BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031O07

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    290   1e-87   Solanum tuberosum [potatoes]
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    286   3e-86   Nicotiana sylvestris
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    285   5e-86   Nicotiana tomentosiformis
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    283   6e-85   Solanum lycopersicum
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    283   6e-85   
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    277   5e-83   Pyrus x bretschneideri [bai li]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    277   6e-83   Pyrus x bretschneideri [bai li]
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    277   6e-83   Pyrus x bretschneideri [bai li]
gb|AGH12216.1|  glycine decarboxylase P protein                         258   6e-83   Flaveria pringlei
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    274   8e-82   Eucalyptus grandis [rose gum]
emb|CDP08258.1|  unnamed protein product                                272   4e-81   Coffea canephora [robusta coffee]
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    271   7e-81   Prunus mume [ume]
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    271   8e-81   Malus domestica [apple tree]
gb|KDP34101.1|  hypothetical protein JCGZ_07672                         271   9e-81   Jatropha curcas
gb|AFV46211.1|  hypothetical protein                                    253   1e-80   Scutellaria baicalensis [Baikal skullcap]
gb|KCW81693.1|  hypothetical protein EUGRSUZ_C03047                     266   1e-79   Eucalyptus grandis [rose gum]
gb|KJB54687.1|  hypothetical protein B456_009G045100                    267   2e-79   Gossypium raimondii
gb|KJB54688.1|  hypothetical protein B456_009G045100                    267   3e-79   Gossypium raimondii
ref|XP_010097067.1|  Glycine cleavage system P protein 1                266   3e-79   
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             266   4e-79   Capsella rubella
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    266   4e-79   Fragaria vesca subsp. vesca
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    265   1e-78   Gossypium arboreum [tree cotton]
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    265   2e-78   Eucalyptus grandis [rose gum]
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  263   4e-78   
gb|KJB65558.1|  hypothetical protein B456_010G101200                    263   4e-78   Gossypium raimondii
gb|KJB65559.1|  hypothetical protein B456_010G101200                    263   6e-78   Gossypium raimondii
gb|AAU94363.1|  glycine decarboxylase P-protein                         253   7e-78   Moricandia nitens
gb|KJB65560.1|  hypothetical protein B456_010G101200                    262   1e-77   Gossypium raimondii
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    262   1e-77   Sesamum indicum [beniseed]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             262   1e-77   
gb|AAN17423.1|  P-Protein - like protein                                261   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119106.1|  glycine dehydrogenase [decarboxylating] 2          261   3e-77   Arabidopsis thaliana [mouse-ear cress]
emb|CAN63089.1|  hypothetical protein VITISV_032016                     261   3e-77   Vitis vinifera
ref|XP_002516446.1|  glycine dehydrogenase, putative                    261   4e-77   Ricinus communis
gb|AAK68740.1|  P-Protein - like protein                                261   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             261   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    261   5e-77   Vitis vinifera
gb|AAL57651.1|  AT4g33010/F26P21_130                                    260   5e-77   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    259   1e-76   Arabis alpina [alpine rockcress]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    258   3e-76   Nelumbo nucifera [Indian lotus]
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    258   4e-76   Flaveria pringlei
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                257   8e-76   Erythranthe guttata [common monkey flower]
emb|CAA81076.1|  P protein                                              257   1e-75   Flaveria pringlei
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    256   1e-75   Gossypium arboreum [tree cotton]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             255   3e-75   
dbj|BAJ33627.1|  unnamed protein product                                253   4e-75   Eutrema halophilum
gb|EPS70254.1|  precursor of carboxylase p-protein 1, glycine dec...    244   4e-75   Genlisea aurea
dbj|BAJ34193.1|  unnamed protein product                                251   9e-75   Eutrema halophilum
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    253   3e-74   Tarenaya hassleriana [spider flower]
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    252   4e-74   Populus tremuloides
ref|XP_006382015.1|  hypothetical protein POPTR_0006s24570g             248   5e-74   
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             251   8e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    251   1e-73   
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             251   2e-73   
ref|XP_006382016.1|  hypothetical protein POPTR_0006s24570g             248   4e-73   
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    249   4e-73   Glycine max [soybeans]
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             249   5e-73   
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    249   7e-73   Populus euphratica
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    249   7e-73   Arabis alpina [alpine rockcress]
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    248   2e-72   Flaveria pringlei
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    247   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   4e-72   Cucumis sativus [cucumbers]
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                244   2e-71   Erythranthe guttata [common monkey flower]
gb|KDO80091.1|  hypothetical protein CISIN_1g001531mg                   243   5e-71   Citrus sinensis [apfelsine]
gb|KDO80092.1|  hypothetical protein CISIN_1g001531mg                   243   5e-71   Citrus sinensis [apfelsine]
gb|KDO80090.1|  hypothetical protein CISIN_1g001531mg                   243   7e-71   Citrus sinensis [apfelsine]
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    243   7e-71   Flaveria anomala
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     243   8e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KDO80085.1|  hypothetical protein CISIN_1g001531mg                   243   9e-71   Citrus sinensis [apfelsine]
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    243   9e-71   Camelina sativa [gold-of-pleasure]
dbj|BAE98954.1|  putative glycine dehydrogenase                         243   9e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AGH12214.1|  glycine decarboxylase P protein                         225   1e-70   Flaveria pringlei
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             243   1e-70   Citrus clementina [clementine]
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    243   1e-70   Citrus sinensis [apfelsine]
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   242   1e-70   Citrus sinensis [apfelsine]
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   2e-70   Cucumis melo [Oriental melon]
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   2e-70   Sesamum indicum [beniseed]
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    241   4e-70   Glycine max [soybeans]
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    241   5e-70   Flaveria trinervia
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    240   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    238   6e-69   Medicago truncatula
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    238   8e-69   Pisum sativum [garden pea]
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             237   8e-69   Phaseolus vulgaris [French bean]
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    237   1e-68   Elaeis guineensis
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    237   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    237   1e-68   Brassica rapa
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    236   2e-68   Elaeis guineensis
emb|CDX75316.1|  BnaA01g03860D                                          236   3e-68   
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    234   8e-68   Vitis vinifera
emb|CBI27919.3|  unnamed protein product                                234   1e-67   Vitis vinifera
emb|CDX68930.1|  BnaC01g05230D                                          234   1e-67   
ref|XP_006858311.1|  hypothetical protein AMTR_s00064p00096040          233   3e-67   Amborella trichopoda
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    233   3e-67   Phoenix dactylifera
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    232   7e-67   Phoenix dactylifera
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             230   3e-66   Capsella rubella
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    230   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    230   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    228   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    221   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    214   2e-60   Glycine max [soybeans]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    214   2e-60   Glycine soja [wild soybean]
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    213   7e-60   Glycine soja [wild soybean]
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    213   7e-60   Glycine max [soybeans]
gb|AAB97081.1|  glycine decarboxylase P subunit                         194   3e-59   Coffea arabica [arabica coffee]
gb|AAB99844.1|  glycine decarboxylase multi-enzyme complex P subunit    194   4e-59   Coffea canephora [robusta coffee]
gb|AAB99845.1|  glycine decarboxylase multi-enzyme complex P subunit    191   6e-58   Coffea congensis
gb|AAA63798.1|  victorin binding protein                                207   9e-58   Avena sativa [cultivated oat]
gb|AGH12215.1|  glycine decarboxylase P protein                         186   5e-56   Flaveria pringlei
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             201   7e-56   Phaseolus vulgaris [French bean]
ref|XP_006371884.1|  hypothetical protein POPTR_0018s05150g             199   1e-55   
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    191   5e-52   
ref|XP_001754864.1|  predicted protein                                  187   9e-51   
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    182   3e-49   Brachypodium distachyon [annual false brome]
gb|EAY75571.1|  hypothetical protein OsI_03474                          182   8e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008662474.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    181   1e-48   
gb|AFW56071.1|  glycine cleavage complex P-protein                      181   1e-48   
ref|NP_001044046.1|  Os01g0711400                                       181   2e-48   
ref|XP_001780310.1|  predicted protein                                  180   2e-48   
emb|CDM83805.1|  unnamed protein product                                180   4e-48   Triticum aestivum [Canadian hard winter wheat]
gb|AAS16361.1|  glycine dehydrogenase P protein                         178   8e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001058062.1|  Os06g0611900                                       178   9e-48   
gb|AAB82711.1|  glycine decarboxylase P subunit                         178   1e-47   x Tritordeum sp.
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          177   3e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          177   3e-47   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35509.1|  putative glycine dehydrogenase                         177   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005850088.1|  hypothetical protein CHLNCDRAFT_16305              169   5e-47   Chlorella variabilis
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          175   2e-46   Sorghum bicolor [broomcorn]
ref|XP_001692993.1|  glycine cleavage system, P protein                 165   4e-43   Chlamydomonas reinhardtii
gb|KIY98368.1|  glycine dehydrogenase                                   154   2e-42   Monoraphidium neglectum
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   158   1e-40   Citrus sinensis [apfelsine]
ref|XP_001420206.1|  predicted protein                                  158   2e-40   Ostreococcus lucimarinus CCE9901
ref|XP_002503477.1|  glycine cleavage system p-protein                  156   7e-40   Micromonas commoda
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             155   1e-39   Volvox carteri f. nagariensis
ref|XP_003081763.1|  GCSP_FLAAN Glycine dehydrogenase [decarboxyl...    154   3e-39   
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    154   4e-39   Ostreococcus tauri
ref|XP_003055654.1|  glycine cleavage system p-protein                  152   3e-38   Micromonas pusilla CCMP1545
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    149   2e-37   Auxenochlorella protothecoides
ref|XP_005649750.1|  glycine dehydrogenase                              148   5e-37   Coccomyxa subellipsoidea C-169
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             142   4e-35   
ref|XP_007510359.1|  glycine dehydrogenase                              142   6e-35   Bathycoccus prasinos
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             142   8e-35   
gb|EMT12369.1|  Glycine dehydrogenase (decarboxylating), mitochon...    136   5e-33   
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    136   6e-33   Oryza brachyantha
ref|XP_001755004.1|  predicted protein                                  135   1e-32   
ref|XP_006681352.1|  hypothetical protein BATDEDRAFT_20549              130   8e-31   Batrachochytrium dendrobatidis JAM81
ref|WP_014435168.1|  glycine dehydrogenase                              129   3e-30   Caldilinea aerophila
ref|WP_009768707.1|  glycine dehydrogenase, decarboxylating             128   4e-30   Oscillatoriales cyanobacterium JSC-12
gb|ESA20942.1|  hypothetical protein GLOINDRAFT_343379                  127   7e-30   
ref|WP_009187084.1|  glycine dehydrogenase                              125   4e-29   Cecembia lonarensis
gb|KFH65627.1|  glycine dehydrogenase                                   125   5e-29   Mortierella verticillata NRRL 6337
ref|WP_014772152.1|  glycine dehydrogenase                              124   9e-29   Belliella baltica
ref|WP_039830229.1|  glycine dehydrogenase                              119   1e-28   
ref|XP_009056743.1|  hypothetical protein LOTGIDRAFT_216694             124   1e-28   Lottia gigantea
ref|WP_021830956.1|  Glycine dehydrogenase [decarboxylating] (gly...    124   1e-28   Crocosphaera watsonii
ref|XP_007270989.1|  glycine dehydrogenase                              124   2e-28   Fomitiporia mediterranea MF3/22
ref|WP_013030982.1|  glycine dehydrogenase                              123   2e-28   Sideroxydans lithotrophicus
ref|WP_008624248.1|  Glycine dehydrogenase                              123   2e-28   Mariniradius saccharolyticus
ref|WP_044226980.1|  glycine dehydrogenase                              123   2e-28   Phaeodactylibacter xiamenensis
ref|WP_012627655.1|  glycine dehydrogenase                              123   2e-28   Cyanothece sp. PCC 7425
ref|WP_035493337.1|  glycine dehydrogenase                              123   2e-28   
ref|WP_013294701.1|  glycine dehydrogenase                              123   2e-28   Gallionella capsiferriformans
ref|WP_018149850.1|  glycine dehydrogenase                              123   3e-28   Leeia oryzae
ref|WP_009032864.1|  glycine dehydrogenase                              123   3e-28   Indibacter alkaliphilus
ref|WP_021833183.1|  Glycine dehydrogenase [decarboxylating] (gly...    122   3e-28   
ref|WP_035628774.1|  hypothetical protein                               113   5e-28   
ref|WP_002707146.1|  glycine dehydrogenase                              122   5e-28   
ref|WP_008684764.1|  glycine dehydrogenase                              122   6e-28   Rhodopirellula sallentina
ref|WP_035827440.1|  glycine dehydrogenase                              122   6e-28   Crocosphaera watsonii
ref|WP_035075932.1|  glycine dehydrogenase                              122   6e-28   Anditalea andensis
emb|CCQ61793.1|  Glycine dehydrogenase [decarboxylating] (glycine...    122   6e-28   Crocosphaera watsonii WH 0401
ref|WP_039413576.1|  glycine dehydrogenase                              122   6e-28   
ref|WP_015130859.1|  glycine dehydrogenase                              121   8e-28   Calothrix sp. PCC 7507
ref|WP_044145105.1|  glycine dehydrogenase                              119   1e-27   
ref|XP_004343370.1|  glycine dehydrogenase                              121   1e-27   Capsaspora owczarzaki ATCC 30864
ref|WP_008692424.1|  glycine dehydrogenase                              120   1e-27   
ref|WP_028471416.1|  glycine dehydrogenase                              121   1e-27   Neptunomonas japonica
ref|WP_007096761.1|  glycine dehydrogenase                              121   1e-27   Kordia algicida
ref|WP_012166094.1|  glycine dehydrogenase                              121   1e-27   Acaryochloris marina
ref|WP_018476108.1|  glycine dehydrogenase                              121   1e-27   Pontibacter roseus
ref|WP_002694452.1|  glycine dehydrogenase                              120   1e-27   Microscilla marina
emb|CDS12383.1|  hypothetical protein LRAMOSA04578                      120   2e-27   Lichtheimia ramosa
emb|CDH56548.1|  glycine dehydrogenase                                  120   2e-27   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_024850811.1|  glycine dehydrogenase                              120   2e-27   Hydrogenovibrio kuenenii
ref|WP_039743276.1|  glycine dehydrogenase                              120   2e-27   
ref|WP_040687253.1|  glycine dehydrogenase                              120   2e-27   
ref|WP_044206069.1|  glycine dehydrogenase                              120   2e-27   Coleofasciculus chthonoplastes
gb|ELS34041.1|  Glycine dehydrogenase (decarboxylating)                 120   2e-27   Pseudanabaena biceps PCC 7429
ref|WP_040728598.1|  glycine dehydrogenase                              120   3e-27   
gb|EDX77003.1|  glycine dehydrogenase                                   120   3e-27   Coleofasciculus chthonoplastes PCC 7420
ref|WP_009094772.1|  glycine dehydrogenase                              120   3e-27   Rhodopirellula sp. SWK7
ref|WP_007306344.1|  glycine dehydrogenase                              120   3e-27   Crocosphaera watsonii
ref|WP_012410110.1|  glycine dehydrogenase                              120   3e-27   Nostoc punctiforme
ref|WP_028946840.1|  glycine dehydrogenase                              120   4e-27   Synechocystis sp. PCC 6714
ref|WP_017294248.1|  glycine dehydrogenase                              119   4e-27   Geminocystis herdmanii
ref|WP_019556676.1|  glycine dehydrogenase                              119   4e-27   Thiomicrorhabdus arctica
ref|WP_035151567.1|  glycine dehydrogenase                              119   4e-27   Calothrix sp. 336/3
ref|WP_019586329.1|  glycine dehydrogenase                              119   4e-27   Deinococcus apachensis
ref|WP_019499546.1|  glycine dehydrogenase                              119   4e-27   Pseudanabaena sp. PCC 6802
ref|WP_009544701.1|  MULTISPECIES: glycine dehydrogenase                119   4e-27   Cyanothece
ref|WP_028220613.1|  glycine dehydrogenase                              119   5e-27   Paraburkholderia oxyphila
ref|WP_044171749.1|  glycine dehydrogenase                              119   5e-27   
ref|WP_044179699.1|  glycine dehydrogenase                              119   5e-27   Photobacterium damselae
gb|KGT34387.1|  glycine dehydrogenase                                   112   5e-27   Vibrio parahaemolyticus
gb|EVU15264.1|  glycine cleavage system P-family protein                113   5e-27   Vibrio parahaemolyticus V-223/04
ref|WP_018979919.1|  glycine dehydrogenase                              119   5e-27   
ref|WP_027857624.1|  glycine dehydrogenase                              119   6e-27   Marinobacterium jannaschii
ref|XP_010875485.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    119   6e-27   Esox lucius
ref|WP_015784226.1|  glycine dehydrogenase                              119   6e-27   Cyanothece sp. PCC 8802
ref|WP_025918361.1|  glycine dehydrogenase                              119   7e-27   Herminiimonas sp. CN
ref|WP_010472943.1|  glycine dehydrogenase                              119   7e-27   Acaryochloris sp. CCMEE 5410
gb|AFZ32122.1|  Glycine dehydrogenase (decarboxylating)                 119   7e-27   Gloeocapsa sp. PCC 7428
ref|WP_041919296.1|  glycine dehydrogenase                              119   7e-27   
ref|WP_005365623.1|  glycine dehydrogenase                              119   9e-27   Photobacterium angustum
ref|WP_006643852.1|  glycine dehydrogenase                              118   9e-27   Photobacterium sp. SKA34
gb|KJG15141.1|  glycine dehydrogenase                                   118   9e-27   Photobacterium angustum
gb|KJF83041.1|  glycine dehydrogenase                                   118   9e-27   Photobacterium damselae subsp. damselae
ref|WP_007581597.1|  glycine dehydrogenase                              118   9e-27   Burkholderiaceae
gb|KJG39760.1|  glycine dehydrogenase                                   118   1e-26   Photobacterium angustum
gb|EJK45128.1|  hypothetical protein THAOC_36273                        118   1e-26   Thalassiosira oceanica
ref|WP_028981454.1|  glycine dehydrogenase                              118   1e-26   Sporocytophaga myxococcoides
ref|WP_012402353.1|  glycine dehydrogenase                              118   1e-26   Paraburkholderia phymatum
ref|WP_017772230.1|  glycine dehydrogenase                              118   1e-26   Paraburkholderia kururiensis
ref|WP_042302959.1|  glycine dehydrogenase                              118   1e-26   Paraburkholderia kururiensis
ref|WP_031817094.1|  glycine dehydrogenase                              112   1e-26   
ref|WP_044451621.1|  glycine dehydrogenase                              117   1e-26   Mastigocladus laminosus
dbj|GAL17115.1|  glycine dehydrogenase                                  114   1e-26   Vibrio maritimus
ref|WP_044106198.1|  glycine dehydrogenase                              118   1e-26   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_039366657.1|  glycine dehydrogenase                              118   1e-26   
ref|WP_026736448.1|  glycine dehydrogenase                              118   2e-26   Fischerella sp. PCC 9605
ref|WP_037439120.1|  glycine dehydrogenase                              117   2e-26   Shewanella mangrovi
ref|XP_008334077.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    116   2e-26   Cynoglossus semilaevis [half-smooth tongue sole]
ref|WP_020402760.1|  glycine dehydrogenase                              117   2e-26   Gracilimonas tropica
ref|WP_015137299.1|  glycine dehydrogenase, decarboxylating             117   2e-26   Nostoc sp. PCC 7524
ref|WP_005304561.1|  glycine dehydrogenase                              117   2e-26   Photobacterium damselae
ref|XP_007339769.1|  glycine dehydrogenase                              117   2e-26   
ref|WP_015157279.1|  glycine dehydrogenase subunit alpha/beta           117   2e-26   Chroococcidiopsis thermalis
ref|XP_002182636.1|  glycine decarboxylase p- protein                   117   2e-26   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_028364014.1|  glycine dehydrogenase                              117   2e-26   Burkholderia sp. UYPR1.413
ref|XP_004991539.1|  glycine decarboxylase multi-enzyme complex P...    117   2e-26   Salpingoeca rosetta
ref|WP_034341915.1|  glycine dehydrogenase                              117   2e-26   Deinococcus misasensis
ref|WP_029991321.1|  glycine dehydrogenase                              117   2e-26   Tatumella ptyseos
dbj|GAL84002.1|  glycine dehydrogenase                                  117   2e-26   Sporocytophaga myxococcoides
dbj|BAH37805.1|  glycine dehydrogenase                                  117   2e-26   Gemmatimonas aurantiaca T-27
ref|WP_010415806.1|  glycine dehydrogenase                              117   2e-26   Leptospira inadai
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             117   2e-26   Pleurocapsa minor
ref|WP_013340914.1|  glycine dehydrogenase                              117   3e-26   Burkholderia sp. CCGE1003
ref|WP_042347795.1|  glycine dehydrogenase                              117   3e-26   Capnocytophaga canis
ref|WP_042343522.1|  glycine dehydrogenase                              117   3e-26   Capnocytophaga canis
ref|WP_042007515.1|  glycine dehydrogenase                              117   3e-26   Capnocytophaga
ref|WP_017309685.1|  glycine dehydrogenase                              117   3e-26   Fischerella sp. PCC 9339
ref|WP_035805169.1|  glycine dehydrogenase                              117   3e-26   Lunatimonas lonarensis
ref|WP_035470920.1|  glycine dehydrogenase                              117   3e-26   Gammaproteobacteria bacterium MFB021
ref|WP_009906657.1|  glycine dehydrogenase                              117   3e-26   Burkholderia thailandensis
ref|WP_025404644.1|  glycine dehydrogenase                              117   3e-26   Burkholderia thailandensis
ref|WP_028490147.1|  glycine dehydrogenase                              117   3e-26   Thiothrix lacustris
ref|WP_039401704.1|  glycine dehydrogenase                              117   3e-26   
ref|WP_006986397.1|  glycine dehydrogenase                              117   3e-26   Cardiobacterium valvarum
emb|CEI88334.1|  Putative Glycine dehydrogenase                         114   3e-26   Rhizopus microsporus
gb|EEX32328.1|  glycine dehydrogenase [decarboxylating]                 117   3e-26   Vibrio coralliilyticus ATCC BAA-450
ref|WP_026727000.1|  glycine dehydrogenase                              117   4e-26   Flavobacterium denitrificans
ref|WP_042327162.1|  glycine dehydrogenase                              117   4e-26   Paraburkholderia ginsengisoli
dbj|GAL33354.1|  glycine dehydrogenase                                  114   4e-26   Vibrio maritimus
ref|WP_013615693.1|  glycine dehydrogenase                              117   4e-26   Deinococcus proteolyticus
ref|WP_012434789.1|  glycine dehydrogenase                              117   4e-26   Paraburkholderia phytofirmans
ref|WP_035816192.1|  glycine dehydrogenase                              113   4e-26   
ref|WP_008273963.1|  glycine dehydrogenase                              117   4e-26   Cyanothece sp. CCY0110
ref|WP_025598176.1|  glycine dehydrogenase                              117   4e-26   Burkholderia sp. WSM2230
emb|CDQ64607.1|  unnamed protein product                                117   4e-26   Oncorhynchus mykiss
ref|WP_018432467.1|  glycine dehydrogenase                              116   4e-26   Burkholderia sp. JPY251
ref|WP_008917902.1|  glycine dehydrogenase                              116   4e-26   
ref|WP_031780027.1|  glycine dehydrogenase                              114   4e-26   
ref|WP_038159925.1|  glycine dehydrogenase                              116   4e-26   Vibrio sp. B183
ref|WP_006980349.1|  glycine dehydrogenase                              116   4e-26   Chthoniobacter flavus
ref|WP_043009965.1|  glycine dehydrogenase                              116   5e-26   Vibrio coralliilyticus
ref|WP_040121887.1|  glycine dehydrogenase                              116   5e-26   Vibrio coralliilyticus
ref|WP_013090938.1|  glycine dehydrogenase                              116   5e-26   Burkholderia sp. CCGE1002
gb|ABZ95547.1|  Glycine dehydrogenase (decarboxylating), protein P      116   5e-26   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
ref|WP_019275951.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_041770080.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_018418838.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_035987447.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_043893096.1|  hypothetical protein                               116   5e-26   
ref|WP_017027692.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_042305123.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_024162626.1|  Glycine dehydrogenase (decarboxylating)            116   5e-26   
ref|WP_015264586.1|  glycine dehydrogenase, decarboxylating             116   5e-26   
ref|WP_010572852.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_039928551.1|  glycine dehydrogenase                              116   5e-26   
ref|WP_008352522.1|  MULTISPECIES: glycine dehydrogenase                116   5e-26   
gb|EOQ89615.1|  glycine dehydrogenase                                   116   6e-26   
ref|WP_039713483.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_025902714.1|  glycine dehydrogenase                              116   6e-26   
ref|WP_020596172.1|  glycine dehydrogenase                              116   6e-26   
ref|XP_006268968.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    116   6e-26   
ref|XP_008527904.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    113   6e-26   
ref|WP_012486709.1|  glycine dehydrogenase                              116   6e-26   
gb|EDL41700.1|  glycine decarboxylase, isoform CRA_c                    111   6e-26   
ref|WP_009910201.1|  glycine dehydrogenase                              116   6e-26   
gb|AJF00842.1|  glycine dehydrogenase                                   116   6e-26   
ref|WP_025608878.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_030102409.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_028198452.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_027210635.1|  glycine dehydrogenase                              116   7e-26   
ref|WP_042113557.1|  glycine dehydrogenase                              116   7e-26   
gb|KDN53552.1|  putative GCV2-glycine decarboxylase P subunit           116   7e-26   
gb|EDM13112.1|  glycine decarboxylase (predicted), isoform CRA_b        111   7e-26   
gb|AHN75965.1|  glycine dehydrogenase                                   115   8e-26   
gb|EKM30522.1|  glycine dehydrogenase                                   115   8e-26   
pdb|4LHC|A  Chain A, Crystal Structure Of Synechocystis Sp. Pcc 6...    115   8e-26   
ref|WP_038898897.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_028731177.1|  MULTISPECIES: glycine dehydrogenase                115   8e-26   
pdb|4LGL|A  Chain A, Crystal Structure Of Glycine Decarboxylase P...    115   8e-26   
ref|WP_029789378.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_039982227.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_036587010.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_031627481.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_010873139.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_021710634.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_010451973.1|  glycine dehydrogenase                              115   8e-26   
ref|WP_009696729.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_006050861.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_027948813.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_017189009.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_026463388.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_005451647.1|  glycine dehydrogenase                              115   9e-26   
gb|AIV08805.1|  glycine dehydrogenase                                   115   9e-26   
ref|WP_009336924.1|  glycine dehydrogenase                              115   9e-26   
ref|WP_031780093.1|  glycine dehydrogenase                              114   1e-25   
ref|WP_037223913.1|  glycine dehydrogenase                              114   1e-25   
ref|WP_036259154.1|  hypothetical protein                               115   1e-25   
ref|WP_002155592.1|  glycine dehydrogenase (decarboxylating)            112   1e-25   
ref|WP_020566270.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027330224.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_013590033.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027885662.1|  glycine dehydrogenase                              115   1e-25   
gb|EKV00929.1|  glycine dehydrogenase, decarboxylating                  115   1e-25   
ref|WP_027776930.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_015004072.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_041430269.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_035480407.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_020067441.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_040355616.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_008198699.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027000783.1|  glycine dehydrogenase                              115   1e-25   
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  115   1e-25   
ref|WP_028361435.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_027199249.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_017031903.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_017243124.1|  glycine dehydrogenase                              115   1e-25   
gb|EEV87820.1|  glycine dehydrogenase                                   115   1e-25   
ref|WP_008989114.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_012596779.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_024124666.1|  glycine dehydrogenase [decarboxylating] GcvP       115   1e-25   
ref|WP_021096897.1|  glycine dehydrogenase (decarboxylating)            115   1e-25   
ref|WP_027463523.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_013665365.1|  glycine dehydrogenase                              115   1e-25   
ref|WP_035554383.1|  glycine dehydrogenase                              115   2e-25   
dbj|GAM71457.1|  glycine dehydrogenase                                  111   2e-25   
ref|WP_035986474.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_010117488.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_010107157.1|  glycine dehydrogenase                              115   2e-25   
emb|CBJ30901.1|  Glycine dehydrogenase (decarboxylating)                115   2e-25   
ref|WP_020081767.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_010888444.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_029637128.1|  glycine dehydrogenase [                            115   2e-25   
ref|XP_004653057.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    115   2e-25   
ref|WP_029828132.1|  glycine dehydrogenase                              113   2e-25   
ref|WP_022800452.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_019596339.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_027881989.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_007107330.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_007180013.1|  glycine dehydrogenase                              115   2e-25   
ref|WP_036989241.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_042604164.1|  glycine dehydrogenase                              114   2e-25   
gb|KDD73559.1|  glycine cleavage system P-protein                       110   2e-25   
ref|WP_042602813.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_039986371.1|  glycine dehydrogenase                              114   2e-25   
emb|CDQ71180.1|  unnamed protein product                                114   2e-25   
ref|WP_038883994.1|  glycine dehydrogenase                              114   2e-25   
dbj|GAK21950.1|  glycine dehydrogenase                                  114   2e-25   
ref|WP_034386891.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_039452154.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_029971225.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_039976795.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_009841190.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_044223259.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_005442136.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_022574032.1|  glycine dehydrogenase, decarboxylating             114   2e-25   
ref|WP_041053123.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_005469763.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_020197067.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_021713910.1|  glycine dehydrogenase [decarboxylating]            114   2e-25   
ref|WP_009704501.1|  glycine dehydrogenase                              114   2e-25   
gb|EOQ96237.1|  glycine dehydrogenase                                   114   2e-25   
dbj|GAK17746.1|  LOW QUALITY PROTEIN: glycine dehydrogenase             114   2e-25   
ref|WP_023934439.1|  glycine dehydrogenase                              114   2e-25   
dbj|GAJ69680.1|  LOW QUALITY PROTEIN: glycine dehydrogenase             114   2e-25   
ref|WP_039839419.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_038201543.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_038134901.1|  glycine dehydrogenase                              114   2e-25   
gb|KJF96875.1|  glycine dehydrogenase                                   114   2e-25   
ref|WP_038894866.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_017819574.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_022942732.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_001089358.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_027846740.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_040507194.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_038187339.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_038212609.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_005386044.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_025733773.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_033906528.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_017820968.1|  MULTISPECIES: glycine dehydrogenase                114   2e-25   
ref|WP_017634197.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_039623928.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_039477082.1|  glycine dehydrogenase                              114   2e-25   
ref|WP_042520777.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_026721410.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_012829021.1|  glycine dehydrogenase                              114   3e-25   
gb|EYD77881.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    113   3e-25   
ref|WP_005376434.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_009471306.1|  glycine dehydrogenase                              114   3e-25   
emb|CEG63023.1|  Putative Glycine dehydrogenase                         114   3e-25   
ref|WP_016792003.1|  glycine dehydrogenase                              114   3e-25   
emb|CEG07466.1|  Glycine dehydrogenase [decarboxylating]                114   3e-25   
ref|WP_044095056.1|  glycine dehydrogenase                              114   3e-25   
gb|ERE79332.1|  glycine dehydrogenase                                   111   3e-25   
gb|KIJ83529.1|  glycine dehydrogenase                                   114   3e-25   
ref|WP_027251065.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_035563762.1|  glycine dehydrogenase                              114   3e-25   
gb|EMO61678.1|  glycine dehydrogenase                                   114   3e-25   
ref|WP_023404562.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_038870877.1|  glycine dehydrogenase                              114   3e-25   
gb|KGR35979.1|  glycine dehydrogenase (decarboxylating)                 114   3e-25   
ref|WP_005431387.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_011490275.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_002988516.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    114   3e-25   
ref|WP_010370544.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_038877986.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_010607325.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_012129510.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_035401444.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_013433924.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_007117966.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_005530769.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_044202817.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_022946238.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_041265988.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_007361176.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_010649368.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_039491978.1|  glycine dehydrogenase                              114   3e-25   
ref|XP_011273272.1|  glycine dehydrogenase                              114   3e-25   
ref|WP_009514275.1|  glycine dehydrogenase                              114   3e-25   
ref|XP_006018433.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    114   4e-25   
ref|XP_002499282.1|  ZYRO0E08206p                                       114   4e-25   
ref|WP_001089335.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_017217915.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_013322173.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_033403597.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_039485771.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_023076988.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_011669375.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_035383253.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_010628682.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_011319516.1|  glycine dehydrogenase                              114   4e-25   
gb|KEI72124.1|  glycine dehydrogenase                                   114   4e-25   
ref|WP_023265002.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_025553125.1|  glycine dehydrogenase                              113   4e-25   
ref|WP_027799229.1|  glycine dehydrogenase                              114   4e-25   
gb|EMJ78114.1|  glycine dehydrogenase                                   114   4e-25   
ref|WP_017334831.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_020776421.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_029861334.1|  glycine dehydrogenase                              113   4e-25   
ref|WP_004784745.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_025639988.1|  glycine dehydrogenase                              113   4e-25   
ref|WP_024701286.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_004419733.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_001089341.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_029626474.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_035873330.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_011614237.1|  glycine dehydrogenase                              114   4e-25   
ref|WP_037905710.1|  glycine dehydrogenase                              114   4e-25   
gb|EKQ93699.1|  glycine dehydrogenase                                   114   4e-25   
gb|EMN16788.1|  glycine dehydrogenase                                   114   5e-25   
gb|EMK13450.1|  glycine dehydrogenase                                   114   5e-25   
dbj|BAN24488.1|  glycine dehydrogenase                                  114   5e-25   
ref|WP_016757906.1|  MULTISPECIES: glycine dehydrogenase                114   5e-25   
ref|WP_004447455.1|  glycine dehydrogenase                              114   5e-25   
ref|WP_016749270.1|  glycine dehydrogenase                              113   5e-25   
ref|WP_002106132.1|  glycine dehydrogenase                              113   5e-25   
ref|WP_004428948.1|  glycine dehydrogenase                              113   5e-25   
ref|WP_027816015.1|  glycine dehydrogenase                              114   5e-25   
ref|WP_015119530.1|  glycine dehydrogenase, decarboxylating             113   5e-25   
ref|WP_001089344.1|  glycine dehydrogenase                              113   5e-25   
ref|WP_001089336.1|  glycine dehydrogenase                              113   5e-25   
ref|WP_001089343.1|  glycine dehydrogenase                              113   5e-25   
gb|EKR00019.1|  glycine dehydrogenase                                   113   5e-25   



