSIEPFAKANGEPAYSYYGKNSEMNSLMLNAMSGVSVPF  182

Query  607  MKAFLDGYHGFEGVTRLV  660
            MKA L GY GF+GV  LV
Sbjct  183  MKAILQGYDGFQGVKTLV  200



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  A+  ARL I+ELANMISVPMSLNAVVRL V DA+WQGGSNAPLSASEIL+   
Sbjct  1    MADETSDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSP  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADAS----ERRYSLGEVGKTLVTDKDGLSYGA  420
             +  GDA+NLQR+LRML S+GVF EH+   AS    ERRYSL EVGKTLVTD +GLSY  
Sbjct  61   AAPAGDAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAP  120

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQHHQDALM+AWPLVHEAV+D ++EPFVKANG+ AY++YGK PEMN LM +AMSGVSV
Sbjct  121  YVLQHHQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSV  180

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA LDGY GF GV RLV
Sbjct  181  PFMKAILDGYDGFSGVGRLV  200



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 165/200 (83%), Gaps = 6/200 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             E+ +   NARL IMELANMISVPMSLNA+VRL VADAIW+GGSNAPLS +EILS +  S
Sbjct  6    CEASNNNNNARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRAS  65

Query  259  ------GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
                  GGGDA+NLQRILRMLTSY VF EHI  D S+RRYSL EVGKTLVTD++GLSYG+
Sbjct  66   EGGGGGGGGDAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGS  125

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYGK+PEMN LML AMSGVSV
Sbjct  126  YVLQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKRPEMNNLMLNAMSGVSV  185

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA L+ Y GF+GV  LV
Sbjct  186  PFMKAILESYEGFQGVKILV  205



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 163/205 (80%), Gaps = 6/205 (3%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E    E+ +   NARL IMELANMISVPMSLNAVVRL VADAIW+GGSNAPLS +EIL+
Sbjct  1    MENRNGEASNNNNNARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILA  60

Query  244  SVLPSGGGDAQ------NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDG  405
             +  S GG         NLQRILRMLTSY VF EHI  D  +RRYSL EVGKTLVTDK+G
Sbjct  61   KISGSEGGGGAGGGDAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNG  120

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            LSYG+Y+LQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYGKKPEMN LML AM
Sbjct  121  LSYGSYILQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKKPEMNNLMLNAM  180

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
            SGVSVPFMKA L+ Y+GF+GV  LV
Sbjct  181  SGVSVPFMKAILESYNGFQGVKTLV  205



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            ARL IMELANMISVPMSLNA+++L VADAIW+GGSNAPLS +EIL+ + P GGGDA+NLQ
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  286  RILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  465
            RILRMLTSY VF EH+  D S+RRYSL EVGKTLVTD++GLS+G YVLQHHQDALM+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  466  LVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEG  645
            +VHE V DSSS+PFVK  GE  YSYYGK PEMN LM  AMSGVS+PFMK  L+ Y GFEG
Sbjct  136  MVHETVNDSSSDPFVKVYGEQPYSYYGKNPEMNSLMFNAMSGVSMPFMKVMLERYDGFEG  195

Query  646  VTRLV  660
            V  LV
Sbjct  196  VKTLV  200



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL ++ELANMISVPMSLNAVVRL V DAIWQ GSN+PLSAS+IL+ VL
Sbjct  1    MEDESSEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVL  60

Query  253  PSGGG-----DAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
            PS        D  NLQR+LR LTSYGVF EHI+ +   R+YSL +VGKTLVTD DGLSY 
Sbjct  61   PSSSSSAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
             YVLQHHQDALM+AW L+HEAVVD ++EPF KANGEPAY YYGK PEMNGLM +AMSGVS
Sbjct  119  PYVLQHHQDALMRAWSLLHEAVVDPTTEPFAKANGEPAYKYYGKMPEMNGLMQRAMSGVS  178

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
            VPFMKA L+GY GFEGV RLV
Sbjct  179  VPFMKAILNGYDGFEGVRRLV  199



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLL  60

Query  253  -PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
             PSGGGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVL
Sbjct  61   LPSGGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVL  119

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFM  609
            QHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMNGLMLKAMSGVSVPFM
Sbjct  120  QHHQDALMRAWPLVHTAVVEPETEPYVKANGEGAYVQYGKNEEMNGLMLKAMSGVSVPFM  179

Query  610  KAFLDGYHGFEGVTRLV  660
            KA LDGY GF+ V RLV
Sbjct  180  KAILDGYDGFKSVERLV  196



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   286 bits (733),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +1

Query  37   EKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  216
            E++IT K++ + M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW GG+N+
Sbjct  20   EEKITNKQK-KKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANS  78

Query  217  PLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD  396
            PLSA+EILS +L   GGD +NLQRILR LTSYGVF EH+   ++ER+YSL +VGKTLVTD
Sbjct  79   PLSAAEILSRLLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTD  137

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
              GLSY AYVLQHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMN LML
Sbjct  138  SGGLSYAAYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKNEEMNDLML  197

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            KAMSGVSVPFMKA L+GY GF+ V RLV
Sbjct  198  KAMSGVSVPFMKAILEGYDGFKSVERLV  225



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   283 bits (724),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL IMELANMISVPMSLNA V+L VADAIW GG+N+P+SA+EILS   
Sbjct  1    MEHESSERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
              G G  +NLQRILRMLTSYGVF EH + D SER+YSL +VGKTLVTD DGLSYG+YVLQ
Sbjct  61   -GGAGGPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQ+ALM+AWPLVH AV D + EP+VKANGEPAY+ YGK  EMNGLML+AMSGVSVPFM+
Sbjct  119  HHQEALMRAWPLVHTAVEDPTREPYVKANGEPAYAQYGKSEEMNGLMLRAMSGVSVPFMR  178

Query  613  AFLDGYHGFEGVTRLV  660
            A LDGY GF+ V  LV
Sbjct  179  AILDGYDGFKSVEHLV  194



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 162/200 (81%), Gaps = 5/200 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSASEIL  +L
Sbjct  1    MEKESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLL  60

Query  253  -PSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
             PS    GGD +NLQRILRMLTSYGVF EH+   +SER++SL +VGKTLVTD DGLSY A
Sbjct  61   IPSATTTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAA  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            Y+LQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMN LMLKAMSGVSV
Sbjct  120  YILQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKSEEMNSLMLKAMSGVSV  179

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA L+GY GF+ V RLV
Sbjct  180  PFMKAILEGYEGFKSVERLV  199



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 157/201 (78%), Gaps = 5/201 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLL  60

Query  253  PSG-----GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
             S       GD +NLQRILRMLTSYGVF EHIN  + ER+YSL +VGKTLVTD  GLSY 
Sbjct  61   LSSSTTTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYA  120

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
            AYVLQHHQ+ALM+AWPLVH AV++  +EP+VKANGE AYS YGK  EMNGLM KAMSGVS
Sbjct  121  AYVLQHHQEALMRAWPLVHTAVMEPETEPYVKANGEAAYSQYGKCEEMNGLMQKAMSGVS  180

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
             PFMKA LDGY GF+ V  LV
Sbjct  181  APFMKAILDGYDGFKSVEHLV  201



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 159/203 (78%), Gaps = 7/203 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G+N+PLSASEIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLL  60

Query  253  -PSG----GGDAQNLQRILRMLTSYGVFREHINADAS--ERRYSLGEVGKTLVTDKDGLS  411
             PS     GGD +NLQRILRMLTSYGVF EH+N DA   ER+YSL  VGKTLVTD  GLS
Sbjct  61   LPSRDSTIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLS  120

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
            Y AYVLQHHQ++LM+AWPLVH AVV+  +EP+VKANGE AY  YGK  EMNGLM KAMSG
Sbjct  121  YAAYVLQHHQESLMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKCEEMNGLMQKAMSG  180

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
            VSVPFMKA LDGY GF+ V  LV
Sbjct  181  VSVPFMKAILDGYDGFKSVEHLV  203



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   277 bits (709),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADA+W GG+N+PLSA+EIL+ +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
               GGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVLQ
Sbjct  61   LPSGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQ  119

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            HHQDALM+AWPLVH AVV+  +EP+VKAN E AY  YGK  EMN LMLKAMSGVSVPFMK
Sbjct  120  HHQDALMRAWPLVHTAVVEPETEPYVKANSEAAYVQYGKNEEMNDLMLKAMSGVSVPFMK  179

Query  613  AFLDGYHGFEGVTRLV  660
            A L+GY GF+ V +L+
Sbjct  180  AILEGYDGFKSVEQLI  195



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 161/200 (81%), Gaps = 5/200 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M +ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSA+EIL  + 
Sbjct  1    MENESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLH  60

Query  250  LPSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
            LPS    GGD +NLQRILRMLTSYGVF EH+   + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSHTTIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAA  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVSV
Sbjct  120  YVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKSEEMNGLMQKAMSGVSV  179

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA LDGY GF+ V  LV
Sbjct  180  PFMKAILDGYDGFKSVDILV  199



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = +1

Query  88   ESAQKNAR-LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            E  Q N+  L IMELAN++SVPMSLNAV++L V D IWQ GSN PLSA+EILS++     
Sbjct  2    ERIQTNSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPA  61

Query  265  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            GDA+NLQRILR+LTSYGVF EHI  D  ERRYSL EVGK L  D++GLSY  Y+LQHHQD
Sbjct  62   GDAENLQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQD  121

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
            ALM AWP VHEAV+D SSEPFVK +GE  YSYYGK PEMN LM KAMSGVSVPFM+ FLD
Sbjct  122  ALMLAWPRVHEAVLDPSSEPFVKVHGELPYSYYGKNPEMNLLMQKAMSGVSVPFMETFLD  181

Query  625  GYHGFEGVTRLV  660
             Y GF+GV  LV
Sbjct  182  RYDGFQGVETLV  193



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 157/201 (78%), Gaps = 7/201 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
            VPFMKA LDGY GF+ V  LV
Sbjct  179  VPFMKAILDGYDGFKYVEHLV  199



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL IMELANMISVPMSLNA VRL +AD IW  G N+PLSA+EIL  +L
Sbjct  1    MEDESSERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLL  60

Query  253  -PSGG---GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
             PS     GD +NLQRILRMLTSY VF EH+ A + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSDTTITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAA  120

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSV  600
            YVLQHHQ+ALM+AWPLVH AVV   +EP++KANGE AY+ YGK  EMN LM KAMSGVSV
Sbjct  121  YVLQHHQEALMRAWPLVHTAVVQPETEPYMKANGETAYAQYGKCEEMNCLMQKAMSGVSV  180

Query  601  PFMKAFLDGYHGFEGVTRLV  660
            PFMKA LDGY GF+ V  LV
Sbjct  181  PFMKAILDGYDGFKSVDHLV  200



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 157/201 (78%), Gaps = 7/201 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
            VPFMKA LDGY GF+ V  LV
Sbjct  179  VPFMKAILDGYDGFKYVEHLV  199



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 157/201 (78%), Gaps = 7/201 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+P+SA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVS
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVS  178

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
            VPFMKA LDGY GF+ V  LV
Sbjct  179  VPFMKAILDGYDGFKYVEHLV  199



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 148/199 (74%), Gaps = 19/199 (10%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MELAN++SVPMSLNAV++L V D IWQ G N PLSA+EILS+V      DA+NLQRILR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  301  LTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEA  480
            LTSYGVF EHI  D S RRYSL EVGK L TD++GLSY  YVLQHHQDA+M AWPLVHEA
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120

Query  481  VVDSSSEPFVKANGEPA-------------------YSYYGKKPEMNGLMLKAMSGVSVP  603
            V+D SSEPFVK +GE A                   YSYYGK PEMN LM KAMSGVSVP
Sbjct  121  VLDPSSEPFVKVHGELAYSYYGKYPEMNLLMHGELPYSYYGKYPEMNLLMQKAMSGVSVP  180

Query  604  FMKAFLDGYHGFEGVTRLV  660
            FMKAFLDGY GF+GV  LV
Sbjct  181  FMKAFLDGYDGFQGVETLV  199



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 147/194 (76%), Gaps = 20/194 (10%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP 
Sbjct  4    EESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPG  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            G                  VFREH+ A   ER YSL EVGKTLVTD+ GLSY  YVLQHH
Sbjct  64   G------------------VFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHH  103

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
            QDALM+AWPLVHEAVVD + EPF  ANGEPAY YY K+PEMN LM++AMSGVSVPFM+A 
Sbjct  104  QDALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAM  163