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 161/187 (86%), Gaps = 8/187 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+RP+RYVSSL+P    Y  Q R +   
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYRPSRYVSSLSP----YTFQARNNAKS  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
                 + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSI
Sbjct  57   F----NTQQARSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSI  112

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R +SMK PKFD GLTE+QMIEHM+NLASKNKVFKSYIGMGYYNT+VPPVILRN++ENP W
Sbjct  113  RSESMKLPKFDSGLTESQMIEHMQNLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAW  172

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  173  YTQYTPY  179



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 156/189 (83%), Gaps = 2/189 (1%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYEN-QRRYSG  246
            MERARKLANRAIL+RLV ++KQ RANE P+ AAL+RP+RYVSSL+P      N      G
Sbjct  1    MERARKLANRAILKRLVSDSKQSRANEIPSSAALYRPSRYVSSLSPYTFQARNGNNMLHG  60

Query  247  AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
                F    Q  RSISVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQ
Sbjct  61   KVGNFNRQQQHVRSISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQ  120

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIR++SMKF KFD GLTEAQMI+HM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP
Sbjct  121  SIRIESMKFSKFDEGLTEAQMIDHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENP  180

Query  607  GWYTQYTPY  633
             WYTQYTPY
Sbjct  181  AWYTQYTPY  189



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 3/188 (2%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYENQRRYSGA  249
            M+RARKLANRAIL+RLV E+KQ RAN+ P+ AAL+RP+RYVSSL+P      N +     
Sbjct  1    MDRARKLANRAILKRLVSESKQSRANDIPSSAALYRPSRYVSSLSPYIFQARNGKNMLHG  60

Query  250  GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
               F  + Q  RSISVEALKPSDTFPRRHNSATP++Q++MAEFCGF SLD+LIDATVPQS
Sbjct  61   NGNF--NKQHVRSISVEALKPSDTFPRRHNSATPQEQTQMAEFCGFSSLDSLIDATVPQS  118

Query  430  IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            IR++SMKF KFD GLTEAQMIEHM  LAS NKVFKSYIGMGYYNTFVPPVILRNIMENP 
Sbjct  119  IRIESMKFSKFDEGLTEAQMIEHMSKLASMNKVFKSYIGMGYYNTFVPPVILRNIMENPA  178

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  179  WYTQYTPY  186



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   283 bits (723),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 160/188 (85%), Gaps = 9/188 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA-AALHRPARYVSSLAPCAAMYENQRRYSGA  249
            MERARKLANRAIL+RLV ++KQ R+NE P+ ++L+RP+RYVSSL+P    Y  Q R S  
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSPSSLYRPSRYVSSLSP----YTFQARNSVK  56

Query  250  GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
                  + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQS
Sbjct  57   SF----NTQQVRSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQS  112

Query  430  IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            IR +SMK PKFD GLTE+QMIEHM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP 
Sbjct  113  IRSESMKLPKFDGGLTESQMIEHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPA  172

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  173  WYTQYTPY  180



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   283 bits (723),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKLANRAIL+RLV ++KQ R+NE P+++L+ P+RYVSSL+P    Y  Q R +   
Sbjct  1    MERARKLANRAILKRLVSQSKQSRSNEIPSSSLYWPSRYVSSLSP----YTFQARNNAKS  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
                 + QQ RSISVEALKPSDTFPRRHNSATPE+Q+KMAEFCGF SLDALIDATVPQSI
Sbjct  57   F----NTQQARSISVEALKPSDTFPRRHNSATPEEQTKMAEFCGFQSLDALIDATVPQSI  112

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R +SMK PKFD GLTE+QMI+HM+ LASKNKVFKSYIGMGYYNT+VPPVILRN++ENP W
Sbjct  113  RSESMKLPKFDGGLTESQMIDHMQKLASKNKVFKSYIGMGYYNTYVPPVILRNLLENPAW  172

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  173  YTQYTPY  179



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 157/199 (79%), Gaps = 17/199 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA------LHRPARYVSSLAPCAAMYENQR  234
            MERAR+LANRA ++RLV EAKQ R NE+          L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  235  ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  396
                  R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  397  DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  576
            D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116  DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  577  VILRNIMENPGWYTQYTPY  633
            VILRNIMENP WYTQYTPY
Sbjct  176  VILRNIMENPAWYTQYTPY  194



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 157/199 (79%), Gaps = 17/199 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA------LHRPARYVSSLAPCAAMYENQR  234
            MERAR+LANRA ++RLV EAKQ R NE+          L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  235  ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  396
                  R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  397  DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  576
            D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116  DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  577  VILRNIMENPGWYTQYTPY  633
            VILRNIMENP WYTQYTPY
Sbjct  176  VILRNIMENPAWYTQYTPY  194



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 157/199 (79%), Gaps = 17/199 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA------LHRPARYVSSLAPCAAMYENQR  234
            MERAR+LANRA ++RLV EAKQ R NE+          L+ P+RYVSSL+PC+    + R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSSPR  60

Query  235  ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  396
                  R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF  L
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDGL  115

Query  397  DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  576
            D+LIDATVP+SIRL+SMKFPKFD GLTE+QMIEHMKNLASKNK+FKS+IGMGYYNT+VPP
Sbjct  116  DSLIDATVPKSIRLESMKFPKFDEGLTESQMIEHMKNLASKNKIFKSFIGMGYYNTYVPP  175

Query  577  VILRNIMENPGWYTQYTPY  633
            VILRNIMENP WYTQYTPY
Sbjct  176  VILRNIMENPAWYTQYTPY  194



>gb|AGH12216.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=250

 Score =   258 bits (660),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 14/190 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYEN---QRRYS  243
            MERAR+LAN+AILRRLV + K     +    AL+ P+RYVSSL+P      N    R  +
Sbjct  1    MERARRLANKAILRRLVSKTK----TQPITPALYSPSRYVSSLSPYICSGTNVRFDRNVN  56

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFP RHNSATPE+Q+KMAEF G+P+LD+LIDATVP
Sbjct  57   GFGS-------QARTISVEALKPSDTFPHRHNSATPEEQTKMAEFVGYPNLDSLIDATVP  109

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRL+SMK+PKFD GLTE+QMI HM+ LASKNK+FKS+IGMGYYNT+VP VILRNIMEN
Sbjct  110  KSIRLESMKYPKFDEGLTESQMIAHMQELASKNKIFKSFIGMGYYNTYVPTVILRNIMEN  169

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  170  PGWYTQYTPY  179



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   274 bits (701),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 159/196 (81%), Gaps = 9/196 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRR-  237
            MERAR+LANRAIL+R+V E K  R  E+     ++AL+ P+RYVSSL+ C++M+++ R  
Sbjct  1    MERARRLANRAILKRIVSETKHHRRLESGLDSSSSALYTPSRYVSSLSACSSMHKSSRSE  60

Query  238  -YSGAGAGFPASH---QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  405
               G    +   H    Q R+ISVEALKP+DTF RRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  61   MLLGRNVSYNVGHGIGSQTRTISVEALKPNDTFARRHNSATPEEQTKMAESCGFGSLDAL  120

Query  406  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            IDATVP+SIR+DSMKF KFD GLTE+QMIEHMKNLASKNKVFK++IGMGYYNTFVPPVIL
Sbjct  121  IDATVPKSIRIDSMKFSKFDGGLTESQMIEHMKNLASKNKVFKTFIGMGYYNTFVPPVIL  180

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENP WYTQYTPY
Sbjct  181  RNIMENPAWYTQYTPY  196



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 155/195 (79%), Gaps = 8/195 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR----ANETPAAA--LHRPARYVSSLAPCAAMYENQR  234
            M+RARKLANRAIL+RLV EAKQ R    ANE  +A    +RP+RYVSSL+PC+   + QR
Sbjct  1    MDRARKLANRAILKRLVSEAKQRRGNGEANELLSAPSPFYRPSRYVSSLSPCSFRGQYQR  60

Query  235  RYSG--AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  408
             Y      A   +   Q R +SVEALKPSDTFPRRHNSATPE+Q KM E CGFPSLD+LI
Sbjct  61   TYVNPKKNAFLHSGIGQVRFVSVEALKPSDTFPRRHNSATPEEQIKMVENCGFPSLDSLI  120

Query  409  DATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILR  588
            DATVP+SIRLD M F KFD GLTEAQMI+HM+ LASKNKVFKSYIGMGYYNTFVPPVILR
Sbjct  121  DATVPKSIRLDGMTFSKFDEGLTEAQMIDHMQKLASKNKVFKSYIGMGYYNTFVPPVILR  180

Query  589  NIMENPGWYTQYTPY  633
            N++ENP WYTQYTPY
Sbjct  181  NLLENPAWYTQYTPY  195



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 158/199 (79%), Gaps = 14/199 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LANRA ++RLV +AKQ R NET      +  L+ P+RYVSSL+PC+ M  + R 
Sbjct  1    MERARRLANRAFVKRLVSDAKQFRQNETVFSSSTSPVLYTPSRYVSSLSPCSFMRTSSRS  60

Query  238  YSGAGAGFPASHQ-------QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  396
             S AG     SH        Q RSISV+ALK SDTFPRRHNSATP++Q+KMAE CGF SL
Sbjct  61   DSLAGKN--VSHNVGYRTGTQTRSISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSL  118

Query  397  DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  576
            D+LIDATVP+SIRL+SMKF KFD GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPP
Sbjct  119  DSLIDATVPKSIRLESMKFTKFDEGLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPP  178

Query  577  VILRNIMENPGWYTQYTPY  633
            VILRNIMENP WYTQYTPY
Sbjct  179  VILRNIMENPAWYTQYTPY  197



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   271 bits (693),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 155/199 (78%), Gaps = 17/199 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA------LHRPARYVSSLAPCAAMYENQR  234
            MERAR+LANRA ++RLV EAKQ R NE+          L+ P+RYVSSL+PC+      R
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNESSVLGSSTSPVLYAPSRYVSSLSPCSLTRSCPR  60

Query  235  ------RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSL  396
                  R +   AGF     Q RSISV+ALK SDTFPRRHNSATPE+Q+KMAE CGF +L
Sbjct  61   SDSLLSRNASHNAGF-----QTRSISVDALKNSDTFPRRHNSATPEEQTKMAELCGFDAL  115

Query  397  DALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPP  576
            D+LIDATVP+SIRL+SMKF KFD GLTE+QMIEHMK LASKNK+FKS+IGMGYYNT+VPP
Sbjct  116  DSLIDATVPKSIRLESMKFQKFDEGLTESQMIEHMKKLASKNKIFKSFIGMGYYNTYVPP  175

Query  577  VILRNIMENPGWYTQYTPY  633
            VILRNIMENP WYTQYTPY
Sbjct  176  VILRNIMENPAWYTQYTPY  194



>gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 159/202 (79%), Gaps = 15/202 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRA---NETPAA------ALHRPARYVSSLA------P  207
            MERAR+LANRAIL+RLV+E++Q      NE+ A        L+ P+RYVSSL+      P
Sbjct  1    MERARRLANRAILKRLVNESRQCSHQGRNESSALLNSSSPVLYSPSRYVSSLSSFASRNP  60

Query  208  CAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  387
             +  ++  +  + + AG+     Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CGF
Sbjct  61   RSGFFQGGKNVAASAAGYYGVGSQVRSISVESLKPSDTFPRRHNSATPEEQTKMAEVCGF  120

Query  388  PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  567
             +LD+LIDATVP+SI++DSMKFPKFD GLTE+QM+EHMK LASKNKVFKSYIGMGYYNT 
Sbjct  121  DNLDSLIDATVPKSIKIDSMKFPKFDEGLTESQMVEHMKKLASKNKVFKSYIGMGYYNTH  180

Query  568  VPPVILRNIMENPGWYTQYTPY  633
            VPPVILRNIMENP WYTQYTPY
Sbjct  181  VPPVILRNIMENPAWYTQYTPY  202



>gb|AFV46211.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=266

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 147/197 (75%), Gaps = 26/197 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKL +RAILRRLV E KQ          L++ +RYVSSL+   A+   QR     G
Sbjct  1    MERARKLGSRAILRRLVSEQKQ--------QPLYKSSRYVSSLSASVAV---QR-----G  44

Query  253  AGFPASHQ----------QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
            +    SH             RSISV+ALKPSD+FPRRHNSA PE+QSKMAEF GF SLD+
Sbjct  45   SNVVNSHSFNSRSLVQFVGSRSISVDALKPSDSFPRRHNSAAPENQSKMAEFVGFDSLDS  104

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            LIDATVP+SIR+D M+ P F  GLTEAQM+EHM++LASKNKVFKSYIGMGYYNTFVPPVI
Sbjct  105  LIDATVPKSIRIDKMELPVFSEGLTEAQMLEHMQDLASKNKVFKSYIGMGYYNTFVPPVI  164

Query  583  LRNIMENPGWYTQYTPY  633
            LRNIMENPGWYTQYTPY
Sbjct  165  LRNIMENPGWYTQYTPY  181



>gb|KCW81693.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=838

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 154/197 (78%), Gaps = 10/197 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRRY  240
            MERAR+LANRAIL+RLV E+KQ R +E+     +  +  P+RYVSSL P  +M  + R  
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVPHGSMSRSSRSD  60

Query  241  SGAGAGFPASH------QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
               G    +S        Q RSISVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+
Sbjct  61   MSVGRHVSSSSTSYGVGSQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDS  120

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            LIDATVP+SIRLDSMKF KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVI
Sbjct  121  LIDATVPKSIRLDSMKFSKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVI  180

Query  583  LRNIMENPGWYTQYTPY  633
            LRNIMENP WYTQYTPY
Sbjct  181  LRNIMENPAWYTQYTPY  197



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 156/196 (80%), Gaps = 12/196 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  247  AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  405
             GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  406  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            IDATVP++IR+DSMKFPKFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118  IDATVPKAIRIDSMKFPKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENP WYTQYTPY
Sbjct  178  RNIMENPAWYTQYTPY  193



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 156/196 (80%), Gaps = 12/196 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEMSSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  247  AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  405
             GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  406  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            IDATVP++IR+DSMKFPKFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118  IDATVPKAIRIDSMKFPKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENP WYTQYTPY
Sbjct  178  RNIMENPAWYTQYTPY  193



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 155/197 (79%), Gaps = 10/197 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAK-QLRANETPAAAL-------HRPARYVSSLAPCAAMYEN  228
            MERAR++ANRA L+RLV EAK Q R NE+PAA         + P+RYVSSL+PC+   + 
Sbjct  1    MERARRVANRAFLKRLVSEAKKQYRQNESPAALQNASSPMSYTPSRYVSSLSPCSRTRKG  60

Query  229  QRRYSGA--GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
              R   A    G+     Q RSISVEALKPSDTF RRHNSATPE+QSKMAE  GF SLDA
Sbjct  61   IPRSETASYNVGYRGIGSQTRSISVEALKPSDTFARRHNSATPEEQSKMAELVGFESLDA  120

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            LID+TVP+SIRL+SMKF KFD GLTE+QMIEHMK+LASKNKVFKS+IGMGYYNT VPPVI
Sbjct  121  LIDSTVPKSIRLESMKFSKFDEGLTESQMIEHMKDLASKNKVFKSFIGMGYYNTHVPPVI  180

Query  583  LRNIMENPGWYTQYTPY  633
            LRN++ENP WYTQYTPY
Sbjct  181  LRNVLENPAWYTQYTPY  197



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   266 bits (681),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 6/188 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  249
            MERAR+LA R I++RLV+EAK+ R  ETP   + H PARYVSSL+P  + +      S A
Sbjct  1    MERARRLAYRGIVKRLVNEAKRHRNPETPHLVVPHAPARYVSSLSPFVSTHR-----SPA  55

Query  250  GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
              G   SHQQ R ISVEAL+P DTFPRRHNSATP++QS MA+FCGF  +D+L+DATVP+S
Sbjct  56   SFGRHHSHQQTRPISVEALQPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLVDATVPKS  115

Query  430  IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            IRLDSMKF KFD GLTE+QMIEHM +LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP 
Sbjct  116  IRLDSMKFSKFDGGLTESQMIEHMVDLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPA  175

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  176  WYTQYTPY  183



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 151/194 (78%), Gaps = 8/194 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALH-------RPARYVSSLAPCAAMYENQ  231
            MERAR+LANRA ++RLV EAKQ R NET +A L         P+RYVSSL+         
Sbjct  1    MERARRLANRAFVKRLVSEAKQFRQNETSSALLGSSSPVMFTPSRYVSSLSSFIRTNPRS  60

Query  232  RRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  411
                G+ AG   S QQ RSI+VEALK SDTF RRHNSATPE+Q+KMA  CGF SLD+LID
Sbjct  61   DSLLGSKAGIAGS-QQTRSIAVEALKSSDTFARRHNSATPEEQTKMAGLCGFDSLDSLID  119

Query  412  ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
            ATVP+SIRL+SMKF KFD GLTE+QM+EHMK LASKNK+FKSYIGMGYYNT+VPPVILRN
Sbjct  120  ATVPKSIRLESMKFSKFDEGLTESQMLEHMKVLASKNKLFKSYIGMGYYNTYVPPVILRN  179

Query  592  IMENPGWYTQYTPY  633
            IMENP WYTQYTPY
Sbjct  180  IMENPAWYTQYTPY  193



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 155/196 (79%), Gaps = 12/196 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERARK+ANRAIL+RLV+E+KQ R  E  + +   + P+RYVSSL+P  +  +N  R   
Sbjct  1    MERARKVANRAILKRLVNESKQSRNGEISSRSPVSYTPSRYVSSLSPFGS--KNHSRSDS  58

Query  247  AGA-------GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDAL  405
             GA       GF     Q RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLDAL
Sbjct  59   LGARNVSNNVGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLDAL  117

Query  406  IDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            IDATVP++IR+DSMKF KFD GLTE+QMIEHMK+L SKNK+FKS+IGMGYYNT VPPVIL
Sbjct  118  IDATVPKAIRIDSMKFSKFDGGLTESQMIEHMKDLESKNKIFKSFIGMGYYNTHVPPVIL  177

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENP WYTQYTPY
Sbjct  178  RNIMENPAWYTQYTPY  193



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 154/197 (78%), Gaps = 10/197 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET----PAAALHRPARYVSSLAPCAAMYENQRRY  240
            MERAR+LANRAIL+RLV E+KQ R +E+     +  +  P+RYVSSL P  +M  + R  
Sbjct  1    MERARRLANRAILKRLVSESKQYRQDESLLSSSSPVIFTPSRYVSSLVPHGSMSRSSRSD  60

Query  241  SGAGAGFPASH------QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
               G    +S        Q RSISVEALKP+DTFPRRHNSATPE+Q+KMAE+CGF +LD+
Sbjct  61   MSVGRHVSSSSTSYGVGSQARSISVEALKPNDTFPRRHNSATPEEQTKMAEYCGFDNLDS  120

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            LIDATVP+SIRLDSMKF KFD GLTE+QMI HMKNL SKNKVFKSYIGMGYYNT VPPVI
Sbjct  121  LIDATVPKSIRLDSMKFSKFDEGLTESQMIAHMKNLESKNKVFKSYIGMGYYNTSVPPVI  180

Query  583  LRNIMENPGWYTQYTPY  633
            LRNIMENP WYTQYTPY
Sbjct  181  LRNIMENPAWYTQYTPY  197



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR++ANRAIL+RLV+ AKQ R  E  + +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1    MERARRVANRAILKRLVNAAKQSRNGEISSRSPVLYTPSRYVSSLSPFGSKSYSRSDLLG  60

Query  247  A-----GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  411
            A      AGF     Q RSISVEALK SDTFPRRHNSATPE+Q KMA+ CGF +LD+LID
Sbjct  61   ARNVSNNAGFGVG-SQIRSISVEALKSSDTFPRRHNSATPEEQIKMAQSCGFDNLDSLID  119

Query  412  ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
            ATVP++IR+DSMKF KFD GLTE+QMIEHM+NLASKNK+FKS+IGMGYYNT+VPPVILRN
Sbjct  120  ATVPKAIRIDSMKFSKFDGGLTESQMIEHMQNLASKNKIFKSFIGMGYYNTYVPPVILRN  179

Query  592  IMENPGWYTQYTPY  633
            IMENP WYTQYTPY
Sbjct  180  IMENPAWYTQYTPY  193



>gb|KJB65558.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=945

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  247  AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
             G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  421  PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120  PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  601  NPGWYTQYTPY  633
            NP WYTQYTPY
Sbjct  180  NPAWYTQYTPY  190



>gb|KJB65559.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=973

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  247  AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
             G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  421  PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120  PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  601  NPGWYTQYTPY  633
            NP WYTQYTPY
Sbjct  180  NPAWYTQYTPY  190



>gb|AAU94363.1| glycine decarboxylase P-protein [Moricandia nitens]
Length=497

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 146/192 (76%), Gaps = 9/192 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P    Y +  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRKGEITPHHVPSVVPHAPARYISSLSP----YLSNHR  56

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
                GA    +H Q RSISVEA+KP DTFPRRHNSATP++Q+ MA+ CG+  +D+L+DAT
Sbjct  57   SVNVGARHHHNHHQTRSISVEAVKPGDTFPRRHNSATPDEQAHMAKLCGYDHIDSLVDAT  116

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+ IR+DSMKF KFD GLTE+QMI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  117  VPKQIRIDSMKFSKFDEGLTESQMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  176

Query  598  ENPGWYTQYTPY  633
            ENP WYTQYTPY
Sbjct  177  ENPAWYTQYTPY  188



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR+LA+RAIL+RLV+E KQ    +    +  L+ P+RYVSSL+P  + Y ++    G
Sbjct  1    MERARRLASRAILKRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKYYSRSDLLG  60

Query  247  AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
             G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SLD+LIDATV
Sbjct  61   -GRNVPNSFGSQQVRSISVEALKSSDTFPRRHNSATPEEQAKMAESCGFDSLDSLIDATV  119

Query  421  PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120  PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  601  NPGWYTQYTPY  633
            NP WYTQYTPY
Sbjct  180  NPAWYTQYTPY  190



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 152/192 (79%), Gaps = 17/192 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAA-----MYENQRR  237
            MERARKLANRAILRRLV E+KQ          L++ +RY+SSL+P        + +    
Sbjct  1    MERARKLANRAILRRLVSESKQ--------QPLYQSSRYISSLSPSVVHGGSNVVKAHSF  52

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
             S + A F  S    RSISVEALKPSDTFPRRHNSATPE+QSKMAEF GF SLD+LIDAT
Sbjct  53   NSTSLAQFVGS----RSISVEALKPSDTFPRRHNSATPEEQSKMAEFVGFNSLDSLIDAT  108

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+SIR++ M+FP FD GLTEAQM+EHMK+LASKNK+FKSYIGMGYYNTFVPPVILRNIM
Sbjct  109  VPKSIRIEKMEFPIFDEGLTEAQMLEHMKDLASKNKIFKSYIGMGYYNTFVPPVILRNIM  168

Query  598  ENPGWYTQYTPY  633
            ENPGWYTQYTPY
Sbjct  169  ENPGWYTQYTPY  180



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 148/187 (79%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FLSTHRSVNPA  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+ALKP DTFPRRHNSATP++QS MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDALKPGDTFPRRHNSATPDEQSHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMIEHM +LASKNKV KS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDGGLTESQMIEHMVDLASKNKVLKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>gb|AAN17423.1| P-Protein - like protein [Arabidopsis thaliana]
Length=956

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>ref|NP_001119106.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 gb|AEE86160.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=976

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 151/198 (76%), Gaps = 12/198 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCAAMYENQR-  234
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA   +  R 
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCAFPNKTVRS  60

Query  235  -----RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  399
                 R   +  GF     Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD
Sbjct  61   DVLLGRNVMSSVGF-GMGCQTRSISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLD  119

Query  400  ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  579
            +L+DATVP+SIRL+S+KF KFD GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPV
Sbjct  120  SLVDATVPKSIRLESLKFSKFDEGLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPV  179

Query  580  ILRNIMENPGWYTQYTPY  633
            ILRNIMENPGWYTQYTPY
Sbjct  180  ILRNIMENPGWYTQYTPY  197



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 156/202 (77%), Gaps = 17/202 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR------------ANETPAAALHRPARYVSSLAPCAA  216
            MERARKLANRAIL+RLV+E+K  +             N + +  L+ P+RYVSSL+  A+
Sbjct  1    MERARKLANRAILKRLVNESKPHKHHSRNESSATTLLNSSSSPILYTPSRYVSSLSSFAS  60

Query  217  MYENQRRYSGAGA---GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  387
               N R  S  G    G+     Q RSISVE+LKPSDTFPRRHNSAT E+QSKMAE CGF
Sbjct  61   --RNPRSGSLPGTKSIGYYGIGSQVRSISVESLKPSDTFPRRHNSATAEEQSKMAELCGF  118

Query  388  PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  567
             +LD+LIDATVP+SIR+DSMKF KFD+GLTE+QMIEHM++LASKNKVFKSYIGMGYYNT 
Sbjct  119  DNLDSLIDATVPKSIRIDSMKFSKFDNGLTESQMIEHMQDLASKNKVFKSYIGMGYYNTH  178

Query  568  VPPVILRNIMENPGWYTQYTPY  633
            VPPVILRNIMENP WYTQYTPY
Sbjct  179  VPPVILRNIMENPAWYTQYTPY  200



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 151/198 (76%), Gaps = 12/198 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR-----ANETPAAALHRPARYVSSLAPCAAMYENQR-  234
            MERAR++ANRAILRRLV E+KQ R      NE    +     RYVSSL  CA   +  R 
Sbjct  1    MERARRIANRAILRRLVSESKQQRPCPRPQNEGLVNSSFSGWRYVSSLPTCAFPNKTVRS  60

Query  235  -----RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  399
                 R   +  GF     Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE CG+ SLD
Sbjct  61   DVLLGRNVMSSVGF-GMGCQTRSISVEALKPSDTFPRRHNSATPEEQTKMAESCGYESLD  119

Query  400  ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  579
            +L+DATVP+SIRL+S+KF KFD GLTE+QMIEHM  LA+KNKVFKSYIGMGYYNTFVPPV
Sbjct  120  SLVDATVPKSIRLESLKFSKFDEGLTESQMIEHMMQLAAKNKVFKSYIGMGYYNTFVPPV  179

Query  580  ILRNIMENPGWYTQYTPY  633
            ILRNIMENPGWYTQYTPY
Sbjct  180  ILRNIMENPGWYTQYTPY  197



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   260 bits (665),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV++ K+ R  ETP    H PARYVSSL+P    + +  R     
Sbjct  1    MERARRLAYRGIVKRLVNDTKRHRNAETPHLVPHAPARYVSSLSP----FISTPRSVNHT  56

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F   HQQ RSISV+A+KPSDTFPRRHNSATP++Q+ MA+FCGF  +D+LIDATVP+SI
Sbjct  57   AAF-GRHQQTRSISVDAVKPSDTFPRRHNSATPDEQTHMAKFCGFDHIDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RLDSMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VILRNIMENP W
Sbjct  116  RLDSMKFSKFDAGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 155/189 (82%), Gaps = 6/189 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYS-G  246
            MERAR+LA+R I+RRL++E K+ R  E+ +++  H P R+VSS++     + ++R +S G
Sbjct  1    MERARRLASRGIIRRLINETKRHRNGESSSSSSSHIPTRHVSSVS----TFLHRRDFSPG  56

Query  247  AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
            AG+ F    QQ RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF  LD LID+TVP+
Sbjct  57   AGSSFGRQQQQSRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDKLDTLIDSTVPK  116

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIRLDSMKF KFD GLTE++M+ HM +LASKNKVFKSYIGMGYYNT VPPVILRNIMENP
Sbjct  117  SIRLDSMKFSKFDGGLTESEMMNHMSDLASKNKVFKSYIGMGYYNTHVPPVILRNIMENP  176

Query  607  GWYTQYTPY  633
             WYTQYTPY
Sbjct  177  AWYTQYTPY  185



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 152/193 (79%), Gaps = 13/193 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET-----PAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LANRAILRRLVHE++Q + + T     PA+ +  PARY SSL+P        R 
Sbjct  1    MERARRLANRAILRRLVHESRQQQRHATSSYSSPASFI--PARYFSSLSPSVFPSTASRS  58

Query  238  YS-GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
               G G G+     Q RSISVEALKPSDTFPRRHNSATP++QS+MAE CG+ +LD+LIDA
Sbjct  59   ADIGFGLGY-----QTRSISVEALKPSDTFPRRHNSATPDEQSRMAESCGYSTLDSLIDA  113

Query  415  TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  594
            TVP+SIR+  MK PKFD GLTE+QMIEHMK LASKNK+ KS+IGMGYYNT+VP VILRNI
Sbjct  114  TVPKSIRIQPMKLPKFDEGLTESQMIEHMKKLASKNKILKSFIGMGYYNTYVPSVILRNI  173

Query  595  MENPGWYTQYTPY  633
            MENPGWYTQYTPY
Sbjct  174  MENPGWYTQYTPY  186



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 153/190 (81%), Gaps = 12/190 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  243
            MERAR+LAN+AIL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1    MERARRLANKAILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  58

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  59   GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  111

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  112  KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  171

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  172  PGWYTQYTPY  181



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   257 bits (656),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 144/187 (77%), Gaps = 12/187 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKLANRAILRRL  E+KQ          L++ +RYVSSL+P A   + +   S   
Sbjct  1    MERARKLANRAILRRLFSESKQ--------QPLYKSSRYVSSLSPSAVQQQGRTTNSKTL  52

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            + F  +    RSISV ALKPSDTFPRRHNSATPEDQSKMAEF GF +LD LIDATVP+SI
Sbjct  53   SQFLGA----RSISVAALKPSDTFPRRHNSATPEDQSKMAEFVGFKTLDELIDATVPKSI  108

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R+D M  P F  GLTEAQM+ HM +LASKNKVFKSYIGMGYYNT+VPPVILRNIMENPGW
Sbjct  109  RIDKMDLPIFGEGLTEAQMLSHMSDLASKNKVFKSYIGMGYYNTYVPPVILRNIMENPGW  168

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  169  YTQYTPY  175



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 153/190 (81%), Gaps = 12/190 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  243
            M+RAR+LAN+AIL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1    MDRARRLANKAILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  58

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  59   GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  111

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  112  KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  171