Query  619  LDGYHGFEGVTRLV  660
            L+GY GF+GV +LV
Sbjct  164  LEGYDGFQGVEKLV  177



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 142/187 (76%), Gaps = 10/187 (5%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP---  603
            HHQD L+KAWPL HEAVVD   EPFVKAN     +YYG KPEMN LM KAMSGVSVP   
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVL  173

Query  604  FMKAFLD  624
            FMKA ++
Sbjct  174  FMKAIVE  180



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   246 bits (629),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 142/187 (76%), Gaps = 10/187 (5%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP---  603
            HHQD L+KAWPL HEAVVD   EPFVKAN     +YYG KPEMN LM KAMSGVSVP   
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVL  173

Query  604  FMKAFLD  624
            FMKA ++
Sbjct  174  FMKAIVE  180



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 152/203 (75%), Gaps = 11/203 (5%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  262  --GGDAQNLQRILRMLTSYGVFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSY  414
                DA+NLQR+LR+LTS+GVF EH++  +S      ERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
            GAYVLQHHQ+ L+KAWP +H A++D+S+EPF + NGEPAY YYGK  E+N  M  AMSGV
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGV  192

Query  595  SVPFMKAFL-DGYHGFEGVTRLV  660
            SVP+MKA L  GY GFEGV  LV
Sbjct  193  SVPYMKALLGSGYDGFEGVKTLV  215



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            AQ   RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGDA
Sbjct  14   AQSKERLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGDA  73

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALM  453
            +NLQRILR+LT+Y +F E +N+   ER+YSL +VGKTL+ D DGLSY AYVLQHHQ+ALM
Sbjct  74   ENLQRILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEALM  132

Query  454  KAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH  633
            +AW LV EAV D + EPF KANGE A +YY K+ ++  L+  +++G+SVPFM+  L+ Y 
Sbjct  133  RAWALVGEAVEDPTVEPFEKANGESAVAYYIKRADVMSLIYSSLAGMSVPFMREMLENYD  192

Query  634  GFEGVTRL  657
            GF+GV  L
Sbjct  193  GFQGVETL  200



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LT+YGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +G SY  YVLQHHQDALM AWPLVHEA++D + EPFVK +GEP YSYYGK PEMNG
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + LDGY GF+GV RLV
Sbjct  135  LMRKAMSGVSVPFMTSILDGYDGFKGVKRLV  165



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNG
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM +A+SGVSVPFM + LD Y+GF+GV RLV
Sbjct  135  LMRRAISGVSVPFMTSVLDSYNGFKGVKRLV  165



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNG
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM +A+SGVSVPFM + LD Y+GF+GV RLV
Sbjct  135  LMRRAISGVSVPFMTSVLDSYNGFKGVKRLV  165



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYGK PEMNG
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + L+GY+GF+GV RLV
Sbjct  135  LMRKAMSGVSVPFMTSVLEGYNGFKGVKRLV  165



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYGK PEMNG
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + L+GY+GF+GV RLV
Sbjct  135  LMRKAMSGVSVPFMTSVLEGYNGFKGVKRLV  165



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDALM  WPLVHEAV+D + EP VK +G+PAYSYYGK PEMNG
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  122

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + LDGY+GF+GV RLV
Sbjct  123  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLV  153



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHHQDALM  WPLV+EAV+D + EP VK +G+PAYSYYGK PEMNG
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  134

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + LDGY+GF+GV RLV
Sbjct  135  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLV  165



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGDA
Sbjct  11   SQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGDA  70

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALM  453
            +NLQRILR+LT+Y +F E ++++  +R+YSL EVGK LV D DGLSYG YVLQH+QD  +
Sbjct  71   ENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQYL  129

Query  454  KAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH  633
            +AWPLV EAV D + EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y 
Sbjct  130  RAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKYD  189

Query  634  GFEGVTRLV  660
            GF+GV  LV
Sbjct  190  GFKGVESLV  198



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWPLV +AV D + EPF K +GE AY+Y  K PE   L   +MSG+S+P+M+  L+ Y G
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDG  190

Query  637  FEGVTRLV  660
            F+GV  LV
Sbjct  191  FKGVETLV  198



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWPLV +AV D + EPF K +GE AY+Y  K PE   L   +MSG+S+P+M+  L+ Y G
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDG  190

Query  637  FEGVTRLV  660
            F+GV  LV
Sbjct  191  FKGVETLV  198



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  +R+YSL ++GK LV D DGLSY  YVLQH+QD  ++
Sbjct  72   NLQRILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWPLV +AV D+S EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y G
Sbjct  131  AWPLVGDAVEDASVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGLSMPHMNEMLEKYDG  190

Query  637  FEGVTRLV  660
            F+GV  LV
Sbjct  191  FKGVETLV  198



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            AWPLV +AV D + EPF K +GE AY+Y  K PE   L   +MSG+S+P+M+  L+ Y G
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDG  190

Query  637  FEGVTRLV  660
            F+GV  LV
Sbjct  191  FKGVETLV  198



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 11/183 (6%)
 Frame = +1

Query  142  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG--GGDAQNLQRILRMLTSYG  315
            +VPMSL A+VRL V +AIW  GSN P+SA+EILS  LP      DA+NLQR+LR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  316  VFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALMKAWPLVH  474
            VF EH++  +S      ERRY L EVG+TLV+ D+   S+GAYVLQHHQ+ L+KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  475  EAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL-DGYHGFEGVT  651
             A++D+S+EPF + NGEPAY YYGK  E+N  M  AMSGVSVP+MKA L  GY GFEGV 
Sbjct  125  TAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVK  184

Query  652  RLV  660
             LV
Sbjct  185  TLV  187



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 146/203 (72%), Gaps = 8/203 (4%)
 Frame = +1

Query  76   GSESESAQ--KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            G E  +++  K  RL +MELANMISVPM+LNAVVRLNV DAIWQ GSN+PL+A+EIL+ +
Sbjct  8    GREDPTSEVGKQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALL  67

Query  250  LPSGGGDAQN--LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  423
             P     +    LQR+LR+L S+GVF E+  A +  RRYSL +VG+TLV   DG SY AY
Sbjct  68   RPPPPSSSDPSVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAY  127

Query  424  VLQHHQDALMKAWPLVHEAVVD-SSSEPFVKANGE-PAYSYYGKKPEMNGLMLKAMSGVS  597
            VLQHHQDAL++AWP +HEAV+D +  EPF +ANG  PAY+YYG   E N LM +AM GVS
Sbjct  128  VLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGVPAYAYYGGDREANALMQRAMWGVS  187

Query  598  VPFMKAFLDGY--HGFEGVTRLV  660
             PFM+A LDGY   GF  V  LV
Sbjct  188  EPFMEALLDGYGSAGFGSVETLV  210



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 127/166 (77%), Gaps = 4/166 (2%)
 Frame = +1

Query  175  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAQNLQRILRMLTSYGVFREHI-NADAS  348
            L V +AIW  GSN PL+A+EILS +LP S   D +NLQR+LR+LT+Y +F EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  349  ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEP  528
            +RRYSL EVG+TLV D DGLSYG Y++QHHQDAL+++WPLVH AVVD  +EPFV+ANGE 
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMAVVDPVTEPFVRANGES  120

Query  529  AYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD-GYHGFE-GVTRLV  660
            AY YYGK  EMN LM KAM+G SVPFM+  LD GY GFE  V RLV
Sbjct  121  AYWYYGKDEEMNELMQKAMAGFSVPFMRELLDGGYDGFERDVERLV  166



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 146/207 (71%), Gaps = 15/207 (7%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+   +  ARL IMELANMISVPM+LNAVVRL V  AIW  G+N PL+A+ I+S +LP+ 
Sbjct  18   ETSETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNN  77

Query  262  G-GDAQNLQRILRMLTSYGVFREH--INADASERRYSLGEVGKTLVTDKDGL--------  408
               DA NL R+LR+L++YGVF EH  +  D   RRYSL EVG+TLV    G         
Sbjct  78   PEADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGG  136

Query  409  -SYGAYVLQHHQDALMKAWPLVHEAVVDSSSE-PFVKANGEPAYSYYGKKPEMNGLMLKA  582
             S+G YVLQHHQ+AL++AW  V  AVV  +S+ PF  ANGEPAY YYGK  EMNGLM +A
Sbjct  137  SSHGEYVLQHHQEALVRAWLQVDRAVVGPTSKTPFEVANGEPAYDYYGKNEEMNGLMQRA  196

Query  583  MSGVSVPFMKAFLD-GYHGFEGVTRLV  660
            M+GVSVPFMKA ++ GY GF+GV +LV
Sbjct  197  MAGVSVPFMKAVVEGGYDGFDGVVKLV  223



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   203 bits (516),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 128/169 (76%), Gaps = 10/169 (6%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  262  --GGDAQNLQRILRMLTSYGVFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSY  414
                DA+NLQR+LR+LTS+GVF EH++  +S      ERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEM  561
            GAYVLQHHQ+ L+KAWP +H A++D+S+EPF + NGEPAY YYGK  E+
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDEL  181



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANMI+VPM+L AV+RL V  A+W GG+N PLSA+E+    LP+G  D   L
Sbjct  22   EARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSVL  77

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLV-TDKDGLSYGAYVLQHHQDALMKA  459
            +R+LR+L S GVF EH      ERRY+L  VG+TLV +   G SY  YVLQHHQDAL+ A
Sbjct  78   ERLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVLA  137

Query  460  WPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH  633
            WP +HEAV+D +  EPF +A+ G PAY+YYG+  + N +ML+AM+GVS PFM+A LDGY 
Sbjct  138  WPRLHEAVLDPAGPEPFARAHAGVPAYAYYGQDRDANEVMLRAMTGVSEPFMEALLDGYE  197

Query  634  -GFEGVTRLV  660
             GFEGV  LV
Sbjct  198  GGFEGVGTLV  207



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = +1

Query  118  IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILR  297
            +MELANMISVPM+L AV+RL V  A+W GG+NAPLSA+E+    LP G  D   L+R+LR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  298  MLTSYGVFREHINADA-SERRYSLGEVGKTLV-TDKDGLSYGAYVLQHHQDALMKAWPLV  471
            +L S GVF EH    A S RR++L  VG+TLV +   G SY  YVLQHHQDAL+ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  472  HEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY-HGFE  642
            HEAV+D +  EPF +AN G PAY+YYG+  E N +ML+AM+GVS PFM+A LDGY  GFE
Sbjct  117  HEAVLDPAGPEPFARANAGVPAYAYYGRDREANEVMLRAMTGVSEPFMEALLDGYAAGFE  176

Query  643  GVTRLV  660
            GV  LV
Sbjct  177  GVATLV  182



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 142/200 (71%), Gaps = 13/200 (7%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  270
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  429
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  430  QHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVP  603
            QHHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG   E N LM +AM GVS P
Sbjct  170  QHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVSKP  229

Query  604  FMKAFLDGY-HGFEGVTRLV  660
            FM AFL+G+   F GV  +V
Sbjct  230  FMDAFLNGHAAAFAGVRTVV  249



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 142/200 (71%), Gaps = 13/200 (7%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  270
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  429
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  430  QHHQDALMKAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVP  603
            QHHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG   E N LM +AM GVS P
Sbjct  170  QHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVSKP  229

Query  604  FMKAFLDGY-HGFEGVTRLV  660
            FM AFL+G+   F GV  +V
Sbjct  230  FMDAFLNGHAAAFAGVRTVV  249



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 134/196 (68%), Gaps = 14/196 (7%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  AIW GG+NAP SA+E+    LP+G  D   L
Sbjct  26   EARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVL  81

Query  283  QRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTD-KDGLSYGAYVLQHHQDA  447
            +R+LR+L S GVF E  +       + RR++L  VG+TLV +   G SY  YVLQHHQDA
Sbjct  82   ERLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDA  141

Query  448  LMKAWPLVHEAVVDS-SSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
            L+ AWP +HEAV+D    EPF +AN G PAY+YYGK  E N +ML+AM+GVS PFM A L
Sbjct  142  LVAAWPRLHEAVLDPRGPEPFARANAGVPAYAYYGKDREANQVMLRAMTGVSEPFMHALL  201

Query  622  DGY---HGFEGVTRLV  660
            DGY    GF GV  LV
Sbjct  202  DGYGFDGGFHGVATLV  217



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  298  MLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPL  468
            MLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQHHQD LM AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  469  VHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGV  648
            VHEAVVDS+ EPFVKANGE AY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV
Sbjct  61   VHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGV  120

Query  649  TRLV  660
             RLV
Sbjct  121  ERLV  124



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 144/206 (70%), Gaps = 15/206 (7%)
 Frame = +1

Query  76   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  255
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  256  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  414
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  415  GAYVLQHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMS  588
              YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYGK  E N +ML+AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  589  GVSVPFMKAFLDGY--HGFEGVTRLV  660
            GVS PFM+A L+GY   GFEGV+ LV
Sbjct  180  GVSEPFMEALLEGYGDGGFEGVSTLV  205



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 144/206 (70%), Gaps = 15/206 (7%)
 Frame = +1

Query  76   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  255
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  256  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  414
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  415  GAYVLQHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMS  588
              YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYGK  E N +ML+AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  589  GVSVPFMKAFLDGY--HGFEGVTRLV  660
            GVS PFM+A L+GY   GFEGV+ LV
Sbjct  180  GVSEPFMEALLEGYGDGGFEGVSTLV  205



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  283  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALM  453
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  454  KAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             AWP +HEAV+D +  EPF +AN G  AY+YYGK  + N +ML+AM+GVS PFM A LDG
Sbjct  140  AAWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDG  199

Query  628  Y---HGFEGVTRLV  660
            Y    GF GV  LV
Sbjct  200  YGAAGGFRGVATLV  213



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 133/194 (69%), Gaps = 12/194 (6%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  283  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALM  453
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  454  KAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             AWP +HEAV+D +  EPF +AN G  AY+YYGK  + N +ML+AM+GVS PFM A LDG
Sbjct  140  AAWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDG  199

Query  628  Y---HGFEGVTRLV  660
            Y    GF GV  LV
Sbjct  200  YGAAGGFRGVATLV  213



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 108/151 (72%), Gaps = 29/151 (19%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
                 GLSY  Y+LQHHQDALM AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNG
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  106

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPF+ + LDGY+GF+GV +LV
Sbjct  107  LMRKAMSGVSVPFITSVLDGYNGFKGVKQLV  137



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 136/203 (67%), Gaps = 10/203 (5%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A   + E +   ARL +MELANMISVPM+L A +RL V  AIW  G+NAPLSA+++    
Sbjct  4    AASEDEELSPAEARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----  59

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADASE--RRYSLGEVGKTLV-TDKDGLSYGA  420
            LP+   D   L+R+LR+L S GVF EH     +E  RR++L  VG+TLV     G SY  
Sbjct  60   LPADHPDPSVLERVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYAD  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGV  594
            YVLQHHQDAL+ AWP +HEA++D +  EPF +A+ G PAY++Y +  E N +ML+ M+GV
Sbjct  120  YVLQHHQDALVLAWPRLHEALLDPAGPEPFARAHRGLPAYAFYAQDKEANEVMLRGMTGV  179

Query  595  SVPFMKAFLDGYH-GFEGVTRLV  660
            S PFM+A LDGY  GFE V  LV
Sbjct  180  SEPFMEALLDGYAGGFEDVRTLV  202



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 103/125 (82%), Gaps = 4/125 (3%)
 Frame = +1

Query  298  MLTSYGVFREHINADAS----ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  465
            ML S+GVF EH+   AS    ERRYSL EVGKTLVTD +GLSY  YVLQHHQDALM+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  466  LVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEG  645
            LVHEAV+D ++EPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY GF G
Sbjct  61   LVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSG  120

Query  646  VTRLV  660
            V RLV
Sbjct  121  VGRLV  125



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 127/221 (57%), Gaps = 45/221 (20%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVP------MSLNAVVRLNVAD---------------  189
            M  E+   + N RL I+ELANMI  P          A  R+                   
Sbjct  1    MADETMETRDNGRLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCR  60

Query  190  ----AIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERR  357
                 IWQGGSN PLSASEIL+ VLP    D +N Q IL+ML+SYG+F EHI        
Sbjct  61   TTLVTIWQGGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI--------  110

Query  358  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYS  537
                      VT+++GL Y AY+L+HHQDAL+KAWP++HEAVVD   E  VK+NGEP  S
Sbjct  111  ----------VTNREGLFYVAYILKHHQDALVKAWPILHEAVVDLEEELLVKSNGEPVRS  160

Query  538  YYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            YYG K EMN LM KA+SGVSV FMK  L GY GF+ V RL+
Sbjct  161  YYGDKLEMNELMQKAISGVSVSFMKTILKGYDGFKRVERLL  201



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 106/151 (70%), Gaps = 21/151 (14%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N  LSAS+IL+ +L SGGGDA+NLQRIL   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            VTD +GLSY  YVLQHH DALM AWPLVHE V+D + E FVK +G PAYSYYGK PE+N 
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEVVLDPTIELFVKVHGVPAYSYYGKMPEINS  102

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            LM KAMSGVSVPFM + LDGY+GF+GV RLV
Sbjct  103  LMRKAMSGVSVPFMTSVLDGYNGFKGVKRLV  133



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 125/189 (66%), Gaps = 24/189 (13%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGDA
Sbjct  11   SQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGDA  70

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALM  453
            +NLQRILR+LT+Y +F E ++++  +R+YSL E                       D  +
Sbjct  71   ENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQYL  106

Query  454  KAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH  633
            +AWPLV EAV D + EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y 
Sbjct  107  RAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKYD  166

Query  634  GFEGVTRLV  660
            GF+GV  LV
Sbjct  167  GFKGVESLV  175



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 108/166 (65%), Gaps = 34/166 (20%)
 Frame = +1

Query  265  GDAQNLQRILRMLTSYGVFREHINADAS--------ERRYSLGEVGKTLVTDKDGLSYGA  420
            GDA+NLQR+LRML S+G F E   A ++        ERR+SL EV KTLVTD +GLSY A
Sbjct  20   GDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYAA  79

Query  421  YV--------------------------LQHHQDALMKAWPLVHEAVVDSSSEPFVKANG  522
            YV                           +   DALM+AWPLVHEAV+D ++EPFVKANG
Sbjct  80   YVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEAVLDPATEPFVKANG  139

Query  523  EPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            + AY++YGK PEMN LM +AMSGVSVPFMKA LDGY GF GV RLV
Sbjct  140  DTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSGVGRLV  185



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  358  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYS  537
            YSL E+GK+LVTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYS
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYS  61

Query  538  YYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            YYGK PEMNGLM KAMSGVSVPFM + L+GY+GF+GV RLV
Sbjct  62   YYGKIPEMNGLMRKAMSGVSVPFMTSVLEGYNGFKGVKRLV  102



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 126/199 (63%), Gaps = 6/199 (3%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E + +   +   +    +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI +
Sbjct  1    MEGVSNNGSNGASHTTWAMMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIAT  60

Query  244  SVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  423
             +    G  + NL+R+LR+LT++GVF E +   +  RR+SL  +G+ +V D+   S GA+
Sbjct  61   KLGSEAG--SSNLERMLRLLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAF  114

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVP  603
            +L    DAL+ AW L+HEAV++ SSEPF+KA+G+PAY Y+   P  N  M++AMS  S  
Sbjct  115  ILYRLDDALLDAWRLLHEAVLEPSSEPFIKAHGKPAYHYHADDPVFNERMMEAMSSSSGA  174

Query  604  FMKAFLDGYHGFEGVTRLV  660
             M  FL+ Y GFEGV R+V
Sbjct  175  VMDWFLERYDGFEGVRRVV  193



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 83/114 (73%), Gaps = 6/114 (5%)
 Frame = +1

Query  88   ESAQKNAR-LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG-  261
            E +Q N+  L IMEL N++SVPMSL AV++L V D I Q GSN PLS +EI  S LPS  
Sbjct  2    ERSQINSPILAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRL  59

Query  262  --GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                DA+NLQRILR+LTSYGVF EHI AD SERRYSL EVGK L  DK+GLSY 
Sbjct  60   ALARDAENLQRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 103/186 (55%), Gaps = 48/186 (26%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M +  + +   ARL +MELANMISVPM+L AV+RL                      S  
Sbjct  1    MAAGDDLSPAEARLAMMELANMISVPMALTAVIRLGF--------------------SPD  40

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G G                          S RR++L  VG+TLV    G SY  YVLQ
Sbjct  41   PAGSG--------------------------SLRRFALTAVGRTLVPGPSGASYADYVLQ  74

Query  433  HHQDALMKAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            HHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG+  E N +ML+AM+GVS PF
Sbjct  75   HHQDALVRAWPRLHEAVLDPAGPEPFARANAGVPAYAYYGQDREANEVMLRAMTGVSEPF  134

Query  607  MKAFLD  624
            M+A LD
Sbjct  135  MEALLD  140



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    Q N RL I+ELAN+I+VPMSLNA+V L VADAI QG SN PLSASEIL+ VL
Sbjct  1    MADEKTKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASER  354
            P+  GD  NLQ ILRMLTSY VF EHI  D+S++
Sbjct  61   PT--GDPDNLQCILRMLTSYDVFSEHIVDDSSKQ  92



>gb|KDO54338.1| hypothetical protein CISIN_1g032721mg [Citrus sinensis]
Length=135

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M AWPLVHEAV+D + EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSVPFM + LDGY
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGY  60

Query  631  HGFEGVTRLV  660
             GF+GV RLV
Sbjct  61   DGFKGVKRLV  70



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 109/191 (57%), Gaps = 6/191 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             MK W  ++++V  + ++PF  A+G+P +      P   G+   AMS  S  +M+  ++ 
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEA  183

Query  628  YHGFEGVTRLV  660
            Y GF+GV  LV
Sbjct  184  YDGFQGVRTLV  194



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 109/191 (57%), Gaps = 6/191 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             MK W  ++++V  + ++PF  A+G+P +      P   G+   AMS  S  +M+  ++ 
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEA  183

Query  628  YHGFEGVTRLV  660
            Y GF+GV  LV
Sbjct  184  YDGFQGVRTLV  194



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 108/191 (57%), Gaps = 6/191 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  10   QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  68

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD--KDGLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V  +    
Sbjct  69   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPLSSWVTLNQDVV  127

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             MK W  ++++V  + ++PF  A+G+P +      P   G+   AMS  S  +M+  ++ 
Sbjct  128  FMKTWEFLYQSVT-TGADPFTAAHGKPVFDLTANNPRFRGIFDSAMSDNSNAYMRLVVEA  186

Query  628  YHGFEGVTRLV  660
            Y GF+GV  LV
Sbjct  187  YDGFQGVRTLV  197



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 109/191 (57%), Gaps = 6/191 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
             MK W  ++++V  + ++PF  A+G+P +      P   G+   AMS  S  +M+  ++ 
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMRLIVEA  183

Query  628  YHGFEGVTRLV  660
            Y GF+GV  LV
Sbjct  184  YDGFQGVRTLV  194



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M AWPLVHEA++D + EPFVK +GEP YSYYGK PEMNGLM KAMSGVSVPFM + LDGY
Sbjct  1    MSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSILDGY  60

Query  631  HGFEGVTRLV  660
             GF+GV RLV
Sbjct  61   DGFKGVKRLV  70



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN--L  282
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S + P          L
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQI-PECSSPMSPIYL  72

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
             RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W
Sbjct  73   DRIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETW  130

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFE  642
              +HEAV+D   EPF KA G+  +    +   +N L   AMS  S  +M A L+ YHGF+
Sbjct  131  QYLHEAVLD-GGEPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFK  189

Query  643  GVTRLV  660
            G+  LV
Sbjct  190  GIGTLV  195



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 103/186 (55%), Gaps = 6/186 (3%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN--L  282
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S + P          L
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQI-PECSSPMSPIYL  72

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
             RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W
Sbjct  73   DRIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETW  130

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFE  642
              +HEAV+D   EPF KA G+  +    +   +N L   AMS  S  +M A L+ YHGF+
Sbjct  131  QYLHEAVLD-GGEPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFK  189

Query  643  GVTRLV  660
            G+  LV
Sbjct  190  GIGTLV  195



>ref|XP_010027213.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=128

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M+AWPLVHEA+++ +SEPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY
Sbjct  1    MRAWPLVHEAMLNPTSEPFVKANGDTAYAHYGKNPEMNELMQQAMSGVSVPFMKAILDGY  60

Query  631  HGFEGVTRLV  660
             GF  V RLV
Sbjct  61   DGFSEVRRLV  70



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M AWPLVHEAV+D + EPF K +GEPAYSYYGKKP+MNGLM KAMS V VPFM + LDGY
Sbjct  1    MSAWPLVHEAVLDPTIEPFAKVHGEPAYSYYGKKPKMNGLMRKAMSRVFVPFMTSVLDGY  60

Query  631  HGFEGVTRLV  660
             GF+GV RLV
Sbjct  61   DGFKGVKRLV  70



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 113/207 (55%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK FL+ Y GFEG+T LV
Sbjct  177  GMSNHSTIAMKKFLETYKGFEGLTSLV  203