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  172  PGWYTQYTPY  181



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAA--LHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR+LA+RAILRRLV+E KQ    +    +  L+ P+RYVSSL+P  +   ++    G
Sbjct  1    MERARRLASRAILRRLVNETKQSSNGQMSCRSPVLYTPSRYVSSLSPFGSKCYSRSDLLG  60

Query  247  AGAGFPAS--HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
             G   P S   QQ RSISVEALK SDTFPRRHNSATPE+Q+KMAE CGF SL +LIDATV
Sbjct  61   -GRNVPNSFGSQQLRSISVEALKSSDTFPRRHNSATPEEQTKMAESCGFDSLYSLIDATV  119

Query  421  PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            P++IR+DSMKF KFD GLTE+QMIEHMK L SKNK+FKS+IGMGYYNT VPPVILRNIME
Sbjct  120  PKAIRIDSMKFSKFDEGLTESQMIEHMKMLESKNKIFKSFIGMGYYNTHVPPVILRNIME  179

Query  601  NPGWYTQYTPY  633
            NP WYTQYTPY
Sbjct  180  NPAWYTQYTPY  190



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 151/197 (77%), Gaps = 10/197 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR-------ANETPAAALHRPARYVSSLAPCAAMYENQ  231
            MERAR+LANRAIL+RLV  +K+ R       +    + AL+ PARYVSSL+P A+   N 
Sbjct  1    MERARRLANRAILKRLVDSSKRHRTAREASLSGGASSPALYSPARYVSSLSPFASSASNI  60

Query  232  RRYSGAGAGFPASHQ---QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
            R    +     AS     Q R ISVEALKP+DTFPRRHNSATPE+Q+ MA  CGF SLD+
Sbjct  61   RSEMASSNNRKASSHFGSQIRRISVEALKPTDTFPRRHNSATPEEQTVMANSCGFDSLDS  120

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            LIDATVP++IR+DSMKF KFD GLTE+QMI+HMK+LASKNKVFKSYIGMGYYNT +PPVI
Sbjct  121  LIDATVPKAIRIDSMKFSKFDEGLTESQMIDHMKDLASKNKVFKSYIGMGYYNTHIPPVI  180

Query  583  LRNIMENPGWYTQYTPY  633
            LRNI ENP WYTQYTPY
Sbjct  181  LRNITENPAWYTQYTPY  197



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYENQRRYSGA  249
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + + +    S A
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHLVVPHAPARYVSSLSPFVSTHRSVNPTSAA  60

Query  250  GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
              G    HQQ RSISV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP+S
Sbjct  61   AFG---RHQQTRSISVDALKPGDTFPRRHNSATPDEQSYMAKFCGYDHIDSLVDATVPKS  117

Query  430  IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            IRL SMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+ENP 
Sbjct  118  IRLGSMKFSKFDDGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILENPA  177

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  178  WYTQYTPY  185



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 5/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LAN+A ++RLV EAKQ R NET  ++   P  Y  S    +   +N     G G
Sbjct  1    MERARRLANQAFVKRLVSEAKQFRQNETVLSSSTSPVLYTPSSRSDSLAGKNVSHNVGYG  60

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
             G      Q RSISV+ALK SDTFPRRHNSATP++Q+KMAE CGF SLD+LIDATVP+SI
Sbjct  61   TG-----TQTRSISVDALKNSDTFPRRHNSATPDEQTKMAELCGFGSLDSLIDATVPKSI  115

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RL+SMKF KFD GLTE+QM+EHM+ LASKNK+FKS+IGMGYYNT+VPPVILRNIMENP W
Sbjct  116  RLESMKFAKFDEGLTESQMLEHMQYLASKNKIFKSFIGMGYYNTYVPPVILRNIMENPAW  175

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  176  YTQYTPY  182



>dbj|BAJ33627.1| unnamed protein product [Thellungiella halophila]
Length=822

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 8/189 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV+E K+ R  E+ ++ +  P+RYVSS++         RR S A 
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNVESSSSHI-VPSRYVSSVSTFL-----HRRESTAY  54

Query  253  AGFPASHQ--QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
             G    HQ  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+
Sbjct  55   PGGFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPK  114

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIRLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP
Sbjct  115  SIRLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENP  174

Query  607  GWYTQYTPY  633
             WYTQYTPY
Sbjct  175  AWYTQYTPY  183



>gb|EPS70254.1| precursor of carboxylase p-protein 1, glycine decarboxylase complex, 
partial [Genlisea aurea]
Length=408

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 141/187 (75%), Gaps = 12/187 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKLANRAILRRLV  +KQ          L++P+RY SS    + ++      S   
Sbjct  1    MERARKLANRAILRRLVSASKQ--------PPLYKPSRYYSSSLSPSVVHGGVGNASRNF  52

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A F  S    RSISVEALKPSDTFPRRHNSA+P +QSKM E  GF +LD+LIDATVP+SI
Sbjct  53   ARFVGS----RSISVEALKPSDTFPRRHNSASPVEQSKMVEALGFETLDSLIDATVPRSI  108

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R+D MK P FD GLTE+QM EHMK LASKNKVFKS+IGMGYYNTFVPPVILRNIMENP W
Sbjct  109  RIDEMKLPIFDRGLTESQMAEHMKELASKNKVFKSFIGMGYYNTFVPPVILRNIMENPAW  168

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  169  YTQYTPY  175



>dbj|BAJ34193.1| unnamed protein product [Thellungiella halophila]
Length=756

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 150/191 (79%), Gaps = 7/191 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETP---AAALHRPA-RYVSSLAPCAAMYENQRRY  240
            MERAR++A R I+RRLV++AK+ R  ETP   +A  H PA RY+SSL+P       +   
Sbjct  1    MERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP---FLSTRGSI  57

Query  241  SGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
            + +  G  A  QQ R ISVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D+LIDATV
Sbjct  58   NPSTFGNLARQQQTRPISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHIDSLIDATV  117

Query  421  PQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            P+SIRLDSMKF KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP VILRNIME
Sbjct  118  PKSIRLDSMKFSKFDGGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNIME  177

Query  601  NPGWYTQYTPY  633
            NP WYTQYTPY
Sbjct  178  NPAWYTQYTPY  188



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 152/198 (77%), Gaps = 15/198 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAP-----CAAM  219
            MERAR+LA++ I+RRLV+EAK+ R  E PA       A + P RYVSS++P     C   
Sbjct  1    MERARRLAHKGIVRRLVNEAKRHRNGE-PALTPAPAIAPYAPVRYVSSISPSVPRRCTTG  59

Query  220  YENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  399
              N    +  G GF    QQRR ISVEALKPSDTFPRRHNSATPE+Q++MA  CGF +LD
Sbjct  60   SINPAAAAACG-GF--GSQQRRWISVEALKPSDTFPRRHNSATPEEQTQMATSCGFDNLD  116

Query  400  ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  579
            ALIDATVP+SIRLDSM F KFD GLTE+QMIEHM +LASKNKVFKSYIGMGYYNT VPPV
Sbjct  117  ALIDATVPKSIRLDSMSFSKFDGGLTESQMIEHMNDLASKNKVFKSYIGMGYYNTHVPPV  176

Query  580  ILRNIMENPGWYTQYTPY  633
            ILRNIMENP WYTQYTPY
Sbjct  177  ILRNIMENPAWYTQYTPY  194



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 153/203 (75%), Gaps = 16/203 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  210
            MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1    MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  211  AAMYENQRRYSGAG--AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  384
            + +    +        AG+     Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61   SGLLPGTKNIVSRNVPAGYYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  385  FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  564
            F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT
Sbjct  121  FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLASKNKVFKSYIGMGYYNT  180

Query  565  FVPPVILRNIMENPGWYTQYTPY  633
            +VPPVILRNIMENP WYTQYTPY
Sbjct  181  YVPPVILRNIMENPAWYTQYTPY  203



>ref|XP_006382015.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59812.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=677

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 149/208 (72%), Gaps = 26/208 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYV------------  192
            MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYV            
Sbjct  1    MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  193  SSLAPCAAMYENQRRYSGA-GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  369
            S L P      +    +G+ G G      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KM
Sbjct  61   SGLLPGTKNIVSHNVPAGSYGIG-----SQIRSISVESLKPSDTFPRRHNSATPEEQTKM  115

Query  370  AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  549
            AE CGF +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGM
Sbjct  116  AELCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGM  175

Query  550  GYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  GYYNTHVPPVILRNIMENPAWYTQYTPY  203



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   251 bits (642),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 151/189 (80%), Gaps = 8/189 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV+E K+ R  E+ ++ +  P+RYVSS++         RR S A 
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNVESSSSHI-VPSRYVSSVSTFL-----HRRESTAY  54

Query  253  AGFPASHQ--QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
             G    HQ  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA +CGF SL+ LID+TVP+
Sbjct  55   PGGFGRHQLQQTRSISVDALKPSDTFPRRHNSATPEEQTQMANYCGFDSLNTLIDSTVPK  114

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIRLDSMKF KFD GLTE+QMIEHM +LA+KNKVFKS+IGMGYYNT VPPVILRNIMENP
Sbjct  115  SIRLDSMKFSKFDGGLTESQMIEHMSDLATKNKVFKSFIGMGYYNTHVPPVILRNIMENP  174

Query  607  GWYTQYTPY  633
             WYTQYTPY
Sbjct  175  AWYTQYTPY  183



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 148/204 (73%), Gaps = 20/204 (10%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRP---ARYVSSLAPCAAMYENQRR--  237
            MERAR+LANRA L+RL+ EAKQ R NET       P   +RYVSS++         ++  
Sbjct  57   MERARRLANRATLKRLLSEAKQNRNNETIWNTSTTPIPSSRYVSSVSNSVHRTRGSKQDN  116

Query  238  ------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFC  381
                            G G+P+   Q RSISVEALKPSDTFPRRHNSATPE+Q+KMAE C
Sbjct  117  IFTRKPNVPRSVVGFLGIGYPS---QSRSISVEALKPSDTFPRRHNSATPEEQTKMAESC  173

Query  382  GFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYN  561
            GF +LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK LASKNK+FKS+IGMGYYN
Sbjct  174  GFNTLDSLVDATVPKSIRLKEMKFNKFDGGLTEGQMIEHMKYLASKNKIFKSFIGMGYYN  233

Query  562  TFVPPVILRNIMENPGWYTQYTPY  633
            T VPPVILRNIMENP WYTQYTPY
Sbjct  234  THVPPVILRNIMENPAWYTQYTPY  257



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 154/198 (78%), Gaps = 8/198 (4%)
 Frame = +1

Query  55   FLEF-PAMERARKLANRAILRRLVHEAKQLRANETP---AAALHRPA-RYVSSLAPCAAM  219
            FL F  +MERAR++A R I+RRLV++AK+ R  ETP   +A  H PA RY+SSL+P    
Sbjct  97   FLPFYISMERARRIAYRGIVRRLVNDAKRHRNVETPHVPSAVPHAPATRYLSSLSP---F  153

Query  220  YENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLD  399
               +   + +  G  A  QQ R ISVEALKP DTFPRRHNSATP++Q+ MA++CGF  +D
Sbjct  154  LSTRGSINPSTFGNLARQQQTRPISVEALKPGDTFPRRHNSATPDEQTHMAKYCGFDHID  213

Query  400  ALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPV  579
            +LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VP V
Sbjct  214  SLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMVDLASKNKVFKSFIGMGYYNTHVPTV  273

Query  580  ILRNIMENPGWYTQYTPY  633
            ILRNIMENP WYTQYTPY
Sbjct  274  ILRNIMENPAWYTQYTPY  291



>ref|XP_006382016.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
 gb|ERP59813.1| hypothetical protein POPTR_0006s24570g [Populus trichocarpa]
Length=806

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 149/208 (72%), Gaps = 26/208 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYV------------  192
            MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYV            
Sbjct  1    MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  193  SSLAPCAAMYENQRRYSGA-GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  369
            S L P      +    +G+ G G      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KM
Sbjct  61   SGLLPGTKNIVSHNVPAGSYGIG-----SQIRSISVESLKPSDTFPRRHNSATPEEQTKM  115

Query  370  AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  549
            AE CGF +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGM
Sbjct  116  AELCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGM  175

Query  550  GYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  GYYNTHVPPVILRNIMENPAWYTQYTPY  203



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 145/202 (72%), Gaps = 15/202 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANE------TPAAALHRPARYVSSL---------AP  207
            MERAR+LANRAILRRLV EAKQ + NE      T    L+  +R +SS+           
Sbjct  1    MERARRLANRAILRRLVSEAKQHQKNESVLHSSTTPMLLYSSSRCMSSVLRSRGSKTETL  60

Query  208  CAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGF  387
                    R    A AG        RSISVEAL+PSDTFPRRHNSATPE+QSKMAE CGF
Sbjct  61   LGRNINMSRGVVVAAAGGFLGVGSARSISVEALRPSDTFPRRHNSATPEEQSKMAESCGF  120

Query  388  PSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTF  567
             SLD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKSYIGMGYYNT 
Sbjct  121  GSLDSLVDATVPKSIRLKDMKFGKFDAGLTENQMIEHMKDLASKNKVFKSYIGMGYYNTH  180

Query  568  VPPVILRNIMENPGWYTQYTPY  633
            VPPVILRNIMENP WYTQYTPY
Sbjct  181  VPPVILRNIMENPAWYTQYTPY  202



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA--AALHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR+LA R I++RLV+E K+ R  ++ +  A    P+RYVSS++   +   ++R  SG
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNGQSSSLPATTVTPSRYVSSVS---SFLHHRRDVSG  57

Query  247  AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
            +       +QQ RSIS++ALKPSDTFPRRHNSATPE+Q++MA +CGF  L+ LID+TVP+
Sbjct  58   STFTTSCRNQQTRSISIDALKPSDTFPRRHNSATPEEQTQMANYCGFDHLNTLIDSTVPK  117

Query  427  SIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            SIRLDSMKF  KFD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRNIMEN
Sbjct  118  SIRLDSMKFSGKFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRNIMEN  177

Query  604  PGWYTQYTPY  633
            P WYTQYTPY
Sbjct  178  PAWYTQYTPY  187



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 152/203 (75%), Gaps = 16/203 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYVSSLA------PC  210
            MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYVSSL+      P 
Sbjct  1    MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  211  AAMYENQRRYSGAG--AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCG  384
            + +    +  +     AG      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KMAE CG
Sbjct  61   SGILPGTKNIASHNVPAGSYGIGSQIRSISVESLKPSDTFPRRHNSATPEEQTKMAELCG  120

Query  385  FPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNT  564
            F +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYYNT
Sbjct  121  FDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLASKNKVFKSYIGMGYYNT  180

Query  565  FVPPVILRNIMENPGWYTQYTPY  633
             VPPVILRNIMENP WYTQYTPY
Sbjct  181  HVPPVILRNIMENPAWYTQYTPY  203



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET-PAAALHRPARYVSSLAPCAAMYENQRRYSGA  249
            MERAR+LA R I+RRLV++ K+ R N+T P+   H P RYVSSL+P    +      +  
Sbjct  1    MERARRLAYRGIVRRLVNDTKRHRNNQTSPSIVPHTPTRYVSSLSPFLPTH-GSINPTIH  59

Query  250  GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
                  +HQQ RSISV+ALKPSDTFPRRHNSATPE+Q+ MA+ CGF  LD+LIDATVP+S
Sbjct  60   RHNHHHNHQQTRSISVDALKPSDTFPRRHNSATPEEQTHMAKHCGFDHLDSLIDATVPKS  119

Query  430  IRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            IRLDSMKF KFD GLTE+QMI HM +LASKNKVFKS+IGMGYYNT VP VILRNI+ENP 
Sbjct  120  IRLDSMKFSKFDGGLTESQMISHMVDLASKNKVFKSFIGMGYYNTHVPTVILRNILENPA  179

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  180  WYTQYTPY  187



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 150/190 (79%), Gaps = 15/190 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  243
            MERAR+LA   IL RLV + K   +  +PA  L  P+RYVSSL+P  C+     + R  +
Sbjct  1    MERARRLA---ILGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCSGTNVRSDRNLN  55

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GFP+LD+LIDATVP
Sbjct  56   GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVP  108

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109  KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  169  PGWYTQYTPY  178



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 149/208 (72%), Gaps = 26/208 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ--------LRANETPAAALHRPARYV------------  192
            MERAR+LANRAIL+RLV+E+KQ             + +   + P+RYV            
Sbjct  1    MERARRLANRAILKRLVNESKQSHKQARNDSSLLNSSSPVSYTPSRYVSSLSSFGSRSPR  60

Query  193  SSLAPCAAMYENQRRYSGA-GAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  369
            S L P      +    +G+ G G      Q RSISVE+LKPSDTFPRRHNSATPE+Q+KM
Sbjct  61   SGLLPGTKNIVSHNVPAGSYGIG-----SQIRSISVESLKPSDTFPRRHNSATPEEQTKM  115

Query  370  AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  549
            AE CGF +LD+LIDATVP+SIRLDSMKF KFD GLTE+QMIEHM  LASKNKVFKSYIGM
Sbjct  116  AELCGFDTLDSLIDATVPKSIRLDSMKFSKFDGGLTESQMIEHMNYLASKNKVFKSYIGM  175

Query  550  GYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  GYYNTHVPPVILRNIMENPAWYTQYTPY  203



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 150/197 (76%), Gaps = 18/197 (9%)
 Frame = +1

Query  73   MERARKLA-NRAILRRLVHEAKQLRANETP----AAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA N++ LRRLV  +   R  + P    +     P+RYVSSL+  + ++ + R 
Sbjct  1    MERARRLAANKSALRRLVSASNHHRQIDPPFFNSSPVSFTPSRYVSSLSN-SFLFRSVRS  59

Query  238  YS-----GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
             S     G G G        RSISVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+
Sbjct  60   DSFLHRNGIGIG-------SRSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDS  112

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            L+DATVP+SIRL SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVI
Sbjct  113  LVDATVPKSIRLQSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVI  172

Query  583  LRNIMENPGWYTQYTPY  633
            LRNIMENP WYTQYTPY
Sbjct  173  LRNIMENPAWYTQYTPY  189



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 141/187 (75%), Gaps = 14/187 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKL NRAILRRLV  +KQ          L+R +RYVSSL P  A+           
Sbjct  1    MERARKLVNRAILRRLVSASKQ--------QPLYRSSRYVSSLPP--ALVPRGSNVVRKA  50

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
              F  +    RSISV+ALKPSDTF RRHNSATPEDQS+MA F GF +LD+LIDATVP+SI
Sbjct  51   HSFTFT----RSISVDALKPSDTFARRHNSATPEDQSRMAGFAGFETLDSLIDATVPKSI  106

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R D M+ P FD GLTE+QM+EHMK+LASKNKVFKSYIGMGYY TFVPPVILRNIMENPGW
Sbjct  107  RADKMELPIFDKGLTESQMLEHMKHLASKNKVFKSYIGMGYYGTFVPPVILRNIMENPGW  166

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  167  YTQYTPY  173



>gb|KDO80091.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>gb|KDO80092.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=985

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>gb|KDO80090.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1049

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 148/190 (78%), Gaps = 15/190 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  243
            MERAR+LA   +L RLV + K   +  +PA  L  P+RYVSSL+P  C      + R  +
Sbjct  1    MERARRLA---MLGRLVSQTKHNPSISSPA--LCSPSRYVSSLSPYVCGGTNVRSDRNLN  55

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP
Sbjct  56   GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVP  108

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109  KSIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  169  PGWYTQYTPY  178



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 149/194 (77%), Gaps = 13/194 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  243
            MERAR+LA R I++RLV+E K+ R  E+   P   +  P+RYVSS++         RR  
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNGESSLLPTTTV-TPSRYVSSVSSFL-----HRRRD  54

Query  244  GAGAGFPAS---HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
             +G+ F  S     Q RSISV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+
Sbjct  55   VSGSAFTTSGRNQHQTRSISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDS  114

Query  415  TVPQSIRLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
            TVP+SIRLDSMKF   FD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRN
Sbjct  115  TVPKSIRLDSMKFSGIFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRN  174

Query  592  IMENPGWYTQYTPY  633
            IMENP WYTQYTPY
Sbjct  175  IMENPAWYTQYTPY  188



>gb|KDO80085.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1016

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAAL-HRPARYVSSLAPCAAMYE--NQRRYS  243
            MERAR+LA R I++RLV++AK+ R  +TP   + H PARYVSSL+P  + +   N    +
Sbjct  1    MERARRLAYRGIVKRLVNDAKRHRNPDTPHVVVPHAPARYVSSLSPFVSTHRSVNPNAAA  60

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
                       Q RSISV+ALKP DTFPRRHNSATP++QS MA+FCG+  +D+L+DATVP
Sbjct  61   AFARHHHHQQHQTRSISVDALKPGDTFPRRHNSATPDEQSFMAKFCGYDHIDSLVDATVP  120

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIRL SMKF KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VP VI+RNI+EN
Sbjct  121  KSIRLGSMKFSKFDDGLTESQMIQHMVDLASKNKVFKSFIGMGYYNTHVPTVIIRNILEN  180

Query  604  PGWYTQYTPY  633
            P WYTQYTPY
Sbjct  181  PAWYTQYTPY  190



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 149/194 (77%), Gaps = 13/194 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  243
            MERAR+LA R I++RLV+E K+ R  E+   P   +  P+RYVSS++         RR  
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNGESSLLPTTTV-TPSRYVSSVSSFL-----HRRRD  54

Query  244  GAGAGFPAS---HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
             +G+ F  S     Q RSISV+ALKPSDTFPRRHNSATP++Q++MA +CGF +L+ LID+
Sbjct  55   VSGSAFTTSGRNQHQTRSISVDALKPSDTFPRRHNSATPDEQAQMANYCGFDNLNTLIDS  114