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M AWPLVHEAV+D + EPFVK +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + LD Y
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDSY  60

Query  631  HGFEGVTRLV  660
            + F+GV +LV
Sbjct  61   NRFKGVKQLV  70



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKILETYKGFEGLTSLV  203



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKILETYKGFEGLTSLV  203



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKILETYKGFEGLTSLV  203



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 105/206 (51%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SES++ NA+       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSASESSEMNAKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRALASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    VL +    LM++W  + +AV+D  S+PF KA+G  A+ Y       N +  + 
Sbjct  121  GVSLAPLVLMNQDKVLMESWYYLKDAVLD-GSQPFTKAHGMNAFEYPAMDQRFNRVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   M   LD Y GF+ V  LV
Sbjct  180  MSEHSTLLMNKILDTYEGFKEVQELV  205



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 106/206 (51%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNMKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    VL +    LM+ W  + +AV++  S+PF KA+G  A+ Y       N L  ++
Sbjct  121  GVSLAPLVLMNQDKVLMETWYYLKDAVLE-GSQPFTKAHGMNAFEYTAMDQRFNRLFNRS  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S+  M   +D Y GF+ V +LV
Sbjct  180  MSEYSIMLMNKIMDSYQGFKEVLKLV  205



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 97/179 (54%), Gaps = 8/179 (4%)
 Frame = +1

Query  142  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGV  318
            +VPM+L A + L+V + I +GG  A LSA EI +  LP+   DA   L R+LR+L SY V
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  319  FREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAV  483
                I        + ERRY L  V K L+ ++DG+S    VL +     M++W  + EAV
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEAV  123

Query  484  VDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            +D    PF KA+G  A+ Y+   P  N +  + MS  S   MK  L+ Y GF+G+  LV
Sbjct  124  LDGGI-PFNKAHGMSAFEYHSTDPRFNKIFNRTMSDHSTLVMKKILETYKGFDGLKELV  181



>prf||1906376A O-methyltransferase
Length=364

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 108/203 (53%), Gaps = 8/203 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS 
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y GFEG+T LV
Sbjct  183  HSTITMKKILETYKGFEGLTSLV  205



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 108/203 (53%), Gaps = 8/203 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS 
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y GFEG+T LV
Sbjct  183  HSTITMKKILETYKGFEGLTSLV  205



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 108/203 (53%), Gaps = 8/203 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS 
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y GFEG+T LV
Sbjct  183  HSTITMKKILETYKGFEGLTSLV  205



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 96/183 (52%), Gaps = 4/183 (2%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RILR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    + R Y L  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT  651
             +AV+D  S+PF KA+G  A+ Y  K P  N +  +AM+  S   M+  LD Y GF+ V 
Sbjct  140  KDAVLD-GSQPFTKAHGVNAFEYPAKDPRFNNVFNRAMAEHSTMLMQKILDTYPGFKDVQ  198

Query  652  RLV  660
             +V
Sbjct  199  EIV  201



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 110/207 (53%), Gaps = 12/207 (6%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K +I+    E E A   A    M+LA+   VPM L A + L+V + I + G+ A +S SE
Sbjct  5    KTQIKIADQEEEEACNYA----MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSE  60

Query  235  ILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            I +S LP+   DA   L R+LR+L S+ +     R H +    ER Y L  V K LV ++
Sbjct  61   I-ASHLPTQNPDAPVMLDRMLRLLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S    VL +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  +
Sbjct  119  DGVSMAPLVLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNR  177

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  +V
Sbjct  178  GMSDHSTITMKKILETYKGFEGLNSVV  204



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 106/206 (51%), Gaps = 13/206 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDKD  402
            EI S +     G    L RILR+LTS+ V       ++ D  ER Y LG V K L  ++D
Sbjct  59   EIASHLPTKNPGAPVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNED  118

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S     L      LM++W  + +A++D    PF KA G  A+ Y+G  P  N +    
Sbjct  119  GVSIAGLCLTSQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNG  177

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   MK  L+ Y GFEG+T LV
Sbjct  178  MSNHSTITMKKILETYKGFEGLTSLV  203



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 112/212 (53%), Gaps = 18/212 (8%)
 Frame = +1

Query  73   MGSESESA------------QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  216
            MGSESE+             ++ A L  M+LA+   +PM L + + L++ + + + G  A
Sbjct  1    MGSESENQTSSTSTPVGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGA  60

Query  217  PLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKT  384
             +S +E L++ LP+   DA   L RILR+LTSY V    + +      ER Y+L  V K 
Sbjct  61   FVSPTE-LAAQLPTQNPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKY  119

Query  385  LVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMN  564
            L  + DG+S    +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N
Sbjct  120  LTRNSDGVSMAPLLLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFN  178

Query  565  GLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             +  + MS  S   MK  L+ Y GFEG+T LV
Sbjct  179  KVFNQGMSNHSTITMKKILEIYQGFEGLTSLV  210



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    VL +    LM +W  + +AV++  S+PF KA+G  A+ Y  K    N +  + 
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLE-GSQPFTKAHGMNAFEYPAKDQRFNRVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   M   LD Y GF+ V  LV
Sbjct  180  MSEHSTMLMNKILDTYQGFKEVQELV  205



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKVVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVMNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    VL +    LM +W  + +AV++  S+PF KA+G  A+ Y  K    N +  + 
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLE-GSQPFTKAHGMNAFEYPAKDQRFNRVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   M   LD Y GF+ V  LV
Sbjct  180  MSEHSTMLMNKILDTYQGFKEVQELV  205



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKLLETYKGFEGLTSLV  205



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY  630
            M+AWPLVH AVV+  +EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY
Sbjct  1    MRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGY  60

Query  631  HGFEGVTRLV  660
             GF+ V  LV
Sbjct  61   DGFKYVEHLV  70



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 111/208 (53%), Gaps = 16/208 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  396
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +  
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFN  176

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  NGMSNHSTITMKKILETYKGFEGLTSLV  204



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 111/208 (53%), Gaps = 16/208 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  396
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +  
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFN  176

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  NGMSNHSTITMKKILETYKGFEGLTSLV  204



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 4/205 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ +  M  E ++A + A +  ++LA+   +PM+L   + L+V + I + GS A LS +E
Sbjct  6    KQGVPTMSLEKQAADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAE  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY V    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTKNPMAAAMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M
Sbjct  126  VSMAALTLMNQDKILMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGM  184

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
               S+   K  L+ Y GFE V  LV
Sbjct  185  KNHSIIITKKLLEFYKGFEDVNVLV  209



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 95/175 (54%), Gaps = 6/175 (3%)
 Frame = +1

Query  148  PMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFR  324
            PM L AV+ L+V + I + G NA LS +EI++  LPS   DA   L R+LR+L SY +  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  325  EHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSS  495
              +        ER Y L  V + L  ++DG++ GA  L +    LM++W  + +AV+D  
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  148

Query  496  SEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              PF KA G  A+ Y+G  P  N +    MS  S   MK  LD Y GFEG++ LV
Sbjct  149  I-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHSTITMKRILDTYKGFEGLSTLV  202



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 111/208 (53%), Gaps = 10/208 (5%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + S  + + A L  M+LA+   +PM L + + L++ + I +GG    LS 
Sbjct  4    TGETQI----TPSHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  396
            S+I +S LP+   +A   L RILR+L SY +  F      D   ER Y L  V K LV +
Sbjct  60   SQI-ASQLPTRNPEAPVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFN  177

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            K M+  S   MK  L+ Y GFEG+  LV
Sbjct  178  KGMADHSTITMKKILETYTGFEGLKSLV  205



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 109/215 (51%), Gaps = 6/215 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKP  555
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDP  192

Query  556  EMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              N +  + MS  S   MK  LD Y GF+G+  LV
Sbjct  193  RFNKVFNRGMSDHSTITMKKILDTYDGFQGLKTLV  227



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 109/209 (52%), Gaps = 17/209 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L   + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA-----DASERRYSLGEVGKTLVT  393
            EI +S LP+   +A   L RILR+LT+Y V            DA ER Y LG V K L  
Sbjct  59   EI-ASHLPTKNLEAPVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTK  117

Query  394  DKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLM  573
            ++DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G  P  N + 
Sbjct  118  NEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVF  176

Query  574  LKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
               MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  NNGMSNHSTITMKKILETYKGFEGLTSLV  205



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 10/208 (5%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G+ A LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSP  59

Query  229  SEILSSVLPSGGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTD  396
            +EI +S LP+   DA   L R+LR+L  Y +    +  +     +R Y L  V K LV +
Sbjct  60   AEI-ASQLPTTNPDAPTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  
Sbjct  119  EDGVSISALNLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFN  177

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            K MS  S   MK  L+ Y GFEG+  LV
Sbjct  178  KGMSDHSTITMKKILETYTGFEGLKSLV  205



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 116/219 (53%), Gaps = 11/219 (5%)
 Frame = +1

Query  31   RIEKQITGKKEIEAMGSESES-AQKNARLTI----MELANMISVPMSLNAVVRLNVADAI  195
            +I  Q  GK +    G+E E+ +Q++    +    + LAN + +PM L + + LN+ D I
Sbjct  2    QIRSQNFGKVKQPETGAEKETMSQEDQEEEVGKLAVRLANAVVLPMVLKSALELNIIDTI  61

Query  196  WQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYS  363
               G  A LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A   +  ER Y 
Sbjct  62   LAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYG  120

Query  364  LGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
             G + K LV ++DG S    +L HH    M++W  +++A+++    PF KA G  A+ Y 
Sbjct  121  AGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYP  179

Query  544  GKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            G     N +  +AMS  +   M+  +D Y GF+G+  LV
Sbjct  180  GTDQRFNRVFNQAMSNHTALIMREIVDVYKGFDGLKVLV  218



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 109/202 (54%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA+G  ++ Y+GK    N +  K MS  
Sbjct  125  AALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSVV  205



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A+++    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +A+++    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG++ 
Sbjct  65   KLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  LD Y GF+G+  LV
Sbjct  184  STITMKKILDTYDGFQGLKTLV  205



>gb|AHA44835.1| caffeate O-methyltransferase [Larix kaempferi]
Length=364

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 105/206 (51%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+++ N +       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSAAENSEMNTKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTALCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    VL +    LM+ W  + +AV++  ++PF+KA+G  A+ Y       N +  + 
Sbjct  121  GVSLAPLVLMNQDKVLMECWYYLKDAVLE-GAQPFIKAHGMNAFEYPAMDQRYNRVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   M   LD Y GF+ V  LV
Sbjct  180  MSEHSTMLMNKILDTYQGFKEVQELV  205



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
            LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ 
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLLEL  193

Query  628  YHGFEGVTRLV  660
            Y GFEG+  +V
Sbjct  194  YKGFEGLKSVV  204



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 109/202 (54%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS SE+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA+G  ++ Y+GK    N +  K MS  
Sbjct  125  AALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSVV  205



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 107/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G +A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y L  V K L+ ++DG+S 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +AV+     PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  APLCLMNQDKVLMESWYYLKDAVL-LGGIPFNKAYGMTAFDYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSVV  205



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MREIVDVYKGFDGLKVLV  196



>emb|CDY43839.1| BnaC03g14720D [Brassica napus]
Length=364

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+GK    N +   
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNN  177

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  178  GMSNHSTITMKKILETYKGFEGLTSLV  204



>gb|ABK21417.1| unknown [Picea sitchensis]
Length=365

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 94/183 (51%), Gaps = 4/183 (2%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  25   MELGNFSCLPMAMKAAVELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  84

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K LV ++DG+S    VL +     M+ W  +
Sbjct  85   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLINQDKVFMETWYYL  144

Query  472  HEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT  651
             +AV++  S+PF KA+G  A+ Y       N L  ++MSG S   M   +D Y GF+ V 
Sbjct  145  KDAVLE-GSQPFTKAHGMNAFEYTAMDQRFNRLFNRSMSGHSTMLMNKIMDSYQGFKEVQ  203

Query  652  RLV  660
             LV
Sbjct  204  ELV  206



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MRKIVDVYKGFDGLKVLV  196



>ref|XP_009132451.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Brassica rapa]
 emb|CDY43052.1| BnaA03g11990D [Brassica napus]
Length=364

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +   
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNN  177

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  178  GMSNHSTITMKKILETYKGFEGLTSLV  204



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 111/211 (53%), Gaps = 8/211 (4%)
 Frame = +1

Query  40   KQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAP  219
            KQ     E E M S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A 
Sbjct  36   KQPETGAEKETM-SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAF  93