Query  415  TVPQSIRLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
            TVP+SIRLDSMKF   FD GLTE+QMIEHM +LASKNKVFKS+IGMGYYNT VPPVILRN
Sbjct  115  TVPKSIRLDSMKFSGIFDEGLTESQMIEHMSDLASKNKVFKSFIGMGYYNTHVPPVILRN  174

Query  592  IMENPGWYTQYTPY  633
            IMENP WYTQYTPY
Sbjct  175  IMENPAWYTQYTPY  188



>gb|AGH12214.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=190

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 139/187 (74%), Gaps = 8/187 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            M+RAR+LAN++IL+RL+ ++KQ      P++ +   +    S +          R     
Sbjct  1    MDRARRLANKSILKRLISQSKQ-----HPSSPVLFSSSRYVSSSSSHVWINRNGRSERNL  55

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
             GF +   Q R IS+EALKPSDTF RRHNSAT E+Q+KMAEF GF SLD+LIDATVP+SI
Sbjct  56   NGFWS---QSRFISIEALKPSDTFARRHNSATAEEQTKMAEFVGFSSLDSLIDATVPKSI  112

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R+  MK P+FD GLTE+QMI+HM+ LA+KN+VFKS+IGMGYYNTFVP VILRNIMENPGW
Sbjct  113  RIGKMKLPQFDQGLTESQMIDHMQTLAAKNRVFKSFIGMGYYNTFVPSVILRNIMENPGW  172

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  173  YTQYTPY  179



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGIG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 24/206 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPA------AALHRPARYVSSLAPCAAMYENQR  234
            MERAR+LA+RA L+RLV+E+KQL  N   +      AA + P+RY+SSL+    +  N  
Sbjct  1    MERARRLASRAFLKRLVNESKQLSRNHRESKSSAAAAATYTPSRYLSSLSCAPFVCSNNS  60

Query  235  R-------------YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAE  375
            R              +G G G      Q R ISVEALKPSDTF RRHNSATPEDQ+KM+E
Sbjct  61   RSDLLQSRNMSHHNVNGYGLG-----SQTRGISVEALKPSDTFARRHNSATPEDQAKMSE  115

Query  376  FCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGY  555
              G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IGMGY
Sbjct  116  LVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIGMGY  175

Query  556  YNTFVPPVILRNIMENPGWYTQYTPY  633
            YNT VPPVILRNIMENP WYTQYTPY
Sbjct  176  YNTHVPPVILRNIMENPAWYTQYTPY  201



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 150/197 (76%), Gaps = 17/197 (9%)
 Frame = +1

Query  73   MERARKLA-NRAILRRLVHEAKQLRANETP----AAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA N++ LRRLV  +   R  + P    +     P+RYVSSL+  + ++ + R 
Sbjct  1    MERARRLAANKSALRRLVSASNHHRQIDPPFFNSSPVSFTPSRYVSSLSSNSFLFRSVRS  60

Query  238  YS-----GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDA  402
             S     G G G        RSISVEALKPSDTFPRRHNSATPE+QSKMAE CGF SLD+
Sbjct  61   DSFLHRNGIGIG-------ARSISVEALKPSDTFPRRHNSATPEEQSKMAEVCGFDSLDS  113

Query  403  LIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVI  582
            L+DATVP+SIRL SMKF KFD GLTE+QMIEHM+NLA+KNK+FKSYIGMGYYNTFVPPVI
Sbjct  114  LVDATVPKSIRLQSMKFSKFDEGLTESQMIEHMQNLAAKNKIFKSYIGMGYYNTFVPPVI  173

Query  583  LRNIMENPGWYTQYTPY  633
            LRNIMENP WYTQYTPY
Sbjct  174  LRNIMENPAWYTQYTPY  190



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 142/190 (75%), Gaps = 11/190 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQ---LRANETPAAALHRPARYVSSLAPCAAMYENQRRYS  243
            MERARKLANRAIL+RL+  +KQ    +++    ++L        S         N R   
Sbjct  1    MERARKLANRAILKRLLSSSKQQPLYKSSSRCLSSLSPSVVQCGSNVVSKVHSFNSRN--  58

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
                  P      RSISVEALKPSDTFPRRHNSATPE+Q+KMAEF G+ SLDALIDATVP
Sbjct  59   ------PVQFVGTRSISVEALKPSDTFPRRHNSATPEEQAKMAEFVGYNSLDALIDATVP  112

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIR+D M+FP FD GLTEAQMI+HM++LASKNKVFKSYIGMGYYNTFVPPVILRNIMEN
Sbjct  113  KSIRIDKMEFPIFDEGLTEAQMIQHMQDLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  172

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  173  PGWYTQYTPY  182



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 142/208 (68%), Gaps = 30/208 (14%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYV--------------------  192
            MERAR+LANRAILRRLV EAKQ + NE+    LH     +                    
Sbjct  1    MERARRLANRAILRRLVSEAKQHQKNES---VLHSSTTPILLYSSSRCMSSVSSPVLRSR  57

Query  193  -SSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKM  369
             S          N  R   AGAG        RSISVEAL+PSDTFPRRHNSATPE+QSKM
Sbjct  58   GSKTETLLGRNMNISRSVVAGAG------SARSISVEALQPSDTFPRRHNSATPEEQSKM  111

Query  370  AEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGM  549
            AE  GF SLD+L+DATVP+SIRL  M F KFD GLTE+QMIEHMK+LASKNKVFKSYIGM
Sbjct  112  AESIGFESLDSLVDATVPKSIRLKEMTFGKFDAGLTESQMIEHMKDLASKNKVFKSYIGM  171

Query  550  GYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  172  GYYNTHVPPVILRNIMENPAWYTQYTPY  199



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 15/190 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAP--CAAM-YENQRRYS  243
            MERAR+LA   +L RLV + K        ++AL  P+RYVSSL+P  C+     + R  +
Sbjct  1    MERARRLA---MLGRLVSQTKH--NPSISSSALCSPSRYVSSLSPYVCSGTNVRSDRNLN  55

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF GF +LD+LIDATVP
Sbjct  56   GFGS-------QVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVP  108

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            ++IRLDSMK+ KFD GLTE+QMI HM++LASKNK+FKS+IGMGYYNT VP VILRNIMEN
Sbjct  109  KAIRLDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMEN  168

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  169  PGWYTQYTPY  178



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 147/191 (77%), Gaps = 7/191 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANET---PAAALHRPARYVSSLAPCAAMYENQRRYS  243
            MERAR+LA R I++RLV+E K+ R NE+   P+  +  P+RYVSS        +N     
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNNESSLLPSTTV-TPSRYVSSF--LHRRLDNNTVSV  57

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
              GA    +  Q RSISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L+ LID+TVP
Sbjct  58   VGGAVSGKNQHQTRSISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLNKLIDSTVP  117

Query  424  QSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
            +SIRLDSMKF  KFD GLTE++MI+HM  LASKN+VFKS+IGMGYYNT VP VILRNIME
Sbjct  118  KSIRLDSMKFSGKFDEGLTESEMIKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIME  177

Query  601  NPGWYTQYTPY  633
            NPGWYTQYTPY
Sbjct  178  NPGWYTQYTPY  188



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 141/200 (71%), Gaps = 14/200 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYS---  243
            MERAR+LANRA L+RL+ EAKQ   NE+       P    S      +    + R S   
Sbjct  1    MERARRLANRATLKRLLSEAKQNCKNESTTTTAPLPFSSSSRYVSSVSNSVFRNRGSNVF  60

Query  244  --------GAGAGF--PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPS  393
                    G G GF    S  Q RSI+VEALKPSDTF RRHNSATPE+Q+KMAE CGF  
Sbjct  61   GRNNNVSRGVG-GFHGSGSSTQSRSITVEALKPSDTFARRHNSATPEEQTKMAESCGFDH  119

Query  394  LDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVP  573
            LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKS+IGMGYYNT VP
Sbjct  120  LDSLVDATVPKSIRLKEMKFNKFDEGLTEGQMIEHMKDLASKNKVFKSFIGMGYYNTHVP  179

Query  574  PVILRNIMENPGWYTQYTPY  633
            PVILRNI+ENP WYTQYTPY
Sbjct  180  PVILRNILENPAWYTQYTPY  199



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 147/204 (72%), Gaps = 20/204 (10%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARY--------------VSSLAPC  210
            MERAR+LANRA L+RL+ EAKQ R  E+ +     P  +               S L   
Sbjct  1    MERARRLANRATLKRLLSEAKQNRKTESTSTTTTTPLPFSLSGSSSRYVSSVSNSILRGR  60

Query  211  AAMYENQ--RRYSG-AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFC  381
             +  +N   RR  G  G G+P+   Q RSISVEALKPSDTFPRRHNSATP++Q+KMAE  
Sbjct  61   GSKPDNNVSRRVGGFLGVGYPS---QSRSISVEALKPSDTFPRRHNSATPDEQTKMAESV  117

Query  382  GFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYN  561
            GF +LD+L+DATVP+SIRL  MKF KFD GLTE QMIEHMK+LASKNKVFKS+IGMGYYN
Sbjct  118  GFDTLDSLVDATVPKSIRLKEMKFNKFDGGLTEGQMIEHMKDLASKNKVFKSFIGMGYYN  177

Query  562  TFVPPVILRNIMENPGWYTQYTPY  633
            T VPPVILRNIMENP WYTQYTPY
Sbjct  178  THVPPVILRNIMENPAWYTQYTPY  201



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 145/205 (71%), Gaps = 18/205 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGA-  249
            MERAR+LANRAIL+RLV EAKQ + NE+   +   P    SS    +++     R  G+ 
Sbjct  1    MERARRLANRAILKRLVSEAKQHQKNESVLHSSTTPMLLYSSSRCMSSVSSPALRNRGSK  60

Query  250  -----GAGFPASHQQR------------RSISVEALKPSDTFPRRHNSATPEDQSKMAEF  378
                 G     +   R            RSISVEAL+ SDTFPRRHNSATPE+QSKMAE 
Sbjct  61   TDTLLGRSMNIATMSRGVVGGFLGVGSTRSISVEALQASDTFPRRHNSATPEEQSKMAES  120

Query  379  CGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYY  558
            CGF S+D+L+DATVP+SIRL  MKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYY
Sbjct  121  CGFESIDSLVDATVPKSIRLKEMKFGKFDGGLTESQMIEHMKELASKNKVFKSYIGMGYY  180

Query  559  NTFVPPVILRNIMENPGWYTQYTPY  633
            NT VPPVILRNIMENP WYTQYTPY
Sbjct  181  NTHVPPVILRNIMENPAWYTQYTPY  205



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 8/189 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCA--AMYENQRRYSG  246
            MERAR+LA+RAILRRL+ ++K    ++ PA      +R +SSLAP    A    +R  + 
Sbjct  1    MERARRLASRAILRRLISQSKP---SQPPAP---NASRQLSSLAPAIFPANPAVRRPPAT  54

Query  247  AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
              + F  + +Q RSISVE+L+PSDTFPRRHNSA+P+DQ  MAE CGFPSLDALIDATVP 
Sbjct  55   DYSPFRNAGRQSRSISVESLRPSDTFPRRHNSASPDDQVHMAELCGFPSLDALIDATVPN  114

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIR+ +M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIMENP
Sbjct  115  SIRIPTMALPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIMENP  174

Query  607  GWYTQYTPY  633
            GWYTQYTPY
Sbjct  175  GWYTQYTPY  183



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 145/189 (77%), Gaps = 5/189 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAA--ALHRPARYVSSLAPCAAMYENQRRYSG  246
            MERAR++A+RA+L+RL H  +    N       +L   +RYVS++A  +    + +  SG
Sbjct  1    MERARRIASRALLKRLQHHNRPNNNNGGKKIFDSLSSNSRYVSTMASSSRF--SWKNESG  58

Query  247  AGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
               GF  +  Q RSISV+ALKPSDTF RRHNS  PE++ KMA++CGF + +ALIDATVP+
Sbjct  59   NNVGFGKT-PQNRSISVDALKPSDTFARRHNSINPEEEIKMAQYCGFDNTNALIDATVPK  117

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIR+ SMKF KFD GLTEAQMIEHMKNLASKNK+FKS+IGMGYY+T+VPPVILRNIMENP
Sbjct  118  SIRIQSMKFSKFDEGLTEAQMIEHMKNLASKNKIFKSFIGMGYYDTYVPPVILRNIMENP  177

Query  607  GWYTQYTPY  633
             WYTQYTPY
Sbjct  178  AWYTQYTPY  186



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 143/192 (74%), Gaps = 7/192 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P   +  N  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSPF--LSNNHHR  58

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
                      +H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D T
Sbjct  59   SVNLPKHHHHNHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDT  118

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+ IR+DSMKF KFD GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  119  VPKQIRIDSMKFSKFDGGLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  178

Query  598  ENPGWYTQYTPY  633
            ENP WYTQYTPY
Sbjct  179  ENPAWYTQYTPY  190



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 144/192 (75%), Gaps = 12/192 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            M+RARKLA RAILRRL+ ++K    ++ PAA      R++SSLAP      +  R   A 
Sbjct  1    MDRARKLACRAILRRLISQSKP---SQPPAA---NAPRHLSSLAPSIFPANSATRRHAAA  54

Query  253  AGFP-----ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
               P     ASHQ R  ISVE+L+PSDTFPRRHNSA+P+DQ++MAE CGFPSLD LID T
Sbjct  55   DYSPSPFRNASHQFRW-ISVESLRPSDTFPRRHNSASPDDQARMAELCGFPSLDTLIDTT  113

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+SIR+  M  PKFD GLTE+QM+ HMK LAS NKVFKS+IGMGYYNTFVP VILRNIM
Sbjct  114  VPKSIRIAPMTLPKFDAGLTESQMLAHMKRLASMNKVFKSFIGMGYYNTFVPAVILRNIM  173

Query  598  ENPGWYTQYTPY  633
            ENPGWYTQYTPY
Sbjct  174  ENPGWYTQYTPY  185



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 145/194 (75%), Gaps = 12/194 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H P+RY+SSL+P  +   + R 
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPSRYISSLSPFLSNNHHNRS  60

Query  238  YSGAGAGFPA--SHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  411
             +      P   +H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D
Sbjct  61   VN-----LPKHHNHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVD  115

Query  412  ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
             TVP+ IR+DSMKF KFD GLTE++MI HM  LASKNKVFKS+IGMGYYNT VP VI+RN
Sbjct  116  DTVPKQIRIDSMKFSKFDGGLTESEMIAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRN  175

Query  592  IMENPGWYTQYTPY  633
            I+ENP WYTQYTPY
Sbjct  176  ILENPAWYTQYTPY  189



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   234 bits (598),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 142/193 (74%), Gaps = 11/193 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSS------LAPCAAMYENQR  234
            MERAR+LANRAILRR+V E+K+     + + AL   +    S      L     +  N R
Sbjct  1    MERARRLANRAILRRVVAESKRHLHISSSSPALVDSSSSFRSVSSMSLLRSHLILGSNVR  60

Query  235  RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
              +G+G G      Q RSISVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDA
Sbjct  61   NATGSGVG-----SQLRSISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDA  115

Query  415  TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  594
            TVP+SIR+ SMKF K D GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNI
Sbjct  116  TVPKSIRIGSMKFSKLDEGLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNI  175

Query  595  MENPGWYTQYTPY  633
            MENPGWYTQYTPY
Sbjct  176  MENPGWYTQYTPY  188



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 142/193 (74%), Gaps = 11/193 (6%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSS------LAPCAAMYENQR  234
            MERAR+LANRAILRR+V E+K+     + + AL   +    S      L     +  N R
Sbjct  1    MERARRLANRAILRRVVAESKRHLHISSSSPALVDSSSSFRSVSSMSLLRSHLILGSNVR  60

Query  235  RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
              +G+G G      Q RSISVE+L+PSDTFPRRHNSATP+++S MAE CGF SLDALIDA
Sbjct  61   NATGSGVG-----SQLRSISVESLRPSDTFPRRHNSATPQEESSMAETCGFSSLDALIDA  115

Query  415  TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  594
            TVP+SIR+ SMKF K D GLTE+QMIEHM  LA+KNKV+KS+IGMGYY T VP VILRNI
Sbjct  116  TVPKSIRIGSMKFSKLDEGLTESQMIEHMNQLAAKNKVYKSFIGMGYYGTLVPHVILRNI  175

Query  595  MENPGWYTQYTPY  633
            MENPGWYTQYTPY
Sbjct  176  MENPGWYTQYTPY  188



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANE-----TPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LA R I+RRLV+E+K+ R  E      P+   H PARY+SSL+P   +  N  R
Sbjct  1    MERARRLAYRGIVRRLVNESKRHRNGEITPHHVPSVVPHAPARYISSLSPF--LSNNHHR  58

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
                       H Q RSISV+A+K  DTFPRRHNSATP++Q+ MA++CG+  +D+L+D T
Sbjct  59   SVNLPKHHHHHHNQTRSISVDAVKAGDTFPRRHNSATPDEQAHMAKYCGYDHIDSLVDDT  118

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+ IR+DSMKF KFD GLTE++M+ HM  LASKNKVFKS+IGMGYYNT VP VI+RNI+
Sbjct  119  VPKQIRIDSMKFSKFDGGLTESEMMAHMTELASKNKVFKSFIGMGYYNTHVPTVIIRNIL  178

Query  598  ENPGWYTQYTPY  633
            ENP WYTQYTPY
Sbjct  179  ENPAWYTQYTPY  190



>ref|XP_006858311.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 144/196 (73%), Gaps = 17/196 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA+ AILRRL+HE+K++     P       AR +SSL     ++ +    S   
Sbjct  1    MERARRLASGAILRRLLHESKRVAPQSRPGPG---GARTISSL-----LHPHSPDKSKRS  52

Query  253  AGFPASHQQR-------RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  411
              +   H +R       RSIS EALKPSDTFPRRHNSATPE+Q+KMA+ CGFPSLD+LID
Sbjct  53   DNWLLLHSKRHQHFQYGRSISTEALKPSDTFPRRHNSATPEEQAKMAKTCGFPSLDSLID  112

Query  412  ATVPQSIRLDSMKF--PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            ATVP SIR   M F  P+FD G TE+QM+EHMK L++KNKVFKSYIGMGYYNTFVPPVI+
Sbjct  113  ATVPVSIRGPPMHFSDPRFDAGFTESQMVEHMKRLSAKNKVFKSYIGMGYYNTFVPPVIV  172

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENPGWYTQYTPY
Sbjct  173  RNIMENPGWYTQYTPY  188



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 147/190 (77%), Gaps = 10/190 (5%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA+RAILRR+++++K     +TPA +    +R++SSLAP +    N        
Sbjct  1    MERARRLASRAILRRVMYQSKP---PQTPAPS---ASRHLSSLAP-SVFPANPAVRRPPA  53

Query  253  AGFPA---SHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            A +P    +  Q RSISVE+++PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP
Sbjct  54   ADYPPFRNAGWQSRSISVESMRPSDTFSRRHNSASPDDQVRMAELCGFPSLDALIDATVP  113

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMEN  603
            +SIR+  M  PKFD GLTE+QM+ HMK LAS N+VFKS+IGMGYYNTFVP VILRNIMEN
Sbjct  114  KSIRIPPMALPKFDAGLTESQMLAHMKRLASMNRVFKSFIGMGYYNTFVPAVILRNIMEN  173

Query  604  PGWYTQYTPY  633
            PGWYTQYTPY
Sbjct  174  PGWYTQYTPY  183



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   232 bits (591),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 142/189 (75%), Gaps = 8/189 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA RAILRRL+ ++K    ++ PAA      R++SSLAP     +   R   A 
Sbjct  1    MERARRLACRAILRRLISQSKP---SQPPAA---NAPRHLSSLAPSIFPAKPAARLPAAA  54

Query  253  --AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
              + F  + +Q R ISVE+L+PSDTF RRHNSA+P+DQ +MAE CGFPSLDALIDATVP+
Sbjct  55   DYSSFRNAGRQSRWISVESLRPSDTFARRHNSASPDDQVRMAEVCGFPSLDALIDATVPK  114

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            SIR+  M  PKFD GLTE+QM+ HM  LAS NK FKS+IGMGYYNTFVP VILRNIMENP
Sbjct  115  SIRIPPMTLPKFDAGLTESQMLGHMNRLASMNKAFKSFIGMGYYNTFVPAVILRNIMENP  174

Query  607  GWYTQYTPY  633
            GWYTQYTPY
Sbjct  175  GWYTQYTPY  183



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 142/196 (72%), Gaps = 21/196 (11%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RL+ E K+ R NE+            SSL P +    +   +    
Sbjct  1    MERARRLAYRGIVKRLITETKRHRINES------------SSLLPSSRYVSSVSSFLHRR  48

Query  253  AGFPAS--------HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  408
            + F A+          Q RSISV+ALKPSDTFPRRHNSA+PE+Q++MA++CGF  L  LI
Sbjct  49   SDFTATSGMNQQQLQNQTRSISVDALKPSDTFPRRHNSASPEEQAQMAKYCGFDDLGTLI  108

Query  409  DATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVIL  585
            D+TVP+SIRL SMKF  KFD GLTE+QMI+HM +LASKNKVFKS+IGMGYYNT VPPVIL
Sbjct  109  DSTVPKSIRLGSMKFSEKFDEGLTESQMIKHMSDLASKNKVFKSFIGMGYYNTHVPPVIL  168

Query  586  RNIMENPGWYTQYTPY  633
            RNIMENPGWYTQYTPY
Sbjct  169  RNIMENPGWYTQYTPY  184



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 140/192 (73%), Gaps = 7/192 (4%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAA---ALHRPARYVSSLAPCAAMYENQRRYS  243
            MERAR+LA R I++RLV+E K+ R N   +        P+RYVSS        +N     
Sbjct  1    MERARRLAYRGIVKRLVNETKRHRNNNESSILPPTTVTPSRYVSSF--LHRRLDNTVSVV  58

Query  244  GAGA-GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATV  420
            G    G   +  Q R ISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  LID+TV
Sbjct  59   GGSVPGTGMNQHQTRPISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSKLIDSTV  118

Query  421  PQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            P+SIRL SMKF  KFD GLTE+QMI+HM  LASKN+VFKS+IGMGYYNT VP VILRNIM
Sbjct  119  PKSIRLGSMKFSGKFDEGLTESQMIKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIM  178

Query  598  ENPGWYTQYTPY  633
            ENPGWYTQYTPY
Sbjct  179  ENPGWYTQYTPY  190



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 6/189 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LA R I++RLV+E K+ R N  P+  +  P+RYVSS        +N     G  
Sbjct  1    MERARRLAYRGIVKRLVNETKRHR-NNNPSTTV-TPSRYVSSF--LHRRLDNTVSVVGGS  56

Query  253  AGFPASHQ-QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQS  429
                  +Q Q R ISV+ALKPSDTFPRRHNSATPE+Q++MA++CGF  L  LID+TVP+S
Sbjct  57   VSGTGRNQHQTRPISVDALKPSDTFPRRHNSATPEEQTQMAKYCGFDDLSKLIDSTVPKS  116

Query  430  IRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            IRLDSMKF  KFD GLTE+QM++HM  LASKN+VFKS+IGMGYYNT VP VILRNIMENP
Sbjct  117  IRLDSMKFSGKFDEGLTESQMVKHMSELASKNRVFKSFIGMGYYNTHVPTVILRNIMENP  176

Query  607  GWYTQYTPY  633
            GWYTQYTPY
Sbjct  177  GWYTQYTPY  185



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 135/187 (72%), Gaps = 6/187 (3%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERARKLA+R ILRRL+ +     +  TPA   H  +   SS+ P      N      A 
Sbjct  1    MERARKLASRGILRRLISQTNS--SAPTPATTRHLSSLASSSVFPTG----NSLLRPPAA  54

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            A     + Q RSISV+AL+PSDTFPRRHNSATP+DQS MA  CGF SLDALIDATVP+SI
Sbjct  55   ADSLLRNGQYRSISVDALRPSDTFPRRHNSATPDDQSTMAASCGFGSLDALIDATVPKSI  114

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            R+  MKF KFD GLTE++MI HM  LA+KNKVFKS+IGMGYY+T VP VILRNIMENP W
Sbjct  115  RIPDMKFAKFDGGLTESEMIAHMSRLAAKNKVFKSFIGMGYYDTLVPAVILRNIMENPAW  174

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  175  YTQYTPY  181



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 137/194 (71%), Gaps = 25/194 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPC-------AAMYENQ  231
            MERARKLA++AILRRL+ + +       P+  +    R VSSL P        + + E+ 
Sbjct  1    MERARKLASQAILRRLISQTR-------PSPPMPAATRRVSSLFPATNSLFRPSVLAESM  53

Query  232  RRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALID  411
             R           + Q RSISV+AL+PSDTFPRRHNSATPE+Q  MA  CGF SLDALID
Sbjct  54   LR-----------NGQTRSISVDALRPSDTFPRRHNSATPEEQFTMAASCGFSSLDALID  102

Query  412  ATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRN  591
            ATVP++IR+  ++ PKFD GLTE++MI HM  LA+KNKVFKS+IGMGYYNT VP VILRN
Sbjct  103  ATVPKTIRISDIRLPKFDAGLTESEMIAHMSRLAAKNKVFKSFIGMGYYNTLVPGVILRN  162

Query  592  IMENPGWYTQYTPY  633
            IMENP WYTQYTPY
Sbjct  163  IMENPAWYTQYTPY  176



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 21/187 (11%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LANRAIL+RL+  A         + +L RP        P  ++  + R+ S   
Sbjct  1    MERARRLANRAILKRLISTAGD------NSHSLLRPK-------PENSILGSNRKLS---  44

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
                  +   RSIS+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+LIDATVP+SI
Sbjct  45   -----HYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDSLIDATVPKSI  99

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVILRNIMENP W
Sbjct  100  RLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIMENPAW  159

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  160  YTQYTPY  166



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 21/187 (11%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LANRAIL+RL+  A         + +L RP        P  ++  + R+ S   
Sbjct  1    MERARRLANRAILKRLISTAGD------NSHSLLRPK-------PENSILGSNRKLS---  44

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
                  +   RSIS+ ALKPSD+FPRRHNSAT E+Q+KMA+ CGF +LD+LIDATVP+SI
Sbjct  45   -----HYVPSRSISLAALKPSDSFPRRHNSATSEEQTKMAQTCGFDTLDSLIDATVPKSI  99

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
            RL  M F  F+ GLTE++M+ HM +LASKNK FKSYIGMGYYNT VPPVILRNIMENP W
Sbjct  100  RLSDMSFSVFNEGLTESEMMSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIMENPAW  159

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  160  YTQYTPY  166



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 136/192 (71%), Gaps = 23/192 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAK-----QLRANETPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LAN+AIL+RL+  AK     +  ++ + + +L +P   +           N R+
Sbjct  1    MERARRLANKAILKRLISSAKVNSHSRSLSSISHSFSLPKPENPIG----------NNRK  50

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
             S         +   R IS++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+LIDAT
Sbjct  51   LS--------HNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSLIDAT  102

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVILRNIM
Sbjct  103  VPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIM  162

Query  598  ENPGWYTQYTPY  633
            ENP WYTQYTPY
Sbjct  163  ENPAWYTQYTPY  174



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   213 bits (541),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 136/192 (71%), Gaps = 23/192 (12%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAK-----QLRANETPAAALHRPARYVSSLAPCAAMYENQRR  237
            MERAR+LAN+AIL+RL+  AK     +  ++ + + +L +P   +           N R+
Sbjct  1    MERARRLANKAILKRLISSAKVNSHSRSLSSISHSFSLPKPENPIG----------NNRK  50

Query  238  YSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
             S         +   R IS++ALKPSDTFPRRHNSAT E+QSKMA+ CGF SLD+LIDAT
Sbjct  51   LS--------HNVPSRFISLDALKPSDTFPRRHNSATSEEQSKMAQTCGFDSLDSLIDAT  102

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+SIRL+ M F  F+ GLTE++M  HM +LASKNK FKSYIGMGYYNT VPPVILRNIM
Sbjct  103  VPKSIRLNDMSFSVFNEGLTESEMSSHMNSLASKNKCFKSYIGMGYYNTHVPPVILRNIM  162

Query  598  ENPGWYTQYTPY  633
            ENP WYTQYTPY
Sbjct  163  ENPAWYTQYTPY  174



>gb|AAB97081.1| glycine decarboxylase P subunit [Coffea arabica]
 gb|AAB99846.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
eugenioides]
Length=142

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  328  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  507
            RRHNSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRHNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMQK  60

Query  508  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPY
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPY  102



>gb|AAB99844.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
canephora]
Length=142

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  328  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  507
            RRHNSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRHNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMEK  60

Query  508  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPY
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPY  102



>gb|AAB99845.1| glycine decarboxylase multi-enzyme complex P subunit [Coffea 
congensis]
Length=142

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  328  RRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKN  507
            RR NSATPE+Q KM E CGFPSLD+LIDATVP+SIRLD M F KFD GLTEAQMI+HM+ 
Sbjct  1    RRDNSATPEEQIKMVENCGFPSLDSLIDATVPKSIRLDGMTFSKFDEGLTEAQMIDHMEK  60

Query  508  LASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            LASKNKVFKSYIGMGYYNTFVPPVILRN++ENP WYTQYTPY
Sbjct  61   LASKNKVFKSYIGMGYYNTFVPPVILRNLLENPAWYTQYTPY  102



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   207 bits (526),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 133/188 (71%), Gaps = 14/188 (7%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYSGAG  252
            MERAR+LANRA+LRRL+  +    +  TP+     P+R +S+L P  A     RR   A 
Sbjct  1    MERARRLANRALLRRLLAGSA---STTTPS-----PSRGISTLVPSPAAGSRPRRARPA-  51

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
                  H   R +SV AL+PSDTFPRRHNSA+P +Q+ MA  CGF +LD+LIDATVP +I
Sbjct  52   ----HQHTPSRPVSVSALQPSDTFPRRHNSASPAEQTVMASTCGFNTLDSLIDATVPAAI  107

Query  433  RLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            R   M+F  KFD G TE+QM+EHM +LAS NKV+KS+IGMGYYNT +P VILRN+MENP 
Sbjct  108  RAPPMQFTGKFDAGFTESQMLEHMAHLASMNKVYKSFIGMGYYNTHIPAVILRNLMENPA  167

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  168  WYTQYTPY  175



>gb|AGH12215.1| glycine decarboxylase P protein, partial [Flaveria pringlei]
Length=145

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 14/156 (9%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYEN---QRRYS  243
            MERAR+LAN+AILRRLV + K      TPA  L+ P+RYVSSL+P      N    R  +
Sbjct  1    MERARRLANKAILRRLVSKTKH--NPSTPA--LYSPSRYVSSLSPYICSSRNVRFDRNLN  56

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G G+       Q R+ISVEALKPSDTFPRRHNSATPE+Q+KMAEF G+P+LD+LIDATVP
Sbjct  57   GFGS-------QARTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGYPNLDSLIDATVP  109

Query  424  QSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVF  531
            +SIRL+SMK+PKFD GLTE+QMI HM+ LASKNK+ 
Sbjct  110  KSIRLESMKYPKFDEGLTESQMIAHMQELASKNKIL  145



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 128/193 (66%), Gaps = 25/193 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAA------MYENQR  234
            MERAR+LANRAIL+RLV   K            H  +R +S ++   A      +  N R
Sbjct  1    MERARRLANRAILQRLVSSTKD-----------HSHSRRLSRVSDSFARAKQEKLIGNNR  49

Query  235  RYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDA  414
             +        A + + RSISVEALKPSDTFPRRHNSAT ++   MA+ CGF  L++LIDA
Sbjct  50   HH--------ACNVRSRSISVEALKPSDTFPRRHNSATSDELINMAQTCGFSDLNSLIDA  101

Query  415  TVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNI  594
            T+P SIR   M F  FD GLTEA+M+ HMK+L +KNK FKSYIGMGYY+  VP VILRNI
Sbjct  102  TIPISIRRKEMSFNTFDEGLTEAEMMLHMKSLEAKNKCFKSYIGMGYYDMHVPTVILRNI  161

Query  595  MENPGWYTQYTPY  633
            MENP WYTQYTPY
Sbjct  162  MENPAWYTQYTPY  174



>ref|XP_006371884.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
 gb|ERP49681.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
Length=804

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 136/193 (70%), Gaps = 26/193 (13%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLR---ANETPAAALH-----RPARYVSSLAPCAAMYEN  228
            MERAR+ ANRAIL+RLV+ +KQ      NE+            P+RY+SSL+     + +
Sbjct  1    MERARRPANRAILKRLVNGSKQSHNQAINESSLLNSSSSVSCTPSRYLSSLSS----FGS  56

Query  229  QRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALI  408
             R  SG    FP  ++   S +V A+          ++ATPE+Q+KMAE CGF +LD+LI
Sbjct  57   TRPRSGL---FPG-NENSISHNVAAV----------SAATPEEQTKMAELCGFDTLDSLI  102

Query  409  DATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILR  588
            DATVP+SIRLDSMKF KFD GLTE+QMIEHMK LASKNKVFKSYIGMGYY+T VPPVILR
Sbjct  103  DATVPKSIRLDSMKFSKFDGGLTESQMIEHMKYLASKNKVFKSYIGMGYYDTQVPPVILR  162

Query  589  NIMENPGWYTQYT  627
            NIMENP WYTQYT
Sbjct  163  NIMENPAWYTQYT  175



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 115/155 (74%), Gaps = 9/155 (6%)
 Frame = +1

Query  178  PARYVSSLAPCAAMYENQRRYSGAGAGFPASHQ--QRRSISVEALKPSDTFPRRHNSATP  351
            P+R +S+LAP  A    +RR    GA     HQ  Q R +SV AL+PSDTFPRRHNSATP
Sbjct  28   PSRGISTLAPAPAA-AGKRRPRARGA-----HQYAQGRPVSVSALQPSDTFPRRHNSATP  81

Query  352  EDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKV  528
             +Q+ MA  CGF ++DALIDATVP +IR  +M F  KFD G TE+QMI+HM+ LAS NK 
Sbjct  82   AEQAAMASTCGFDTVDALIDATVPAAIRAPTMHFAGKFDEGFTESQMIDHMQRLASMNKA  141

Query  529  FKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  142  YKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  176



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 131/192 (68%), Gaps = 16/192 (8%)
 Frame = +1

Query  73   MERARKLANRAILRRLVHEAKQLRANETPAAALHRPARYVSSLAPCAAMYENQRRYS---  243
            MERA++     +++RLV +A  +R    P+A    P R  ++L   AA  E +R +    
Sbjct  1    MERAKQ----QVVKRLVQQA--VRRAAAPSA----PVRSGAALR-AAAGNETRRGFGASL  49

Query  244  --GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDAT  417
              G+G G        R+ISVEALKPSDTF RRHNSAT E+Q  MA  CGF  +DA+IDAT
Sbjct  50   LRGSGNGVVQLPLGVRAISVEALKPSDTFQRRHNSATLEEQKAMAGMCGFEDMDAMIDAT  109

Query  418  VPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIM  597
            VP+SIR   +K  K+  GLTE++++ H K+LASKNKV +S+IGMGY++T VP VILRNI+
Sbjct  110  VPKSIRRPDLKLSKYAEGLTESELLAHFKSLASKNKVMRSFIGMGYHDTHVPTVILRNIL  169

Query  598  ENPGWYTQYTPY  633
            ENPGWYTQYTPY
Sbjct  170  ENPGWYTQYTPY  181



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = +1

Query  271  HQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMK  450
            H Q R +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+
Sbjct  53   HTQGRPVSVSALQPSDTFPRRHNSATPAEQAVMASACGFNTLDALIDATVPAAIRAPPMQ  112

Query  451  FP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYT  627
            F  KFD G TE+QM+EHM  L+S NK +KS+IGMGYYNT +P VILRN+MENP WYTQYT
Sbjct  113  FSGKFDAGFTESQMLEHMARLSSMNKAYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYT  172

Query  628  PY  633
            PY
Sbjct  173  PY  174



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 113/159 (71%), Gaps = 17/159 (11%)
 Frame = +1

Query  178  PARYVSSLAPCAAMYENQRRYSGAG----AGFPASHQ--QRRSISVEALKPSDTFPRRHN  339
            P+R +S+LA          +  GAG    A  PA HQ    R +S  AL+PSDTFPRRHN
Sbjct  28   PSRGISTLA----------KAPGAGSRPRAPRPAPHQYTTGRPVSASALQPSDTFPRRHN  77

Query  340  SATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLAS  516
            SATP +Q+ MA  CGF +LDALIDATVP +IR  +M F  KFD G TE+QMI+HM+ LA+
Sbjct  78   SATPAEQAAMASECGFNTLDALIDATVPAAIRAPTMHFSGKFDAGFTESQMIDHMQRLAA  137

Query  517  KNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             NK +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  138  MNKAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  176



>ref|XP_008662474.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  ARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQ  360
            +R +S+L+P       Q+R           H Q R++SV AL+PSDTFPRRHNSATP +Q
Sbjct  32   SRGISTLSPPPPAAGKQQRRCCPPPRGAHQHAQARAVSVSALQPSDTFPRRHNSATPAEQ  91

Query  361  SKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKS  537
              MA  CGF  +DAL+DATVP +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS
Sbjct  92   EAMASACGFGGVDALVDATVPPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKS  151

Query  538  YIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +IGMGYY T VP V+LRN+MENP WYTQYTPY
Sbjct  152  FIGMGYYGTHVPAVVLRNLMENPAWYTQYTPY  183



>gb|AFW56071.1| glycine cleavage complex P-protein [Zea mays]
Length=1097

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = +1

Query  181  ARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQ  360
            +R +S+L+P       Q+R           H Q R++SV AL+PSDTFPRRHNSATP +Q
Sbjct  32   SRGISTLSPPPPAAGKQQRRCCPPPRGAHQHAQARAVSVSALQPSDTFPRRHNSATPAEQ  91

Query  361  SKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKS  537
              MA  CGF  +DAL+DATVP +IR   M+FP +FD G TE+QM++HM+ LAS N+ FKS
Sbjct  92   EAMASACGFGGVDALVDATVPPAIRAPPMRFPGRFDAGFTESQMLDHMRRLASMNRDFKS  151

Query  538  YIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +IGMGYY T VP V+LRN+MENP WYTQYTPY
Sbjct  152  FIGMGYYGTHVPAVVLRNLMENPAWYTQYTPY  183



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 100/127 (79%), Gaps = 3/127 (2%)
 Frame = +1

Query  262  PASHQ--QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR  435
            PA HQ    R +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR
Sbjct  50   PAPHQYTTGRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFNTLDALIDATVPAAIR  109

Query  436  LDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
              +M F  KFD G TE+QMI+HM+ LA+ NK +KS+IGMGYYNT VP VILRN+MENP W
Sbjct  110  APTMHFSGKFDAGFTESQMIDHMQRLAAMNKAYKSFIGMGYYNTHVPAVILRNLMENPAW  169

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  170  YTQYTPY  176



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  462
            R+IS+EALKPSDTF RRHNS T E+Q  MA+ CGF S+DA+IDATVP+SIR   +   K+
Sbjct  22   RTISIEALKPSDTFQRRHNSPTLEEQKMMAQACGFDSMDAMIDATVPKSIRRPDLNLSKY  81

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              GLTE+Q++ H K +ASKNKV KSYIGMGYY+T VP VILRNI+ENPGWYTQYTPY
Sbjct  82   GEGLTESQLLAHFKAMASKNKVMKSYIGMGYYDTHVPTVILRNILENPGWYTQYTPY  138



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-K  459
            R +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+F  K
Sbjct  57   RPVSVSALQPSDTFPRRHNSATPAEQAVMASECGFNTLDALIDATVPAAIRAPPMQFTGK  116

Query  460  FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            FD G TE+QM+EHM +LAS NK +KS+IGMGYYNT +P VILRN+MENP WYTQYTPY
Sbjct  117  FDAGFTESQMLEHMAHLASMNKTYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPY  174



>gb|AAS16361.1| glycine dehydrogenase P protein [Oryza sativa Indica Group]
Length=892

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  456
            RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56   RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  116  RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  174



>ref|NP_001058062.1| Os06g0611900 [Oryza sativa Japonica Group]
 dbj|BAF19976.1| Os06g0611900 [Oryza sativa Japonica Group]
Length=892

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  456
            RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56   RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  116  RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  174



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +1

Query  289  ISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFD  465
            +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF +LDALIDATVP +IR   M+F  KFD
Sbjct  59   VSVSALQPSDTFPRRHNSATPAEQAVMASECGFNTLDALIDATVPAAIRAPPMQFTGKFD  118

Query  466  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             G TE+QM+EHM +LAS NK +KS+IGMGYYNT +P VILRN+MENP WYTQYTPY
Sbjct  119  AGFTESQMLEHMAHLASMNKTYKSFIGMGYYNTHIPAVILRNLMENPAWYTQYTPY  174



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  456
            RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  60   RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  119

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  120  RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  178



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  456
            RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56   RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  116  RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  174



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-  456
            RR +S  AL+PSDTFPRRHNSATP +Q+ MA  CGF ++DALIDATVP +IR   M+F  
Sbjct  56   RRPVSASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSG  115

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +FD G TE++MIEHM+ LA+ N+ +KS+IGMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  116  RFDAGFTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPY  174



>ref|XP_005850088.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
 gb|EFN57986.1| hypothetical protein CHLNCDRAFT_16305, partial [Chlorella variabilis]
Length=324

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKF-P  456
            R ISV+ALKPSD F  RHNS +  ++  MA+ CGFPSLDAL++ATVP +I R D M   P
Sbjct  1    RPISVQALKPSDRFEPRHNSISEAEKQSMAQLCGFPSLDALVEATVPDAIKRTDGMPLGP  60

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            K+  GLTE++ +   K +ASKNKVFKSYIGMGYYNT VPPVILRN++ENPGWYTQYTPY
Sbjct  61   KYHEGLTESEFLAMFKEMASKNKVFKSYIGMGYYNTHVPPVILRNLLENPGWYTQYTPY  119



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +1

Query  277  QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPS-LDALIDATVPQSIRLDSMKF  453
            Q R +SV AL+PSDTFPRRHNSATP +Q+ MA  CGF   LDALIDATVP +IR   M+F
Sbjct  64   QGRPVSVSALQPSDTFPRRHNSATPAEQAAMATTCGFDGGLDALIDATVPAAIRAPPMRF  123

Query  454  P-KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  630
              +FD GLTE+QM++HM+ LAS NK +KS+IGMGYY T VP V+LRN+MENP WYTQYTP
Sbjct  124  SGRFDAGLTESQMLDHMQRLASMNKAYKSFIGMGYYGTHVPGVVLRNLMENPAWYTQYTP  183

Query  631  Y  633
            Y
Sbjct  184  Y  184



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            +GF AS    RSISV AL+PSD F  RHNS TP +   M +  GF SLDALIDATVP++I
Sbjct  59   SGFAAS--GIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAI  116

Query  433  -RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
             R D M   K+  G+TE+Q +E+ K +ASKNKV+KSYIGMGYY T VP VILRN++ENPG
Sbjct  117  VRKDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPG  176