Query  220  LSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTL  387
            LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A      ER Y  G + K L
Sbjct  94   LSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFL  152

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNG  567
            V ++DG S    +L HH    M++W  +++A+++    PF KA G  A+ Y G     N 
Sbjct  153  VKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNR  211

Query  568  LMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            +  +AMS  +   M+  +D Y GF+G+  LV
Sbjct  212  VFNQAMSNHTALIMRKIVDVYKGFDGLKVLV  242



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 108/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L   +DG S 
Sbjct  65   QLPTKNPDAPVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
            G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  GSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y+GFEG+T +V
Sbjct  184  STITMKKLLENYNGFEGLTSIV  205



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 107/198 (54%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MRKIVDVYKGFDGLKVLV  196



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 106/192 (55%), Gaps = 6/192 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L+ M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA 
Sbjct  16   EEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNPDAP  74

Query  277  -NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V     + +     ER YSL  V K L  ++DG+S  A +L +   
Sbjct  75   VMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDK  134

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
             LM++W  + +AV++    PF KA G  A+ Y+GK P  N +  + MS  S   MK  L+
Sbjct  135  VLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTIIMKKILE  193

Query  625  GYHGFEGVTRLV  660
             Y GF+G+  +V
Sbjct  194  IYQGFQGLKTVV  205



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + I + G  A LS  +I +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-AS  64

Query  247  VLPSGGGDAQN-LQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    +        E+ Y L  V K L  ++DG+S 
Sbjct  65   QLPTKNPDAPVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + EAV++    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  APLCLMNQDKVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>ref|XP_002971011.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
 gb|EFJ27609.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
Length=385

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 101/187 (54%), Gaps = 12/187 (6%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  276
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  277  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  445  ALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
             LM+ W  + +AV+    + PF  A+ GE  +    +   ++ L   AM   S+ F+ A 
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHGGEHFFQLASRSDRLDRLFTSAMCDHSMIFLPAI  196

Query  619  LDGYHGF  639
            LD Y GF
Sbjct  197  LDEYRGF  203



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 109/210 (52%), Gaps = 13/210 (6%)
 Frame = +1

Query  64   IEAMGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPL  222
            I+ MGS  E+       + + A L  M+LA+   +PM L A + L++ + + + G  A +
Sbjct  66   IQKMGSTPETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFV  125

Query  223  SASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLV  390
            S ++ LSS LP+   DA   L R+LR L SY +    +        ER Y LG V K L 
Sbjct  126  SPAD-LSSQLPTKNPDAPVMLDRMLRXLASYSILTYSLRTLPDGKVERLYGLGPVCKFLT  184

Query  391  TDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGL  570
               DG S G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +
Sbjct  185  KXXDGASIGSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKV  243

Query  571  MLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              K M+  S   MK  L+ Y+GFEG+T +V
Sbjct  244  FNKGMADHSTITMKKLLENYNGFEGLTSIV  273



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + I + G  A LS  +I +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-AS  64

Query  247  VLPSGGGDAQN-LQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    +        E+ Y L  V K L  ++DG+S 
Sbjct  65   QLPTKDPDAPVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + EAV++    PF KA G  A+ Y+G  P  N +  K MS  
Sbjct  125  APLCLMNQDKVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T LV
Sbjct  184  STITMKKILETYKGFEGLTSLV  205



>ref|XP_002962074.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
 gb|EFJ37334.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
Length=385

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 101/187 (54%), Gaps = 12/187 (6%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  276
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  277  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  445  ALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAF  618
             LM+ W  + +AV+    + PF  A+ GE  +    +   ++ L   AM   S+ F+ A 
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHGGEHFFQLASRSNRLDRLFTSAMCDHSMIFLPAI  196

Query  619  LDGYHGF  639
            LD Y GF
Sbjct  197  LDEYRGF  203



>ref|XP_010103059.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB94708.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=264

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 104/200 (52%), Gaps = 4/200 (2%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS S+++S 
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKTALDLDLLEIMAKAGPGAYLSPSDVVSQ  65

Query  247  VLPSGGGDAQNLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYG  417
            +     G    L R+LR+L SY +      ++     ER Y LG V K L  ++DG+S G
Sbjct  66   LPTKNPGAPVMLDRVLRLLASYSILTYSLRNLPDGKVERLYGLGPVCKYLTKNEDGVSIG  125

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
            +  L +    LM++W  + + +++    PF KA+G  ++ Y+G  P  N +  K M   S
Sbjct  126  SLCLMNQDKVLMESWYHLKDTILEGGI-PFNKAHGMTSFDYHGTDPRFNKIFNKGMFDHS  184

Query  598  VPFMKAFLDGYHGFEGVTRL  657
               MK  L+ Y GFEG+T L
Sbjct  185  TITMKKILETYKGFEGLTSL  204



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 109/202 (54%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++I +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPADI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    +        +R Y LG V K L  ++DG S 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYSILTYSLRTLPDGKVQRLYGLGPVCKFLTKNEDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
            G+  L +    LM++W  + E+V++    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  GSLCLMNQDKVLMESWYHLKESVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y+GFEG+T +V
Sbjct  184  STITMKKLLEIYNGFEGLTSIV  205



>dbj|BAO79380.1| 5-hydroxyconiferylaldehyde O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 103/192 (54%), Gaps = 6/192 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A +  M+LA+   +PM L + + LN+ +AI + G  A +S SE L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLEAIAKAGPGAYVSPSE-LAAGLPSSQPDTP  76

Query  277  -NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V +  +        ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLKCQLRDLPHGRVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
             LM++W  + +AV+D    PF KA G  A+ Y+GK P  N +  + MS  S   MK  L+
Sbjct  137  ILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKKILE  195

Query  625  GYHGFEGVTRLV  660
             Y+GF G+  LV
Sbjct  196  TYNGFGGLETLV  207



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 106/198 (54%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MRKIVDVYKGFDGLKVLV  196



>dbj|BAE94400.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
 dbj|BAE94406.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 102/193 (53%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            + + A L  M+LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA
Sbjct  16   SDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPDA  74

Query  274  Q-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +        ER YSL  V K L  + DG+S    +L +  
Sbjct  75   AVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQD  134

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S   MK  L
Sbjct  135  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  193

Query  622  DGYHGFEGVTRLV  660
            D Y GFEG+  LV
Sbjct  194  DDYKGFEGLKSLV  206



>dbj|BAE94403.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 102/193 (53%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            + + A L  M+LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA
Sbjct  16   SDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPDA  74

Query  274  Q-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +        ER YSL  V K L  + DG+S    +L +  
Sbjct  75   AVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQD  134

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S   MK  L
Sbjct  135  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  193

Query  622  DGYHGFEGVTRLV  660
            D Y GFEG+  LV
Sbjct  194  DDYKGFEGLKSLV  206



>ref|XP_009352092.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=269

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 110/202 (54%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA++  +PM L A + L++ + + + G    +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEASLFAMQLASVSVLPMVLKAAIELDLLEIMAKAGPGVFVSPAD-LSS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L R+LR+L SY +       +     ER Y LG V K L T++DG+S 
Sbjct  65   QLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLQDGKVERLYGLGPVCKFLTTNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             +  L +     +++W  + +AV++    PF KA G  A+ Y+G  P  N +  +AM+ +
Sbjct  125  ASLCLMNLDKVPVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRAMADI  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSVV  205



>ref|XP_001762717.1| predicted protein [Physcomitrella patens]
 gb|EDQ72516.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 103/188 (55%), Gaps = 4/188 (2%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQR  288
            RL  +EL    ++P +L ++ RLNV +A+ + G    L+  E+ +  +P    +   L R
Sbjct  30   RLAAIELVGQAAIPGTLASLARLNVFEALARAGDGVELTPQELGNQAMPGKVINLSYLGR  89

Query  289  ILRMLTSYGVFRE--HINADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKA  459
            +LR+ +S  V RE   ++ D S E RY L  +GK LV D +  S    +L +     +  
Sbjct  90   MLRLASSVKVLREVATMSEDGSTEHRYGLEPIGKFLVDDAEKGSLVHLLLMYQDPVFLST  149

Query  460  WPLVHEAVVDSSSEPFVKANGE-PAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            W  + E+V+D S +PF +A+G   A+ Y  + PE +    KAM+G S  +M+AFLD Y G
Sbjct  150  WNHLPESVLDDSVQPFARAHGGLHAWEYGMQNPEFDEKFNKAMAGHSKLYMRAFLDVYQG  209

Query  637  FEGVTRLV  660
            FEGV  L+
Sbjct  210  FEGVRVLI  217



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 108/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A LS ++ L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTKNPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  AALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSIV  205



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 108/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A LS ++ L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTKNPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  AALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+T +V
Sbjct  184  STITMKKILETYKGFEGLTSIV  205



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 107/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  399
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S     L      LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  +
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNR  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+T +V
Sbjct  179  GMAAQSTIIMKKLLETYKGFEGLTSVV  205



>gb|AAC18863.1| caffeic acid 3-O-methyltransferase [Mesembryanthemum crystallinum]
Length=350

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 95/175 (54%), Gaps = 6/175 (3%)
 Frame = +1

Query  148  PMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFR  324
            PM L AV+ L+V + I + G  A LS +EI ++ LP+   DA   L R+LR+L SY +  
Sbjct  18   PMVLKAVIELDVLEIIKRAGPGAQLSPAEI-ANQLPTKNPDAATMLDRMLRLLASYSILS  76

Query  325  EHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSS  495
              +   +    ER Y L  V + L  ++DG++ GA  L +    LM++W  + +AV+D  
Sbjct  77   YSLRTLSDGRVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  136

Query  496  SEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              PF KA G  A+ Y+G  P  N +    MS  S   MK  LD Y GFEG++ LV
Sbjct  137  I-PFNKAYGMSAFEYHGTDPRFNKVFNSGMSNHSTITMKKILDDYQGFEGLSTLV  190



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 109/203 (54%), Gaps = 6/203 (3%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E   +  + + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ L+
Sbjct  5    VETQMTPIQVSDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LA  63

Query  244  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLS  411
            S LP+   DA   L R+LR+L SY +    +        ER Y LG V K L  ++DG S
Sbjct  64   SQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGAS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
             G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+ 
Sbjct  124  IGSLCLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMAD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y+GFEG+T +V
Sbjct  183  HSTITMKKLLEIYNGFEGLTSIV  205



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 107/198 (54%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            + HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  VLHHDQVFMQSWYHLNDAILEGGF-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MREIVDVYKGFDGLKVLV  196



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 107/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L    DG S 
Sbjct  65   QLPTKNPDAPVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSVDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
            G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  GSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNRVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y+GFEG+T +V
Sbjct  184  STITMKKLLENYNGFEGLTSIV  205



>gb|KJB52493.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
 gb|KJB52494.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=275

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 108/215 (50%), Gaps = 6/215 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKP  555
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G   
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDT  192

Query  556  EMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              N +  K MS  S   MK  LD Y GF+G+  LV
Sbjct  193  RFNKVFNKGMSDHSTITMKKILDTYDGFQGLKTLV  227



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   DA   L R+LR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPDAPVMLDRMLRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMSDHSTITMKKILETYTGFEGLKSLV  205



>gb|AAD29842.1|AF064694_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELSVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
            LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ 
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLEL  193

Query  628  YHGFEGVTRLV  660
            Y GFEG+  +V
Sbjct  194  YKGFEGLKSVV  204



>gb|AAD29843.1|AF064695_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 100/191 (52%), Gaps = 4/191 (2%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L R+LR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRVLRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG  627
            LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ 
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLEL  193

Query  628  YHGFEGVTRLV  660
            Y GFEG+  +V
Sbjct  194  YKGFEGLKSVV  204



>ref|XP_010442991.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASQLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKLLETYKGFEGLTSLV  203



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 105/198 (53%), Gaps = 7/198 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G    LS S+I +S LPS
Sbjct  2    SQEDQDEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTTLI  178

Query  607  MKAFLDGYHGFEGVTRLV  660
            M+  +D Y GF+G+  LV
Sbjct  179  MRKIVDVYKGFDGLKVLV  196



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPEAPVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMSDHSTITMKKILETYTGFEGLKSLV  205



>gb|AEQ59236.1| putative S-adenosyl-L-methionine:flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=296

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 93/183 (51%), Gaps = 4/183 (2%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT  651
             +AV+D  S+ F KA+G  A+ Y  K P  N ++ +AM+  S   M+  LD Y GF  V 
Sbjct  140  KDAVLD-GSQSFTKAHGVNAFEYPAKDPRFNDVINRAMAEHSTMLMQKILDTYPGFNDVQ  198