Query  610  WYTQYTPY  633
            WYTQYTPY
Sbjct  177  WYTQYTPY  184



>gb|KIY98368.1| glycine dehydrogenase [Monoraphidium neglectum]
Length=252

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  244  GAGAGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVP  423
            G+    P S    RSIS+ AL+PSD F  RHNS TP +   M    GF S+DALIDATVP
Sbjct  55   GSSNMMPFSVAGVRSISLAALEPSDRFVPRHNSTTPAELDAMVAETGFKSMDALIDATVP  114

Query  424  QSIRL-DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIME  600
              IR  D M   K+  G+ E++ +E+ K +A KNK++KS+IGMGYY T +PPVILRN++E
Sbjct  115  VPIRRSDGMGMGKYTEGMKESEFLEYFKEMAGKNKLYKSFIGMGYYGTHIPPVILRNVLE  174

Query  601  NPGWYTQYTPY  633
            NPGWYTQYTPY
Sbjct  175  NPGWYTQYTPY  185



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  546
            M+E  G  +LD+LIDATVP+SIR+DSMKF KFD GLTE+QMIEHM+ LAS NKV+KS+IG
Sbjct  1    MSELVGLDNLDSLIDATVPKSIRIDSMKFSKFDEGLTESQMIEHMQKLASMNKVYKSFIG  60

Query  547  MGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            MGYYNT VPPVILRNIMENP WYTQYTPY
Sbjct  61   MGYYNTHVPPVILRNIMENPAWYTQYTPY  89



>ref|XP_001420206.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98499.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=976

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPK  459
            R++S EALKP DTF RRHNS T ++ ++M    GF  +DALIDATVP++IRL  +M   +
Sbjct  10   RAVSTEALKPLDTFERRHNSGTTQEVAEMCAVIGFKDIDALIDATVPENIRLKKTMDMGE  69

Query  460  FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +   LTE++ +  MKN+ASKNKVFK+YIG GY+ T VP VILRNI+ENPGWYTQYTPY
Sbjct  70   YTQPLTESEFLTMMKNMASKNKVFKNYIGTGYHGTHVPTVILRNILENPGWYTQYTPY  127



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPK  459
            R+I+VEALKP D+F RRHNSAT +++++MA++ GF S+DAL+DATVP  IR   SM   K
Sbjct  20   RTIAVEALKPLDSFERRHNSATKKEEAEMAKYVGFDSMDALVDATVPSDIRRAGSMDMGK  79

Query  460  FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +   L+E++ +   K++ASKNKVFKSY G GYY T VP VILRN++ENPGWYTQYTPY
Sbjct  80   WTQPLSESEFLSTFKSMASKNKVFKSYQGTGYYGTHVPTVILRNVLENPGWYTQYTPY  137



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (65%), Gaps = 15/156 (10%)
 Frame = +1

Query  169  LHRPARYVSSLAPCAAMYENQRRYSGAGAGFPASHQQRRSISVEALKPSDTFPRRHNSAT  348
            + R AR +  +   A     Q R++ +G  F         I+V+AL PSD F  RHNS +
Sbjct  1    MRRAARLLRGVGQAA-----QSRFAASGVRF---------IAVDALLPSDDFKPRHNSGS  46

Query  349  PEDQSKMAEFCGFPSLDALIDATVPQSI-RLDSMKFPKFDHGLTEAQMIEHMKNLASKNK  525
            P +   M    GF SLDALIDATVP++I R D M   K+  G+TE+Q + + K++A KNK
Sbjct  47   PAEIDAMVNMTGFSSLDALIDATVPKAIVRKDGMDLGKYHEGMTESQFLSYFKSMAGKNK  106

Query  526  VFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            V KS++GMGYY+  VPPVILRN++ENPGWYTQYTPY
Sbjct  107  VLKSFLGMGYYDVHVPPVILRNVLENPGWYTQYTPY  142



>ref|XP_003081763.1| GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mitochondrial 
precursor (Glycine decarboxylase) (ISS), partial [Ostreococcus 
tauri]
Length=880

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +1

Query  265  ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            A+    R++S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP +IRL  
Sbjct  9    ANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPTNIRLPK  68

Query  445  -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+ENPGWYTQ
Sbjct  69   LMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILENPGWYTQ  128

Query  622  YTPY  633
            YTPY
Sbjct  129  YTPY  132



>emb|CEF99477.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
1 [Ostreococcus tauri]
Length=1019

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +1

Query  265  ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            A+    R++S  +LKP DTF RRHNS T E+ ++M +  GF ++DALIDATVP +IRL  
Sbjct  47   ANAMSARNVSAASLKPLDTFERRHNSGTEEEVAEMCKVVGFENIDALIDATVPTNIRLPK  106

Query  445  -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             M   K+   LTE++ +  MK++A KNKV+K+YIG GY+ T VPPVILRNI+ENPGWYTQ
Sbjct  107  LMDMGKYTEPLTESEFLAKMKDIAGKNKVYKTYIGAGYHGTHVPPVILRNILENPGWYTQ  166

Query  622  YTPY  633
            YTPY
Sbjct  167  YTPY  170



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = +1

Query  256  GFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR  435
            GF A+    RSI+ E L+P D+F RRHNSAT E++ +MA++ GF S+DAL+DATVP  IR
Sbjct  65   GF-AAVATTRSIATETLRPLDSFERRHNSATKEEEIEMAKYVGFDSMDALVDATVPTDIR  123

Query  436  -LDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
                M   ++   L+E++ +   K +ASKNKVFKSY G GYY T VPPVILRN++ENPGW
Sbjct  124  RAGEMDMGEWTSPLSESEYLARFKAMASKNKVFKSYQGTGYYGTHVPPVILRNVLENPGW  183

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  184  YTQYTPY  190



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  462
            R+IS+E+L+PSDTF  RHNS TP +  +M    GF SLDALIDATVP SIR + +     
Sbjct  235  RAISIESLQPSDTFEPRHNSITPNEVKEMVGLLGFDSLDALIDATVPASIRREGVMELAN  294

Query  463  DH--GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             H  G+TE+  I+  + LA +NKV  S+IGMGYY T  PPVILRNI+ENPGWYTQYTPY
Sbjct  295  SHPDGITESAFIKEFRALAEQNKVASSHIGMGYYGTITPPVILRNILENPGWYTQYTPY  353



>ref|XP_005649750.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25206.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=1041

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  462
            R ISV+ L+P+D F  RHNS T ++  +M    GF S+  LIDATVP++IR   M   ++
Sbjct  64   RQISVQTLQPTDVFAPRHNSGTEQEVQEMVNLTGFGSMAELIDATVPKAIRRGQMDLGEY  123

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              G TE++ I   K +A KNK+FKSY+GMGYYNT +PPVI RN++ENPGWYTQYTPY
Sbjct  124  TKGYTESEFIAKFKKMAEKNKMFKSYLGMGYYNTHLPPVIQRNLLENPGWYTQYTPY  180



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  543
            MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1    MAEVVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  544  GMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GMGYYNT VPPVILRNIMENPGWYTQYTPY
Sbjct  61   GMGYYNTIVPPVILRNIMENPGWYTQYTPY  90



>ref|XP_007510359.1| glycine dehydrogenase [Bathycoccus prasinos]
 emb|CCO18704.1| glycine dehydrogenase [Bathycoccus prasinos]
Length=1040

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +1

Query  283  RSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD---SMKF  453
            R ISVE+L P DTF RRHNSA+ E+  +MA F GF S+  LIDATVP +I+     ++  
Sbjct  72   RQISVESLGPLDTFERRHNSASKEEAEEMARFVGFKSVRELIDATVPDNIKAPQALNLGS  131

Query  454  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +++ G +E + ++  K +A KNKVFK+Y+G GY+ T VP VILRNI+ENPGWYTQYTPY
Sbjct  132  EEYNRGYSETEFLDMFKKMAGKNKVFKNYLGTGYHGTHVPQVILRNILENPGWYTQYTPY  191



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  543
            MAE  GF S+D L++ATVP+ I+   M  P KF  GLTE+QMI+HMK LA+KNK+ KSYI
Sbjct  1    MAEAVGFSSMDELVEATVPKPIKRGPMSLPGKFHEGLTESQMIDHMKYLAAKNKIAKSYI  60

Query  544  GMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GMGYYNT VPPVILRNIMENPGWYTQYTPY
Sbjct  61   GMGYYNTIVPPVILRNIMENPGWYTQYTPY  90



>gb|EMT12369.1| Glycine dehydrogenase (decarboxylating), mitochondrial [Aegilops 
tauschii]
Length=1027

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  543
            MA  CGF +LDALIDATVP +IR   M+F  KFD G TE+QM++HM +LAS NK +KS+I
Sbjct  1    MASECGFNTLDALIDATVPAAIRAPPMQFTGKFDAGFTESQMLDHMAHLASMNKTYKSFI  60

Query  544  GMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GMGYYNT +P VILRN+MENP WYTQYTPY
Sbjct  61   GMGYYNTHIPAVILRNLMENPAWYTQYTPY  90



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTEAQMIEHMKNLASKNKVFKSYI  543
            MA  CGF +LDALIDATVP +IR   M F  KFD G TE+QMI+HM+ LA+ NK +KS+I
Sbjct  1    MASECGFNTLDALIDATVPAAIRAPQMHFSGKFDAGFTESQMIDHMQRLAAMNKAYKSFI  60

Query  544  GMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            GMGYYNT VP VILRN+MENP WYTQYTPY
Sbjct  61   GMGYYNTHVPGVILRNLMENPAWYTQYTPY  90



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  367  MAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIG  546
            MA  CGF  +DA+IDATVP+SIR   +K  K+  GLTE++++ H K+LASKNKV +S+IG
Sbjct  1    MAGMCGFEDMDAMIDATVPKSIRRPDLKLSKYAEGLTESELLAHFKSLASKNKVMRSFIG  60

Query  547  MGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            MGY++T VP VILRNI+ENPGWYTQYTPY
Sbjct  61   MGYHDTHVPTVILRNILENPGWYTQYTPY  89



>ref|XP_006681352.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77981.1| hypothetical protein BATDEDRAFT_20549 [Batrachochytrium dendrobatidis 
JAM81]
Length=1019

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +1

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            AGF  S   R + S    +P DTF RRH   +  D  KM +  G  SL+AL+  TVP++I
Sbjct  50   AGFSTSIIARSTPS-SIFEPLDTFARRHIGPSSADVQKMCKVVGVDSLEALVAKTVPENI  108

Query  433  RLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGW  612
             + ++   +   GLTE++ +  +K +ASKNKV +SYIGMGY  T  PPVILRNIMENPGW
Sbjct  109  SIQNLT--RLGPGLTESEALAEIKRIASKNKVMRSYIGMGYNGTITPPVILRNIMENPGW  166

Query  613  YTQYTPY  633
            YTQYTPY
Sbjct  167  YTQYTPY  173



>ref|WP_014435168.1| glycine dehydrogenase [Caldilinea aerophila]
 dbj|BAM01948.1| glycine dehydrogenase [decarboxylating] [Caldilinea aerophila 
DSM 14535 = NBRC 104270]
Length=962

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 8/116 (7%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS---MKFPKFD  465
            +E LKP DTFPRRH   +P D  +M E  G  SLDALID  VP  IRL     ++ P+  
Sbjct  7    IELLKPLDTFPRRHLGPSPFDIERMVEVLGVESLDALIDEAVPPQIRLKEPLHLEPPR--  64

Query  466  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               +E++++  +++LAS N+V++S+IGMGYY T  P VI RNI+ENPGWYTQYTPY
Sbjct  65   ---SESEVLAELRSLASHNRVYRSFIGMGYYGTLTPGVIQRNILENPGWYTQYTPY  117



>ref|WP_009768707.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ67914.1| glycine dehydrogenase, decarboxylating [Oscillatoriales cyanobacterium 
JSC-12]
Length=995

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  483
            L  +D+F  RH     ED ++M    G+ +LD LIDATVPQSIRL S    K + G  E 
Sbjct  45   LDYTDSFADRHIGPNQEDIAQMLNVLGYSNLDTLIDATVPQSIRLKSPL--KLEAGKAEY  102

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            Q+++ +K +A +N+VF+SYIGMGY N   PPVI RNI+ENPGWYTQYTPY
Sbjct  103  QLLQELKEIAQENQVFRSYIGMGYSNCITPPVIQRNILENPGWYTQYTPY  152



>gb|ESA20942.1| hypothetical protein GLOINDRAFT_343379 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX62240.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX62241.1| glycine decarboxylase subunit P [Rhizophagus irregularis DAOM 
197198w]
Length=1019

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = +1

Query  253  AGFPASHQQRRS--ISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQ  426
            + FP S ++  S  +  +A  P DTFPRRHN  +  +   M E      ++ L+  TVP 
Sbjct  48   SNFPKSFRKFSSTPLKYDAFSPLDTFPRRHNGPSDTEIKAMLETIDVKDMEELVLKTVPA  107

Query  427  SIRLDSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENP  606
            +IR  S      + GLTE++++E +K +ASKNKV+KSYIGMGY NT VP VILRNI+E+P
Sbjct  108  NIR--SKDALALEEGLTESELMERLKRIASKNKVYKSYIGMGYANTIVPSVILRNILESP  165

Query  607  GWYTQYTPY  633
            GWYTQYTPY
Sbjct  166  GWYTQYTPY  174



>ref|WP_009187084.1| glycine dehydrogenase [Cecembia lonarensis]
 gb|EKB47336.1| Glycine dehydrogenase [Cecembia lonarensis LW9]
Length=965

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            L PS  F  RHN  + E+ S M +  G  S+D LID T+P+SI+LD  +  PK     +E
Sbjct  5    LHPSTKFENRHNGPSQEEISMMLDAIGAASMDELIDQTIPKSIQLDRPLDLPK---AKSE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            A  ++  K LASKNK+FKS+IG+GYY+T VP VILRNI+ENPGWYT YTPY
Sbjct  62   AAFLKDFKILASKNKIFKSFIGLGYYDTLVPGVILRNILENPGWYTAYTPY  112



>gb|KFH65627.1| glycine dehydrogenase [Mortierella verticillata NRRL 6337]
Length=1018

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 76/123 (62%), Gaps = 8/123 (7%)
 Frame = +1

Query  283  RSISVE------ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            RSI  E         P DTF RRHN  +  +  +M    G   +D L   T+P  IR  S
Sbjct  45   RSIHTEKPPARTVFSPLDTFVRRHNGPSQGEIKEMLSAIGLKDMDGLTGKTIPDRIR--S  102

Query  445  MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  624
             +    DHG TE +++E +K +ASKNK+FK+YIGMGY +  VP VILRN+MENPGWYTQY
Sbjct  103  TRALALDHGFTEKEVLERLKYIASKNKLFKNYIGMGYTDVVVPNVILRNVMENPGWYTQY  162

Query  625  TPY  633
            TPY
Sbjct  163  TPY  165



>ref|WP_014772152.1| glycine dehydrogenase [Belliella baltica]
 gb|AFL84161.1| glycine dehydrogenase, decarboxylating [Belliella baltica DSM 
15883]
Length=964

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            L PS  F  RHN ++ ED + M E  G  S+D LID T+P+SI+L   +  P      +E
Sbjct  5    LSPSTKFENRHNGSSQEDVNMMLEKIGAASIDELIDQTIPKSIQLTKPLDLPS---AKSE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            A  ++  K LASKNK+FKS+IG+GYY+T VP VILRN++ENPGWYT YTPY
Sbjct  62   AAFLKEFKTLASKNKIFKSFIGLGYYDTIVPGVILRNVLENPGWYTAYTPY  112



>ref|WP_039830229.1| glycine dehydrogenase, partial [Pandoraea sp. B-6]
Length=300

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  456
            RRS+S   L+  D F  RH    TPE Q+ +AE  G+ S  ALIDA VP SIR D  +F 
Sbjct  11   RRSLS--ELEQRDNFSARHIGPDTPEQQAMLAEL-GYASRAALIDAVVPASIRRDGARFA  67

Query  457  K----FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  624
            +    F    TE+Q +  ++ LAS+N+VFKS+IG GY NTF P VILRN++ENP WYT Y
Sbjct  68   QSLGPFAAAQTESQALAQLRALASQNQVFKSFIGQGYANTFTPGVILRNVLENPAWYTAY  127

Query  625  TPY  633
            TPY
Sbjct  128  TPY  130



>ref|XP_009056743.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
 gb|ESO92602.1| hypothetical protein LOTGIDRAFT_216694 [Lottia gigantea]
Length=1025

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +1

Query  286  SISVEALKPS-DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKF  462
            S ++E + PS D FP RH      ++  M +F G  S+D L+  TVPQ I L+  +    
Sbjct  39   STALEKILPSQDVFPERHIGPNEREKRDMLKFMGLQSIDELVTKTVPQDILLN--RKLDI  96

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            D  L E Q+IEH++ +ASKN++++SYIG+GYYNT+VP  I+RNI ENPGW TQYTPY
Sbjct  97   DQPLGEHQLIEHLRGIASKNEIWRSYIGIGYYNTYVPHTIMRNIFENPGWTTQYTPY  153



>ref|WP_021830956.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ51788.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 8502]
Length=985

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +1

Query  277  QRRSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMK  450
              R+ ++E  L P+D+F  RH     +D  KM +  GF SLD LIDATVPQ IRL  ++ 
Sbjct  15   DNRTYNIENTLAPTDSFINRHIGPNSQDIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLI  74

Query  451  FPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  630
             P+     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTP
Sbjct  75   LPE---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTP  131

Query  631  Y  633
            Y
Sbjct  132  Y  132



>ref|XP_007270989.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJC98691.1| glycine dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=1010

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 77/128 (60%), Gaps = 1/128 (1%)
 Frame = +1

Query  253  AGFPASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSI  432
            AG P+    R        KP DTF  RH      +Q  M    GF S+DA +DA+VP SI
Sbjct  27   AGGPSPSPSRTRAQGSLFKPLDTFTERHIGPNESEQKMMLGALGFESMDAFVDASVPPSI  86

Query  433  RLDSMKFPK-FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPG  609
            RL +        H  +E++++   ++LA KNK FKSYIGMGY+N  VPPVILRNI+ENP 
Sbjct  87   RLPAGTMDDAVIHSFSESELLRRARDLAKKNKPFKSYIGMGYHNAVVPPVILRNIIENPA  146

Query  610  WYTQYTPY  633
            WYT YTPY
Sbjct  147  WYTPYTPY  154



>ref|WP_013030982.1| glycine dehydrogenase [Sideroxydans lithotrophicus]
 gb|ADE13086.1| glycine dehydrogenase [Sideroxydans lithotrophicus ES-1]
Length=949

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  489
            SD F  RHN  + +D   M +    PSLDALID TVP +IRL   +  P    G++E   
Sbjct  2    SDQFVNRHNGPSAQDVQAMLKKIDAPSLDALIDQTVPAAIRLRKPLNLPD---GMSEHAF  58

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++H++ +A+KNK++KSYIG+GYY+T VPP I RN++ENPGWYT YTPY
Sbjct  59   LQHLRGIAAKNKLYKSYIGLGYYDTVVPPAIQRNVLENPGWYTAYTPY  106



>ref|WP_008624248.1| Glycine dehydrogenase [Mariniradius saccharolyticus]
 gb|EMS34672.1| Glycine dehydrogenase [Mariniradius saccharolyticus AK6]
Length=963

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +1

Query  301  ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLT  477
            +L PS  F  RHN  +  + + M E  G  SLD LID T+P+SI+L   M  PK     T
Sbjct  4    SLNPSTRFESRHNGPSASEIAIMLEKIGAASLDELIDQTIPKSIQLGRPMDLPK---AKT  60

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            EA  +   K LASKN++FKS+IG+GYY+T VP VILRNI+ENPGWYT YTPY
Sbjct  61   EASFLREFKKLASKNRIFKSFIGLGYYDTIVPGVILRNILENPGWYTAYTPY  112



>ref|WP_044226980.1| glycine dehydrogenase [Phaeodactylibacter xiamenensis]
 gb|KGE85945.1| glycine dehydrogenase [Phaeodactylibacter xiamenensis]
Length=961

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  492
            D F  RHN  +  D  KM E  G PSLD LID TVP  IRL   M  P+    LTE   +
Sbjct  8    DQFVTRHNGVSNRDLPKMLETIGVPSLDQLIDETVPDKIRLKKEMDLPE---ALTEFDFL  64

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              +K  A+KNKV+K+YIGMGY+ T  P VILRN+ +NPGWYTQYTPY
Sbjct  65   NELKRTAAKNKVYKTYIGMGYHGTITPSVILRNVFQNPGWYTQYTPY  111



>ref|WP_012627655.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
 gb|ACL44578.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
Length=996

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  492
            D F +RH    P D  +M E  G  SLD LID TVP  IRLD  +  P+   G +E++ +
Sbjct  44   DRFAQRHIGPPPHDVQQMVEDLGLDSLDELIDQTVPAPIRLDRPLDLPE---GRSESEAL  100

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            E +K +A +N++F+S+IGMGYY  F PPVI RNI+ENPGWYTQYTPY
Sbjct  101  EMLKTIARQNQIFRSFIGMGYYGCFTPPVIQRNILENPGWYTQYTPY  147



>ref|WP_035493337.1| glycine dehydrogenase, partial [Geitlerinema sp. PCC 7105]
Length=983

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 79/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  301  ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLT  477
            A  P+  F +RHN +TP+D  +M E  G+ S+D+LIDA VP  IRL   +  P+    L+
Sbjct  28   ATPPNLAFVQRHNGSTPQDIDRMLEILGYDSIDSLIDAIVPAQIRLKQPLNLPQ---PLS  84