Query  652  RLV  660
             +V
Sbjct  199  EIV  201



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 13/206 (6%)
 Frame = +1

Query  73   MGSESESA-----QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS SE+      ++ A L  M+LA+   +PM L + + L++ + + + G  A +S SE+
Sbjct  1    MGSTSETQTIHTDEEEACLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAYVSPSEV  60

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDKD  402
             ++ LP+   DA   L RILR+LTSY V     R+  N    ER Y L  V K L  + D
Sbjct  61   -AAQLPTKNPDAAVMLDRILRLLTSYSVLNCTLRDLPNG-GVERLYGLAPVCKFLTRNAD  118

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    +L +    LM++W  + + V++    PF KA G  A+ Y+G  P  N +  + 
Sbjct  119  GVSMAPLLLMNQDKVLMESWYYLKDTVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQG  177

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   MK  LD Y GF+G+T +V
Sbjct  178  MSNHSTITMKKILDIYGGFDGLTTVV  203



>gb|AET34455.1| putative S-adenosyl-L-methionine: flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=270

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 93/183 (51%), Gaps = 4/183 (2%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT  651
             +AV+D  S+ F KA+G  A+ Y  K P  N ++ +AM+  S   M+  LD Y GF  V 
Sbjct  140  KDAVLD-GSQSFTKAHGVNAFEYPAKDPRFNDVINRAMAEHSTMLMQKILDTYPGFNDVQ  198

Query  652  RLV  660
             +V
Sbjct  199  EIV  201



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 98/188 (52%), Gaps = 4/188 (2%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  286  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            +W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y G
Sbjct  140  SWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLELYKG  198

Query  637  FEGVTRLV  660
            FEG+  +V
Sbjct  199  FEGLKSVV  206



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPEAPVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMSDHSTITMKKILETYTGFEGLKSLV  205



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 107/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  399
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S     L      LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  +
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLEGGI-PFNKAYGMSAFEYHGTDPRFNKVFNR  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+T +V
Sbjct  179  GMAAQSTITMKKLLETYKGFEGLTSVV  205



>ref|XP_011084580.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=367

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 105/206 (51%), Gaps = 6/206 (3%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K +I       +S ++ A L  MELA+  ++PM L + + L++ + I + G  A +S S+
Sbjct  6    KTQIPTASMADQSEEEEAFLYAMELASASALPMVLKSAIELDLLELIKKAGPGASVSPSQ  65

Query  235  ILSSVLPSGGGDAQN-LQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKD  402
             L++ LP+   DA   + R+LR+L +Y V R  +        ER YSL  V K L  ++D
Sbjct  66   -LAAQLPTKNPDAATMIDRMLRLLAAYSVVRCSLKPLPDGGVERLYSLAPVCKFLTRNED  124

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S     L       M++W  + + V++    PF +A G  A+ Y    P  N +  +A
Sbjct  125  GVSVAPVALMLQDKVFMESWYHIKDTVLEGGI-PFNRAYGMSAFEYPATDPRFNKVFNRA  183

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            M   S  FMK  L+ Y GFEGV  LV
Sbjct  184  MYEQSTIFMKQILEKYKGFEGVKSLV  209



>ref|XP_010482824.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Camelina sativa]
Length=363

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 112/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY +       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASQLPTKNPEAPVMLDRILRLLTSYSILTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKLLETYKGFEGLTSLV  203



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 109/206 (53%), Gaps = 14/206 (7%)
 Frame = +1

Query  73   MGSESESAQKNARLT-------IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+     ++T        ++LA+   +PM+L + + L++ + + +  S  P+SAS
Sbjct  1    MGSTAETHSTPVQVTDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSAS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKD  402
            EI SS LP+   +A   L RILR+LT+Y V    +    D  +R Y LG V K  + ++D
Sbjct  59   EI-SSHLPTKNPEAPVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNED  117

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S     L +H    M +W  + +AV+D    PF KA G  A+ Y+G     N +    
Sbjct  118  GVSIAPLCLLNHDKVFMGSWYYLKDAVLDGGI-PFNKAYGMSAFEYHGTDLRFNKVFNNG  176

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   MK  L+ Y+GFEG+  LV
Sbjct  177  MSNHSTITMKKILETYNGFEGLVSLV  202



>ref|XP_010446534.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 111/207 (54%), Gaps = 15/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTGETQITPVQVTDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASQLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +   
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNN  176

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  177  GMSNHSTITMKKLLETYKGFEGLTSLV  203



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 98/188 (52%), Gaps = 4/188 (2%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  286  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG  636
            +W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y G
Sbjct  140  SWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLLELYKG  198

Query  637  FEGVTRLV  660
            FEG+  +V
Sbjct  199  FEGLKSVV  206



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTNNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Ocimum basilicum]
 gb|AAD38189.1|AF154917_1 caffeic acid O-methyltransferase [Ocimum basilicum]
Length=361

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 107/205 (52%), Gaps = 11/205 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  405
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDG  119

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S     L +    LM++W  + +AVVD    PF KA G  A+ Y+G  P  N +  + M
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLSDAVVDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGM  178

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
            S  S   MK  L+ Y GF+G+  +V
Sbjct  179  SNHSTITMKKILETYTGFDGLKTVV  203



>gb|KDP35860.1| hypothetical protein JCGZ_10599 [Jatropha curcas]
Length=365

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 106/201 (53%), Gaps = 6/201 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            EA  + +  + + A L  M+L++   +PM L + + L++ + I + G  A LS  +I +S
Sbjct  6    EAQMTPTRVSDEEAILFAMQLSSAPLLPMVLKSAIELDLLEIIAKAGPGAFLSTYDI-AS  64

Query  247  VLPSGGGDAQN-LQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +       +N    ER Y L  V K L  ++DG+S 
Sbjct  65   QLPTKSADAPVVLDRILRLLASYSILTCSLRKLNDGKVERLYGLAPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
                L +    LM++W  + +AV++    PF KA+G  A+ Y G  P  + +  K MS  
Sbjct  125  APLCLLNLDKVLMESWYHLKDAVLEGVI-PFNKAHGMDAFEYQGTDPRFSKVFNKGMSNH  183

Query  595  SVPFMKAFLDGYHGFEGVTRL  657
            S+  MK  L+ Y GFEG+T L
Sbjct  184  SIVTMKKILETYKGFEGLTSL  204



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A LS +
Sbjct  1    MGSAGETQITPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAHLSPN  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L R+LR+L  Y +F      +     +R Y L  V K L+ ++
Sbjct  61   DI-ASQLPTNNPDAPIMLDRMLRLLACYNIFTCSLRTLQDGKVQRLYGLAPVAKYLIKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSLSALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMSDHSTITMKKILELYTGFEGLKSLV  205



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = +1

Query  73   MGSESES------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            MGS S +      + + A L  M+L +   +PM L + + L++ + I + G  A +S SE
Sbjct  1    MGSTSMTPTTILESDEEASLFSMQLVSASVLPMVLKSALELDLLEIIAKAGPGAFVSTSE  60

Query  235  ILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKD  402
            I + + P+   +A   L RILR+L +Y V +    ++     ER Y L  V K L  ++D
Sbjct  61   IAAQI-PTHNPEAPVMLDRILRLLATYAVVKCSLRNLPDGGVERLYGLAPVCKYLTRNED  119

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +    
Sbjct  120  GVSVAPLLLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNG  178

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MSG S   MK  L+ Y GFEG+T +V
Sbjct  179  MSGHSTITMKKILEAYKGFEGLTSIV  204



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 108/203 (53%), Gaps = 6/203 (3%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G    LS ++I +
Sbjct  5    VETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPADI-A  63

Query  244  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLS  411
            S LP+   DA   L R+LR+L SY +    +   A    ER Y LG V K L  ++DG+S
Sbjct  64   SQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
                 L +    L+++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+ 
Sbjct  124  IAPLCLMNQDKVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMAD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y GFEG+T +V
Sbjct  183  HSTITMKKILETYKGFEGLTSVV  205



>gb|ABK23795.1| unknown [Picea sitchensis]
Length=365

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 4/186 (2%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIQTTNPDAAISLNRI  81

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  82   LKVLASHSVLSCSVTMDENGKAECLYGLTSLCKYLVKNRDGISLAPWVLMNQDKVFMESW  141

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFE  642
              + +AV++  S+PF KA+G   + Y       N ++ + MS  S   M   LD Y GF+
Sbjct  142  HYLKDAVLE-GSQPFTKAHGMNVFEYLAMDRRFNKVLNRTMSEHSTTLMCKILDMYQGFK  200

Query  643  GVTRLV  660
             V +LV
Sbjct  201  YVQKLV  206



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 108/215 (50%), Gaps = 6/215 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKP  555
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G   
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDT  192

Query  556  EMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
              N +  K MS  S   MK  LD Y GF+G+  LV
Sbjct  193  RFNKVFNKGMSDHSTITMKKILDTYDGFQGLKTLV  227



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 103/197 (52%), Gaps = 5/197 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I S++   
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQIASALPSK  60

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVL  429
              G    L R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +L
Sbjct  61   NPGAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLL  120

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFM  609
             HH    M++W  +++A+++    PF KA G  A+ Y G     N +  +AMS  +   M
Sbjct  121  LHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIM  179

Query  610  KAFLDGYHGFEGVTRLV  660
            +  +D Y GF+G+  LV
Sbjct  180  RKIVDVYKGFDGLKVLV  196



>gb|ABK25932.1| unknown [Picea sitchensis]
Length=353

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 4/186 (2%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  10   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIPTTNPDAAISLDRI  69

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  70   LKVLASHSVLSCSVTMDENGKAEGLYGLTPLCKYLVKNRDGISLAPWVLMNQDKVFMESW  129

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFE  642
              + +AV++  S+PF KA+G   + Y       N ++ + MS  S   M   LD Y GF+
Sbjct  130  HYLKDAVLE-GSQPFTKAHGMNVFEYLAMDRRFNKVLNRTMSEHSTTLMNKILDMYQGFK  188

Query  643  GVTRLV  660
             V +LV
Sbjct  189  DVQKLV  194



>ref|XP_006441263.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
 gb|ESR54503.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
Length=235

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 106/207 (51%), Gaps = 6/207 (3%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHIVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG++     L +    LM++W  + +AV++    PF KA+G  A+ Y+GK    N +   
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMNAFDYHGKDLRFNKIFNN  179

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  +V
Sbjct  180  GMSSHSTITMKKILENYKGFEGLNSVV  206



>gb|KJB23955.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=269

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 106/207 (51%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   DA   L R+LR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPDAPVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMSDHSTITMKKILETYTGFEGLKSLV  205



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 103/205 (50%), Gaps = 11/205 (5%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L+V + I + G    LS +
Sbjct  1    MGSTGETQITPTVVSDEEANLFAMQLASASVLPMVLKSAIELDVLEIIAKAGPGVHLSPA  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKD  402
            +I ++V  +    A  L R+LR+L  Y +    +        ER Y L  V K LV ++D
Sbjct  61   DIAANVPTTNPDAAVMLDRMLRLLACYNILNHSLRTLPDGKVERLYGLAPVAKFLVKNED  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S  A  L +H   LM++W  + E V++    PF KA G  A+ Y+G  P  N +  K 
Sbjct  121  GVSLSALNLMNHDKVLMESWYYLKETVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRL  657
            M+  +   MK  L+ Y GFEG+  L
Sbjct  180  MNDHTTITMKKILEIYTGFEGLKSL  204



>gb|KJB23957.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=290

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
            S ++ + L  M+LA+   +PM L + + L++ + I + G+ A +S +E+ + +  +  G 
Sbjct  15   SDEEESFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAEVAAQLPTTNEGA  74

Query  271  AQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
            A  L RILR+L SY +    +        +R Y L  V K L  + DG+S     L +  
Sbjct  75   AVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDGVSVAPLALMNQD  134

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MSG S   MK  L
Sbjct  135  KVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKIL  193

Query  622  DGYHGFEGVTRLV  660
            + Y GF+G+  +V
Sbjct  194  ETYKGFDGLNSVV  206



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 108/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L A + L++ + + + G  + LS S
Sbjct  1    MGSTGETQMTPTHVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  399
            + L+S LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++
Sbjct  61   D-LASQLPTKNPEAPVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSIAALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+  +V
Sbjct  179  GMADHSTITMKKILETYKGFEGLKSIV  205



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
            S ++ + L  M+LA+   +PM L + + L++ + I + G+ A +S +E+ + +  +  G 
Sbjct  15   SDEEESFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAEVAAQLPTTNEGA  74

Query  271  AQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
            A  L RILR+L SY +    +        +R Y L  V K L  + DG+S     L +  
Sbjct  75   AVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDGVSVAPLALMNQD  134

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MSG S   MK  L
Sbjct  135  KVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKIL  193

Query  622  DGYHGFEGVTRLV  660
            + Y GF+G+  +V
Sbjct  194  ETYKGFDGLNSVV  206



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 107/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+       + + A L  M+LA+   +PM L + + L++ + I + G    LS +
Sbjct  1    MGSAAETQITPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPT  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTDK  399
            +I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV  +
Sbjct  61   DI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K
Sbjct  120  DGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMADHSTITMKKILETYTGFEGLKSLV  205



>sp|Q8LL87.1|COMT1_COFCA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Coffea canephora]
 gb|AAN03727.1| caffeic acid O-methyltransferase [Coffea canephora]
 emb|CDP04982.1| unnamed protein product [Coffea canephora]
Length=350

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 104/193 (54%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  274  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S   MK  L
Sbjct  121  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKIL  179

Query  622  DGYHGFEGVTRLV  660
            + Y GFEG+  +V
Sbjct  180  EVYRGFEGLKTVV  192



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 107/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ ++
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AA  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    + +      ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GF+G+  LV
Sbjct  184  STITMKKILETYDGFDGLKTLV  205



>gb|AAN03726.1| caffeic acid O-methyltransferase [Coffea canephora]
Length=350

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 104/193 (54%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  274  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
              LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S   MK  L
Sbjct  121  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKIL  179

Query  622  DGYHGFEGVTRLV  660
            + Y GFEG+  +V
Sbjct  180  EVYRGFEGLKTVV  192



>gb|ADO16247.1| caffeic acid O-methyltransferase [Ocimum tenuiflorum]
Length=361

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 107/205 (52%), Gaps = 11/205 (5%)
 Frame = +1

Query  73   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  405
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPNGGVERLYGLAPVCKFLTRNEDG  119

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGM  178

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
            S  S   MK  L+ Y GF+G+  +V
Sbjct  179  SNHSTITMKKILETYTGFDGLKTVV  203



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTANPDAPVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVAL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GF+G+  LV
Sbjct  184  STITMKKILETYDGFDGLKTLV  205



>dbj|BAA13683.1| O-methyltransferase [Glycyrrhiza echinata]
Length=367

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 100/204 (49%), Gaps = 5/204 (2%)
 Frame = +1

Query  58   KEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGS-NAPLSASE  234
            K+     + SE  +  A L+ M L   +  P  LNA + LN+ + I +     A +SASE
Sbjct  8    KDNNLFSTSSEQTEDGACLSAMRLVTNLVYPAVLNAAIDLNLFEIIAKATPPGAFMSASE  67

Query  235  ILSSV-LPSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGL  408
            I S + LP+   D  N L R+LR+L SY V        ++ER Y L +VGK LV D    
Sbjct  68   IASKLPLPTQHSDLPNRLDRMLRLLASYSVLT--CATRSTERVYGLSQVGKYLVPDGSRG  125

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMS  588
               ++       ALM  W    EAVVD   + F K +G   Y Y    P+MN +  K+M+
Sbjct  126  YLASFTTFLCYPALMNVWLNFKEAVVDEDIDLFKKLHGVSKYEYMETDPKMNHIFNKSMA  185

Query  589  GVSVPFMKAFLDGYHGFEGVTRLV  660
             V    MK  L  Y GFEG++ LV
Sbjct  186  DVCATEMKRILQIYKGFEGISTLV  209



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 102/205 (50%), Gaps = 4/205 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ + A   E+++  + A L  ++L +   +PM+L A + L+V + I + G    LS ++
Sbjct  6    KQGMPAPSVENQAGDEAACLYALQLVSSSILPMTLKAAIELDVLEIIAKAGPEGKLSPAQ  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENSMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M
Sbjct  126  VSMAPLTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNNVFNEGM  184

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
               S+   K  L+ Y GFE +  LV
Sbjct  185  KNHSIVITKKLLESYKGFEDINVLV  209



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 100/201 (50%), Gaps = 4/201 (2%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + I + G  A LS +EI + 
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKTAIELDLLEIIAKAGPGAWLSPAEIAAQ  65

Query  247  VLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYG  417
            +  +       L RILR+L  Y V    +      A+ER Y L  V K L  + DG+S  
Sbjct  66   LPTTNPAAPVMLDRILRLLACYSVVACQLRTLPGGAAERLYGLAPVCKFLTKNNDGVSIS  125

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVS  597
               L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  S
Sbjct  126  PLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHS  184

Query  598  VPFMKAFLDGYHGFEGVTRLV  660
               MK  L+ Y GFEG+  +V
Sbjct  185  TITMKKLLETYKGFEGLNSVV  205



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 105/203 (52%), Gaps = 6/203 (3%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E   + +  + + A L  M+LA+   +PM L + + L++ + I + G  A LS  EI +
Sbjct  5    VETQITPTNVSDEEAALFAMQLASASVLPMVLKSALELDLLEIIAKAGPAAHLSPYEI-A  63

Query  244  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLS  411
            S LP+   DA   L RILR+L  Y +    +        +R Y L  V K LV ++DG+S
Sbjct  64   SQLPTNNPDAPVMLDRILRLLACYNILTCSLTTLHDGKVQRLYGLATVAKYLVKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSG  591
              A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  K MS 
Sbjct  124  ISALNLMNQDKILMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSD  182

Query  592  VSVPFMKAFLDGYHGFEGVTRLV  660
             S   MK  L+ Y GFEG+  LV
Sbjct  183  HSTITMKKILEIYTGFEGLKSLV  205



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 108/208 (52%), Gaps = 10/208 (5%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTD  396
            S+I +S LP+   DA   L RILR+L  Y +    +        ER Y L  V K LV +
Sbjct  60   SDI-ASRLPTHNPDAPVMLDRILRLLACYNILSFSLRTLPHGKVERLYGLAPVAKYLVRN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  
Sbjct  119  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFN  177

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            K M+  S   MK  L+ Y GFEG+  LV
Sbjct  178  KGMADHSTITMKKILETYTGFEGLKSLV  205



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + +   L  M+L +   +PM L + + L++ + + + G  A LS +E L+S
Sbjct  6    ETQMTPNQVSDEELNLFAMQLTSASVLPMVLTSAIELDLFEIMAKAGPGAFLSPNE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER YSLG V K L  ++DG++ 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYSVLNCSLRTLPDGKVERLYSLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             +  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  + M+  
Sbjct  125  SSLSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   M+  L+ Y GFEGV  LV
Sbjct  184  STTTMRKILETYDGFEGVKTLV  205



>emb|CDY18306.1| BnaC09g30560D [Brassica napus]
Length=364

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 102/207 (49%), Gaps = 14/207 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+           A L  M+LA+   +PM L   + L++ + + +  S   +S S
Sbjct  1    MGSTEETQITPVQVTDDEAALFAMQLASASVLPMVLKTALDLDLLEIMAKNSSQ--MSPS  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASQLQTKNPEAPIMLDRILRLLTSYSILTCSSRAIPGGDSVERIYGLGPVCKYLTKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+GK    N +   
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMTAFEYHGKDLRFNTVFNN  177

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+T LV
Sbjct  178  GMSNHSTITMKKILETYKGFEGLTSLV  204



>ref|XP_008803441.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Phoenix dactylifera]
Length=362

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 105/206 (51%), Gaps = 6/206 (3%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G  + ++   E E A+  A    ++LA   ++ M+L A + L+V + + + G  A LS +
Sbjct  2    GSIQNQSFPQEEEEAKACAY--ALQLATSSAIGMALKAAIELDVLEIMARAGPGAELSPA  59

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI---NADASERRYSLGEVGKTLVTDKD  402
            EI + +       A  L R+LR L SY +    +   +   + RRY L  V + L  + D
Sbjct  60   EIAAQLPTDNPQAAATLDRMLRFLASYSMLTCSVVPGDGGRNARRYGLAPVCRFLTKNGD  119

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S  A VL +    L+ +W  + +AV++    PF KA+G  A+ Y+G  P  N +  + 
Sbjct  120  GVSLAAMVLMNQDKVLLDSWQHLKDAVLEGVI-PFTKAHGMTAFEYHGTDPRFNKVFNQG  178

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            M+  +  F+K  LD Y GFEG+  LV
Sbjct  179  MANHATLFVKKMLDTYEGFEGLKDLV  204



>ref|XP_011075886.1| PREDICTED: LOW QUALITY PROTEIN: caffeic acid 3-O-methyltransferase 
1-like [Sesamum indicum]
Length=370

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 107/198 (54%), Gaps = 6/198 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S  +S+++ + L  M+LA+   +PM L + + L++ + I + G  A +S +E L++ LP+
Sbjct  11   STIDSSEEESCLFAMQLASFSVLPMVLKSAIELDLLELIKKAGPGAFVSPAE-LAAQLPT  69

Query  259  GGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               +A   L RILR+L SY V     + +     ER Y L  V K L  + DG+S    +
Sbjct  70   SNPEAHVMLDRILRLLASYSVVNCSLKKLPDGGVERLYGLAPVCKFLTKNDDGVSMAPLL  129

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + MS  S   
Sbjct  130  LMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNQGMSNHSTII  188

Query  607  MKAFLDGYHGFEGVTRLV  660
            MK  L+ Y+GF+G+  +V
Sbjct  189  MKKILETYNGFQGLKTVV  206



>ref|XP_003621323.1| Isoliquiritigenin 2'-O-methyltransferase [Medicago truncatula]
 gb|AES77541.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=370

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 96/182 (53%), Gaps = 7/182 (4%)
 Frame = +1

Query  130  ANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLT  306
            ANM+  P  LNA + LN+ + I +  +   +SA EI +S LP+   D  N L R+LRML 
Sbjct  33   ANMV-FPAVLNAAIELNLFEIIAKESNGDFMSAFEI-ASKLPTQHSDLPNRLDRMLRMLA  90

Query  307  SYGVFREHI---NADASERRYSLGEVGKTLVTDK-DGLSYGAYVLQHHQDALMKAWPLVH  474
            SY +        + D++ R Y +   GK  V D+ DG   G++       AL+  W    
Sbjct  91   SYSLLSVSTRTNDDDSTVRVYGVTSSGKYFVNDENDGGYLGSFTSFMCHRALLGVWLNFK  150

Query  475  EAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTR  654
            EAV+D   + F K NG   Y Y+GK P++N L  K+M+      MK  LD Y GFEGV+ 
Sbjct  151  EAVIDPEIDLFKKVNGISKYEYFGKDPQINQLFNKSMTDTCNVHMKRILDIYKGFEGVST  210

Query  655  LV  660
            LV
Sbjct  211  LV  212



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 104/202 (51%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    LM++W  + +AV++    PF K  G  A+ Y+G  P  N +  + MS  
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKVYGMTAFEYHGTDPRFNKVFNRGMSDH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  LV
Sbjct  184  STITMKKILETYDGFEGLKTLV  205



>ref|XP_009757562.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=363

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SES        +  A L  M+L +   +PM L + V L++ + + + G  A +S S
Sbjct  1    MGSTSESQSNSLTHTEDEAFLFAMQLCSASVLPMVLKSAVELDLLELMAKAGPGAAISPS  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDKD  402
            E+ + +          L R+LR+L SY V    +    D+S ER YSL  V K L  + D
Sbjct  61   ELAAQLSTQNPEAPVMLDRMLRLLASYSVLNCTLRTLPDSSVERLYSLAPVCKYLTKNAD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + 
Sbjct  121  GVSVAPLLLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   MK  L+ Y GFEG+  +V
Sbjct  180  MSDHSTMSMKKILEDYKGFEGLNSIV  205



>emb|CAA52461.1| catechol O-methyltransferase [Nicotiana tabacum]
Length=364

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 104/206 (50%), Gaps = 11/206 (5%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SES        +  A L  M+L +   +PM L + V L++ + + + G  A +S S
Sbjct  1    MGSTSESQSNSLTHTEDEAFLFAMQLCSASVLPMVLKSAVELDLLELMAKAGPGAAISPS  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDKD  402
            E+ + +          L R+LR+L SY V    +    D+S ER YSL  V K L  + D
Sbjct  61   ELAAQLSTQNPEAPVMLDRMLRLLASYSVLNCTLRTLPDSSVERLYSLAPVCKYLTKNAD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKA  582
            G+S    +L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + 
Sbjct  121  GVSVAPLLLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRG  179

Query  583  MSGVSVPFMKAFLDGYHGFEGVTRLV  660
            MS  S   MK  L+ Y GFEG+  +V
Sbjct  180  MSDHSTMSMKKILEDYKGFEGLNSIV  205



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 104/205 (51%), Gaps = 4/205 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ + A   E+++  + + +  ++LA+   +PM+L A + L V + I + GS   LS ++
Sbjct  6    KQGMPAPSVENQAGDEASCMYALQLASSSILPMTLKAAIELGVLEIIAKAGSVGKLSPAQ  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENPMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M
Sbjct  126  VSMAALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNEGM  184

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
               S+   K  L+ Y GFE V  LV
Sbjct  185  KNHSIIITKKLLEFYKGFEDVNVLV  209



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +1

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL  621
            + L+KAWP +H A++D+S+EPF + NGEPAY YYGK  E+N  M  AMSGVSVP+MKA L
Sbjct  1    ETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALL  60

Query  622  -DGYHGFEGVTRLV  660
              GY GFEGV  LV
Sbjct  61   GSGYDGFEGVKTLV  74



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 103/192 (54%), Gaps = 5/192 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A+L  M+LA+   +PM L   + L++ + I +GG  A LS S+I S +      +A 
Sbjct  9    EEEAQLFAMQLASASVLPMVLKTAIELDLLEIIGRGGEGALLSPSQIASQLSGLKNPEAH  68

Query  277  -NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L R+LR+L SY +    +N   D S +R Y L  V K L+ ++DG+S     L +   
Sbjct  69   VMLDRMLRLLASYSILTCSLNPLPDGSLQRLYGLAPVSKFLIKNQDGVSIAPLCLMNQDK  128

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
             LM++W  + +AV++    PF +A G  A+ Y+G  P  N +  K MS  S   MK  L+
Sbjct  129  VLMESWYHLKDAVLEGGI-PFNRAYGISAFEYHGTDPRFNKVFNKGMSDHSTITMKKILE  187

Query  625  GYHGFEGVTRLV  660
             Y GFEG+  +V
Sbjct  188  TYKGFEGLNSVV  199



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 104/195 (53%), Gaps = 6/195 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S ++S ++ A L  M+LA+   +PM L + + LN+ + I   G+ + +S +E L++ LP+
Sbjct  11   SPTDSDEEGAFLFAMQLASASVLPMVLKSAIELNLLELIKTSGAGSFVSPAE-LAAQLPA  69

Query  259  GGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA   + RILR+L  Y V    +   A    ERRY LG V K L  ++DG+S    V
Sbjct  70   SNADAPVVIDRILRLLACYDVLSCRVETLADGGIERRYGLGPVCKFLTKNEDGVSMAPLV  129

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPF  606
            L +    LM++W  + +AV++    PF +A G  A+ YYG+    + +    MS  S   
Sbjct  130  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGMSAFEYYGRDTRFSKIFNAGMSNHSTLI  188

Query  607  MKAFLDGYHGFEGVT  651
            MK  L  Y GF+ V+
Sbjct  189  MKKLLKTYRGFDHVS  203



>gb|ADI24332.1| caffeic acid 3-O-methyltransferase [Miscanthus sinensis]
Length=362

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 109/205 (53%), Gaps = 10/205 (5%)
 Frame = +1

Query  73   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIW-QGGSNAPLSASEI  237
            MGS +E     A + A +  M+LA+   +PM+L   + L + + +  +  +   L+  E+
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQAEAPAGKALAPEEV  60

Query  238  LS--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDG  405
            ++   V P+  G A  + R+LR+L SY V +  + + D   ERRYS   VGK L  ++DG
Sbjct  61   VARLPVAPTNPGAADMVYRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDG  120

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAM  585
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G  P  N +  + M
Sbjct  121  VSMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGM  179

Query  586  SGVSVPFMKAFLDGYHGFEGVTRLV  660
               SV   K  L+ Y GFEGV+ LV
Sbjct  180  KNHSVIITKKLLEFYTGFEGVSTLV  204



>dbj|BAO31650.1| O-methyltransferase [Sesamum indicum]
Length=353

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 102/195 (52%), Gaps = 6/195 (3%)
 Frame = +1

Query  88   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  267
            +S ++ A L  MELA+  ++PM L + + L++ + I + G  A +S S+ L++ LP+   
Sbjct  4    QSEEEEAFLYAMELASASALPMVLKSAIELDLLELIKKAGPGASVSPSQ-LAAQLPTKNP  62

Query  268  DAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            DA  +  R+LR+L +Y V R  +        ER YSL  V K L  ++DG+S     L  
Sbjct  63   DAATMIDRMLRLLAAYSVVRCSLKPLPDGGVERLYSLAPVCKFLTRNEDGVSVAPVALML  122

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKA  615
                 M++W  + + V++    PF +A G  A+ Y    P  N +  +AM   S  FMK 
Sbjct  123  QDKVFMESWYHIKDTVLEGGI-PFNRAYGMSAFEYPATDPRFNKVFNRAMYEQSTIFMKQ  181

Query  616  FLDGYHGFEGVTRLV  660
             L+ Y GFEGV  LV
Sbjct  182  ILEKYKGFEGVKSLV  196



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 107/207 (52%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESESA-------QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         + A L  M+LA+   +PM L + + L++ + I + G NA LS S
Sbjct  1    MGSTGETQIIPTHVNDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
             I ++ LP+   DA   L R++R+L  Y V    +        ER Y L  V K LV ++
Sbjct  61   NI-AAQLPTKNPDAAVMLDRMMRLLACYNVLSCSVRTLPDGKIERLYGLAPVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S     L +    LM++W  + +AV++    PF KA+G  ++ Y+GK    N +  K
Sbjct  120  DGVSIAPLNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+T LV
Sbjct  179  GMADHSTITMKKILETYTGFEGLTSLV  205



>sp|Q6T1F5.1|COMT1_AMMMJ RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Ammi majus]
 gb|AAR24097.1| caffeic acid O-methyltransferase [Ammi majus]
Length=365

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 102/192 (53%), Gaps = 6/192 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A +  M+LA+   +PM L + + LN+ ++I + G  A +S S+ L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLESIAKAGPGAYVSPSQ-LAAALPSSQPDTP  76

Query  277  -NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V    +    DA  ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLNCKLRDLPDARVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLD  624
             LM++W  + +AV+D    PF KA G  A+ Y+GK P  N +  + MS  S   MK  L 
Sbjct  137  ILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKKILQ  195

Query  625  GYHGFEGVTRLV  660
             Y GF G+  +V
Sbjct  196  TYDGFGGLKTVV  207



>ref|XP_009119951.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14328.1| BnaA10g07270D [Brassica napus]
Length=364

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 7/189 (4%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            A L  M+LA+   +PM L   + L++ + + +  S   +S SEI S +          L 
Sbjct  19   AALFAMQLASASVLPMVLKTALDLDLLEIMAKNSSQ--MSPSEIASQLQTKNPEAPIMLD  76

Query  286  RILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALM  453
            RILR+LTSY +     R     D+ ER Y LG V K L  ++DG+S  A  L +    LM
Sbjct  77   RILRLLTSYSILTCSSRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLM  136

Query  454  KAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH  633
            ++W  + +A++D    PF KA G  A+ Y+GK    N +    MS  S   MK  L+ Y 
Sbjct  137  ESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKILETYK  195

Query  634  GFEGVTRLV  660
            GFEG+T LV
Sbjct  196  GFEGLTSLV  204



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 106/207 (51%), Gaps = 13/207 (6%)
 Frame = +1

Query  73   MGSESESA-------QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         + A L  M+LA+   +PM L + + L++ + I + G NA LS S
Sbjct  1    MGSAGETQITPTHVNDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L R++R+L  Y V    +        ER Y L  V K LV ++
Sbjct  61   DI-ASQLPTKNPDAAVMLDRMMRLLACYNVLSSSLRTLPDGKIERLYGLAPVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG+S     L +    LM++W  + E V++    PF KA+G  ++ Y+GK    N +  K
Sbjct  120  DGVSIAPLNLMNQDKVLMESWYYLTETVLEGGI-PFNKAHGMTSFEYHGKDARFNKVFNK  178

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             M+  S   MK  L+ Y GFEG+  LV
Sbjct  179  GMADHSTITMKKILETYTGFEGLKSLV  205



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 105/207 (51%), Gaps = 6/207 (3%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  232  EILSSVLPSGGGDAQN-LQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHTVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLK  579
            DG++     L +    LM++W  + +AV++    PF KA G  A+ Y+GK    N +   
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMNAFDYHGKDLRFNKIFNN  179

Query  580  AMSGVSVPFMKAFLDGYHGFEGVTRLV  660
             MS  S   MK  L+ Y GFEG+  +V
Sbjct  180  GMSSHSTITMKKILENYKGFEGLNSVV  206



>ref|XP_006829216.1| hypothetical protein AMTR_s00001p00272250 [Amborella trichopoda]
 gb|ERM96632.1| hypothetical protein AMTR_s00001p00272250 [Amborella trichopoda]
Length=358

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 95/183 (52%), Gaps = 4/183 (2%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            M+LA+   +PM+L A + L+V + I   G  A LS  ++   +  +    A  L R+LR+
Sbjct  19   MQLASSSILPMTLKAAIELDVLEIIAAAGPGALLSPKDVADKLPTTNPEAATMLDRMLRL  78

Query  301  LTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L SY V    ++       ER Y    V K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASYSVLTSSVSLTPDGHPERLYGAAPVTKFLVKNQDGVSMAPLVLMNQDKVLMESWYHL  138

Query  472  HEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT  651
             +AV++    PF +A G  A+ Y+GK P  N +  + MS  S   MK  LD Y GFEG+ 
Sbjct  139  KDAVLEGGV-PFNRAYGMTAFEYHGKDPRFNKVFNRGMSDHSTITMKKILDDYPGFEGLN  197

Query  652  RLV  660
             +V
Sbjct  198  CIV  200



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 107/202 (53%), Gaps = 6/202 (3%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  + LS ++ L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPND-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTENPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGV  594
             A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G  P  N +  K M+  
Sbjct  125  AALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADH  183

Query  595  SVPFMKAFLDGYHGFEGVTRLV  660
            S   MK  L+ Y GFEG+  +V
Sbjct  184  STITMKKILETYKGFEGLKSIV  205



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 108/208 (52%), Gaps = 10/208 (5%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  396
            ++I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV +
Sbjct  60   TDI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLML  576
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G  P  N +  
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFN  177

Query  577  KAMSGVSVPFMKAFLDGYHGFEGVTRLV  660
            K M+  S   MK  L+ Y GFE +  LV
Sbjct  178  KGMADHSTITMKKILETYTGFESLKSLV  205



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 99/196 (51%), Gaps = 4/196 (2%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            + ++A + A +  ++LA+   +PM+L A + L++ + I + G  A LS +E+ + +    
Sbjct  15   DEQAADEAACMYAVQLASSSILPMTLKAAIELDILEIIVKAGPGAKLSPAEVATQLPTEN  74

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
               A  L R+LR+L SY +    +  DA     RRY    V K L  +K+G S  A  L 
Sbjct  75   PMAATMLDRMLRLLASYNILTCSVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLM  134

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMK  612
            +    LM +W  + +AV+D    PF KA G  A+ YYG  P  N +  +AM   S     
Sbjct  135  NQDKILMGSWYYLKDAVLDGGI-PFNKAYGTTAFEYYGTDPRFNRVFNEAMKDHSTITTM  193

Query  613  AFLDGYHGFEGVTRLV  660
              L+ Y+GFE V  LV
Sbjct  194  KLLEFYNGFEDVKVLV  209



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 103/195 (53%), Gaps = 6/195 (3%)
 Frame = +1

Query  88   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  267
            +  ++ A +  M+LA+   +PM L + + L++ ++I Q G  A +S +E L++ LPS   
Sbjct  15   DDEEEEACMFAMQLASASVLPMVLKSAIELDLLESIAQAGPGAYVSPAE-LAAKLPSSQP  73

Query  268  DAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            D    L RILR+L SY V +     +     ER Y+L  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLKCKLRDLPQGGVERLYALAPVCKFLTKNSDGVSMAPLLLMN  133

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKA  615
                LM++W  + + V+D    PF KA G  A+ Y+GK P  N +    MS  S   MK 
Sbjct  134  QDKILMESWYHLKDTVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNLGMSNHSTITMKK  192

Query  616  FLDGYHGFEGVTRLV  660
             L+ Y+GF G+  +V
Sbjct  193  ILETYNGFAGLKTVV  207



Lambda      K        H        a         alpha
   0.317    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320