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            EAQ ++ ++ +A KN++F+S+IG GY+++  PPVI RNI+ENPGWYT YTPY
Sbjct  85   EAQALQQLRAIAQKNQIFRSFIGTGYHDSITPPVIQRNILENPGWYTAYTPY  136



>ref|WP_013294701.1| glycine dehydrogenase [Gallionella capsiferriformans]
 gb|ADL56799.1| glycine dehydrogenase [Gallionella capsiferriformans ES-2]
Length=949

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  489
            +D F  RHN  + +D   M +     SLDALID T+P +IRL S +  P+   GL+E   
Sbjct  3    TDQFVNRHNGPSDKDVQDMLKAIDASSLDALIDQTIPAAIRLKSPLNLPE---GLSEHAY  59

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++H++ +A+KNK++KSYIG+GYY+T +PPVI RN++ENPGWYT YTPY
Sbjct  60   LQHLRGIAAKNKLYKSYIGLGYYDTILPPVIQRNVLENPGWYTAYTPY  107



>ref|WP_018149850.1| glycine dehydrogenase [Leeia oryzae]
Length=957

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  471
            S+  L+  D F RRH   +  DQ+KM    GF S+DAL++A VP +IR D+M  P     
Sbjct  7    SLAELEQHDDFQRRHIGPSRNDQAKMLSTLGFDSIDALMEAIVPANIRRDAMPLPG---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             TEA+++  +K +A +N++FKSYIGMGYY T  P VI RNI+ENP WYT YTPY
Sbjct  64   RTEAEVLAELKEIAGENQIFKSYIGMGYYGTHTPGVIQRNILENPAWYTAYTPY  117



>ref|WP_009032864.1| glycine dehydrogenase [Indibacter alkaliphilus]
Length=965

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            L PS  F +RHN  +P++ ++M +     S+D LID T+P++I+L+  +  PK     TE
Sbjct  5    LTPSTKFEQRHNGPSPQEITEMLDQIQAASIDELIDQTIPKAIQLEKPLDLPK---SKTE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            A  ++  K LASKNK++KS+IG+GYY+T VP VILRNI+ENPGWYT YTPY
Sbjct  62   ASFLKEFKKLASKNKIYKSFIGLGYYDTIVPGVILRNILENPGWYTAYTPY  112



>ref|WP_021833183.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ56429.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0005]
Length=800

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 81/119 (68%), Gaps = 5/119 (4%)
 Frame = +1

Query  283  RSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFP  456
            R+ ++E  L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++  P
Sbjct  17   RTYNIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLILP  76

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPY
Sbjct  77   EAQ---SEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPY  132



>ref|WP_035628774.1| hypothetical protein, partial [Hydrogenovibrio marinus]
Length=123

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            +  L  +D F +RH  +  E Q  M    G+ SL+ L+D  VP+SIR  S        GL
Sbjct  5    IADLMTTDNFSQRHIGSNNEQQQLMLSALGYNSLEQLLDGVVPKSIRRQSEM--ALGEGL  62

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +  +K +AS+N+  KS+IGMG+YNT  PPV+LRN++ENP WYT YTPY
Sbjct  63   SEHDALAKLKAMASQNQTIKSFIGMGFYNTLTPPVVLRNVLENPAWYTAYTPY  115



>ref|WP_002707146.1| glycine dehydrogenase [Thiothrix nivea]
 gb|EIJ33192.1| glycine dehydrogenase (decarboxylating) beta subunit ;glycine 
dehydrogenase (decarboxylating) alpha subunit [Thiothrix nivea 
DSM 5205]
Length=960

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTE  480
            L+  D F  RH   +  D   M +  G  SLDALI++TVP SIRL++   P   D   TE
Sbjct  7    LEQHDDFIARHIGPSDADTQAMLQTVGAESLDALINSTVPASIRLNA---PLAMDGSRTE  63

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             ++++++K LA +NKV KSYIGMGYY+T VPPVILRN++ENPGWYT YTPY
Sbjct  64   TEVLDYLKQLAMQNKVNKSYIGMGYYDTIVPPVILRNVLENPGWYTAYTPY  114



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = +1

Query  277  QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKF  453
             R S +  A+   D F RRH   +  DQ+ M    GF SLDAL DATVP  IRLD  +  
Sbjct  14   DRPSTTTNAIDFVDGFARRHIGPSDRDQAAMLGTLGFDSLDALSDATVPADIRLDEPLDI  73

Query  454  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            P       E + ++ ++ +ASKNKV++S IGMGY  T  PPVILRN++ENPGWYTQYTPY
Sbjct  74   PD---PRGERETLQGLRTIASKNKVYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPY  130



>ref|WP_035827440.1| glycine dehydrogenase [Crocosphaera watsonii]
Length=985

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +1

Query  277  QRRSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMK  450
              R+ ++E  L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL  ++ 
Sbjct  15   DNRTYNIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLSKTLI  74

Query  451  FPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  630
             P+     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTP
Sbjct  75   LPE---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTP  131

Query  631  Y  633
            Y
Sbjct  132  Y  132



>ref|WP_035075932.1| glycine dehydrogenase [Anditalea andensis]
 gb|KEO72890.1| glycine dehydrogenase [Anditalea andensis]
Length=965

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            L+PS  F  RHNS + +  ++M +  G  S++ LID TVP+SIRL+  ++ P      +E
Sbjct  5    LEPSVKFEHRHNSPSEQMVAQMLDKIGASSVEELIDQTVPKSIRLEQPLRLPA---AQSE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            A  +   K LASKNK+FKSYIG+GYY+T VP VILRNI+ENPGWYT YTPY
Sbjct  62   AIFLRDFKKLASKNKIFKSYIGLGYYDTLVPGVILRNILENPGWYTAYTPY  112



>emb|CCQ61793.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0401]
Length=985

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = +1

Query  262  PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD  441
            P ++  R       L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ IRL 
Sbjct  11   PKTNDNRTYDIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIRLS  70

Query  442  -SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  618
             ++  P+     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT
Sbjct  71   KTLILPE---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYT  127

Query  619  QYTPY  633
             YTPY
Sbjct  128  AYTPY  132



>ref|WP_039413576.1| glycine dehydrogenase [Pandoraea pulmonicola]
 gb|AJC23149.1| glycine dehydrogenase [Pandoraea pulmonicola]
Length=972

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 81/126 (64%), Gaps = 8/126 (6%)
 Frame = +1

Query  271  HQQRRSISVEALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSM  447
            HQ RRS++   L+  D F  RH    TPE Q+ +AE  G+ S  ALIDA VP SIR D  
Sbjct  2    HQPRRSLA--ELEQRDNFSARHIGPDTPEQQAMLAEL-GYASRAALIDAVVPASIRRDGK  58

Query  448  KFPK----FDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWY  615
            +F      F    TE+Q +  ++ LA +N+VFKS+IG GYYNTF P VILRN++ENP WY
Sbjct  59   QFAATLGPFAAPKTESQALAQLRELADRNQVFKSFIGQGYYNTFTPGVILRNVLENPAWY  118

Query  616  TQYTPY  633
            T YTPY
Sbjct  119  TAYTPY  124



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEA  483
            K S+ F +RH   + +D  +M E  G P+LDALI+ TVPQ+IRL  S++ P      +E 
Sbjct  22   KSSNNFAQRHIGPSSDDIQQMLEVLGIPNLDALINQTVPQAIRLHQSLQLPTAQ---SEY  78

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              +  +K LA+KN+VF+S+IGMGYY+   PPVI RNI+ENPGWYT YTPY
Sbjct  79   AALAKLKQLATKNQVFRSFIGMGYYDCVTPPVIARNILENPGWYTAYTPY  128



>ref|WP_044145105.1| glycine dehydrogenase, partial [Aphanocapsa montana]
Length=589

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTEAQMI  492
            D F  RHN  + +D  KM +  G  SLD LID TVP  IRL   M  P+    LTE   +
Sbjct  8    DQFVNRHNGVSNKDLPKMLDTIGVRSLDQLIDETVPDKIRLKKEMDLPE---ALTEFDFL  64

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              +K  A+KNKV+K+YIGMGY+ T  P VILRN+ +NPGWYTQYTPY
Sbjct  65   NELKRTAAKNKVYKTYIGMGYHGTITPSVILRNVFQNPGWYTQYTPY  111



>ref|XP_004343370.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97008.1| glycine dehydrogenase [Capsaspora owczarzaki ATCC 30864]
Length=1029

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPE-DQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTE  480
            L+P D+F RRH   T E D   M + C   SL+ LID T+P  IRL   +        +E
Sbjct  78   LEPLDSFERRHIGVTTESDVKTMLDACKVDSLEQLIDKTIPAGIRLH--RELAIGAAQSE  135

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + + + +K++AS+NK+F+SYIGMGYYNT  PPVI RN++ENPGWYTQYTPY
Sbjct  136  STLHKTLKSIASENKIFRSYIGMGYYNTLTPPVIQRNVIENPGWYTQYTPY  186



>ref|WP_008692424.1| glycine dehydrogenase [Rhodopirellula maiorica]
 gb|EMI22017.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=623

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  462
            S +  A+   D F RRH  ++  + ++M +  GF SLDAL DATVP  IRLD+ +  P  
Sbjct  13   STATNAIDFVDGFARRHIGSSETELAEMLKLLGFDSLDALSDATVPADIRLDAPLDIPD-  71

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                 E + ++ +K +ASKNK+++S IGMGY  T  PPVILRN++ENPGWYTQYTPY
Sbjct  72   --PRGERECLQGLKAIASKNKMYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPY  126



>ref|WP_028471416.1| glycine dehydrogenase [Neptunomonas japonica]
Length=960

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = +1

Query  277  QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  456
            ++R++S   L+  + F RRH     EDQ  M E  G  SL+ LI  TVP SIRLD     
Sbjct  2    EKRTLS--ELEQKNDFTRRHIGLQGEDQQAMLESLGVSSLEELITQTVPDSIRLDDAL--  57

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                  TE + + ++K+LA +NKV KSYIGMGY+NT VP VILRN++ENPGWYT YTPY
Sbjct  58   DMADSETEVEALAYLKSLAVQNKVNKSYIGMGYHNTLVPNVILRNVLENPGWYTAYTPY  116



>ref|WP_007096761.1| glycine dehydrogenase [Kordia algicida]
 gb|EDP97713.1| glycine dehydrogenase (decarboxylating), glycine cleavage system 
P-protein [Kordia algicida OT-1]
Length=948

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQM  489
            +D+F  RHN    +D   M +  G  SL+ LID T+P  IRL +++  P+   GL+E + 
Sbjct  3    TDSFSLRHNGTRAKDVPHMLQTIGVDSLEQLIDETIPDEIRLKNALALPE---GLSENEF  59

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + HM+NLA  NK+FKSYIG+GY+    PPVI RNI ENPGWYT YTPY
Sbjct  60   LSHMQNLAGHNKIFKSYIGLGYHEAVTPPVIQRNIFENPGWYTAYTPY  107



>ref|WP_012166094.1| glycine dehydrogenase [Acaryochloris marina]
 gb|ABW30892.1| glycine dehydrogenase [Acaryochloris marina MBIC11017]
Length=984

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP-KFDHGLTE  480
            LKPSDTF  RH   +  D ++M +      L+ALIDA VP  IRL   K P K  H   E
Sbjct  31   LKPSDTFAHRHIGPSESDINQMLDTMNVEDLEALIDAAVPTQIRL---KQPLKLGHERGE  87

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             ++I+ ++++A+KN++F+SYIGMGY     PPVI RNI+ENPGWYTQYTPY
Sbjct  88   YELIQELRSIAAKNQIFRSYIGMGYAGCITPPVIQRNILENPGWYTQYTPY  138



>ref|WP_018476108.1| glycine dehydrogenase [Pontibacter roseus]
Length=972

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +1

Query  307  KPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEA  483
            KP+DTF  RHN    E    M +  G  SLD LI+ TVP +IRL   +  PK    L+E 
Sbjct  6    KPADTFKERHNGPDKEQMQDMLKTIGVDSLDQLIEETVPAAIRLKKPLNLPK---ALSER  62

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              ++    +A +NKV+KSYIG+GY +T +PPVILRNIMENPGWYT YTPY
Sbjct  63   DFLKKFGEIARQNKVYKSYIGLGYNDTIMPPVILRNIMENPGWYTAYTPY  112



>ref|WP_002694452.1| glycine dehydrogenase [Microscilla marina]
 gb|EAY30753.1| glycine dehydrogenase [Microscilla marina ATCC 23134]
Length=969

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQ-SKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKFDHGLT  477
            L+ S+ F +RHNS+  EDQ ++M +  G  S+DALID T+P +IR   ++  P     LT
Sbjct  5    LQYSEKFEQRHNSSATEDQIAEMLKTVGEASVDALIDKTIPAAIRKQQALNLPD---ALT  61

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            E Q +   K LA KNKVF SYIG GYY+  VP VILRN++ENPGWYT YTPY
Sbjct  62   EHQFLAEFKQLAQKNKVFTSYIGQGYYDCIVPNVILRNVLENPGWYTAYTPY  113



>emb|CDS12383.1| hypothetical protein LRAMOSA04578 [Absidia idahoensis var. thermophila]
Length=1015

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  477
            +  KP DTFPRRH      D++ M +  G   +D L+  T+P +IR  S K      G+ 
Sbjct  62   QVFKPLDTFPRRHIGPDDADKAAMLKSIGLKDIDELLSKTIPPAIR--SPKTLALSEGVP  119

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            E ++++ +K++ASKNKV++SYIGMGY +T VP VILRN++ENP WYTQYTPY
Sbjct  120  ERELLKRLKSIASKNKVYRSYIGMGYTDTVVPNVILRNVLENPAWYTQYTPY  171



>emb|CDH56548.1| glycine dehydrogenase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1016

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  477
            +  KP DTFPRRH      D++ M +  G   +D L+  T+P +IR  S K      G+ 
Sbjct  63   QVFKPLDTFPRRHIGPDDADKAAMLKSIGLKDIDELLSKTIPPAIR--SPKALALSEGVP  120

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            E ++++ +K++ASKNKV++SYIGMGY +T VP VILRN++ENP WYTQYTPY
Sbjct  121  ERELLKRLKSIASKNKVYRSYIGMGYTDTVVPNVILRNVLENPAWYTQYTPY  172



>ref|WP_024850811.1| glycine dehydrogenase [Thiomicrospira kuenenii]
Length=950

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            +  L  +D F +RH  +  E Q  M    G+ SL+AL+DA VPQSIR  S       +GL
Sbjct  5    IAGLMKNDDFSQRHIGSNTEQQQAMLSALGYDSLEALLDAIVPQSIRRQSSM--ALGNGL  62

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +E +K++A KN+  KS+IGMG+YNT  PPV+LRN++ENP WYT YTPY
Sbjct  63   SEHDALEKLKSMADKNQSVKSFIGMGFYNTLTPPVVLRNVLENPAWYTAYTPY  115



>ref|WP_039743276.1| glycine dehydrogenase [Hassallia byssoidea]
 gb|KIF35727.1| glycine dehydrogenase [Hassallia byssoidea VB512170]
Length=1019

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 80/124 (65%), Gaps = 7/124 (6%)
 Frame = +1

Query  265  ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  441
            +SH+Q  S   +  + S  FP RH     +D  +M E  G  +LD LID TVPQ+IRL  
Sbjct  10   SSHEQVLS---QTSQKSSNFPERHIGPNCDDIQQMLELLGISNLDTLIDKTVPQAIRLKQ  66

Query  442  SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
            S++ P+    L+E   +  +K +A KN+V++S+IGMGYY+   PPVI RNI+ENPGWYT 
Sbjct  67   SLQLPE---ALSEYAALAKLKQIAVKNEVYRSFIGMGYYDCITPPVIQRNILENPGWYTA  123

Query  622  YTPY  633
            YTPY
Sbjct  124  YTPY  127



>ref|WP_040687253.1| glycine dehydrogenase [Pseudanabaena biceps]
Length=974

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  465
             +S +AL P+D+F RRH   T  +  +M    G  SLD +ID TVP +IR  + +  +  
Sbjct  22   CLSNDALAPTDSFIRRHVGVTSAEIQQMLAVIGCESLDEMIDKTVPNAIR--TRQPLQLG  79

Query  466  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                E ++++ +K +ASKN+V++SYIG GYYN   PP+I RNI+ENPGWYTQYTPY
Sbjct  80   EARGEYELLQELKAIASKNQVWRSYIGTGYYNCITPPIIQRNILENPGWYTQYTPY  135



>ref|WP_044206069.1| glycine dehydrogenase [Coleofasciculus chthonoplastes]
Length=992

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = +1

Query  268  SHQQRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            SH  + ++S  + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+ 
Sbjct  18   SHDSQPTLSAADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNH  77

Query  445  -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             +  P      +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT 
Sbjct  78   PLNLPPAQ---SEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTA  134

Query  622  YTPY  633
            YTPY
Sbjct  135  YTPY  138



>gb|ELS34041.1| Glycine dehydrogenase (decarboxylating) [Pseudanabaena biceps 
PCC 7429]
Length=994

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 2/116 (2%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  465
             +S +AL P+D+F RRH   T  +  +M    G  SLD +ID TVP +IR  + +  +  
Sbjct  42   CLSNDALAPTDSFIRRHVGVTSAEIQQMLAVIGCESLDEMIDKTVPNAIR--TRQPLQLG  99

Query  466  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                E ++++ +K +ASKN+V++SYIG GYYN   PP+I RNI+ENPGWYTQYTPY
Sbjct  100  EARGEYELLQELKAIASKNQVWRSYIGTGYYNCITPPIIQRNILENPGWYTQYTPY  155



>ref|WP_040728598.1| glycine dehydrogenase [Thiomicrospira sp. Kp2]
Length=972

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  471
            ++E L+ S++F +RH      +Q  M +  G  S+D L++  +PQSIR  ++   + ++G
Sbjct  5    TLEELQQSESFVKRHLGPDATEQQAMLDLLGMASIDELLEKVIPQSIRRRALM--ELENG  62

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            LTE Q +  +K +AS+N+V KSYIGMGYYNT  PP I RNI+ENP WYT YTPY
Sbjct  63   LTEHQSLAKLKAIASQNRVLKSYIGMGYYNTHTPPTIQRNILENPAWYTAYTPY  116



>gb|EDX77003.1| glycine dehydrogenase [Coleofasciculus chthonoplastes PCC 7420]
Length=997

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = +1

Query  268  SHQQRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            SH  + ++S  + L  +D+F RRH     ED ++M E  G+ SLD LID  VP  IRL+ 
Sbjct  23   SHDSQPTLSAADHLLSTDSFARRHIGVNAEDVAQMLEALGYSSLDELIDVAVPSIIRLNH  82

Query  445  -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             +  P      +E   + H++++ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT 
Sbjct  83   PLNLPPAQ---SEKAALAHLRDIASKNQVFRSFIGMGYHDCITPPVIQRNILENPGWYTA  139

Query  622  YTPY  633
            YTPY
Sbjct  140  YTPY  143



>ref|WP_009094772.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
 gb|EMI46247.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
Length=990

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +1

Query  277  QRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKF  453
            +  S +  A+   D F RRH   +P + S+M    GF SLDAL DATVP  IRLD  +  
Sbjct  14   ETSSAATNAIDFVDGFSRRHIGPSPTELSEMLSTIGFDSLDALSDATVPADIRLDQPLDI  73

Query  454  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            P+      E + ++ ++ +A KNKV++S IGMGY  T  PPVILRN++ENPGWYTQYTPY
Sbjct  74   PE---PRGERETLQGLRTIAGKNKVYRSCIGMGYTGTVTPPVILRNVLENPGWYTQYTPY  130



>ref|WP_007306344.1| glycine dehydrogenase [Crocosphaera watsonii]
 gb|EAM49945.1| Glycine cleavage system P-protein [Crocosphaera watsonii WH 8501]
Length=985

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 80/121 (66%), Gaps = 5/121 (4%)
 Frame = +1

Query  277  QRRSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMK  450
              R+ ++E  L P+D+F  RH     ++  KM +  GF SLD LIDATVPQ I L  ++ 
Sbjct  15   DNRTYNIENTLAPTDSFINRHIGPNSQEIDKMLKVLGFSSLDKLIDATVPQGIHLSKTLI  74

Query  451  FPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTP  630
             P+     +E   +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTP
Sbjct  75   LPE---AQSEYGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTP  131

Query  631  Y  633
            Y
Sbjct  132  Y  132



>ref|WP_012410110.1| glycine dehydrogenase [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +1

Query  319  TFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMIE  495
            +F  RH     +D  +M +  GFPSLDALID TVPQ+IRL   +K P+ +   +E   + 
Sbjct  25   SFAPRHIGPNSDDIQQMLKVLGFPSLDALIDKTVPQTIRLKQPLKLPEAE---SEYAALA  81

Query  496  HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +K +A+KN+VF+SYIGMGYY+T  P VI RNI+ENPGWYT YTPY
Sbjct  82   SLKKIAAKNQVFRSYIGMGYYDTITPLVIGRNILENPGWYTAYTPY  127



>ref|WP_028946840.1| glycine dehydrogenase [Synechocystis sp. PCC 6714]
 gb|AIE72693.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Synechocystis sp. PCC 6714]
Length=984

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGL  474
            E L P++ F  RH      +Q +M +  GF SL  LID  VPQ+IRL  S+K P      
Sbjct  27   EKLAPAEAFVDRHLGPGEGEQQQMLQELGFQSLGELIDQAVPQAIRLHGSLKLPSPQ---  83

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             E   I  +K++ASKN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPY
Sbjct  84   GEYGAIAQLKSIASKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPY  136



>ref|WP_017294248.1| glycine dehydrogenase [Geminocystis herdmanii]
Length=979

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 7/123 (6%)
 Frame = +1

Query  277  QRRSISVEALKPS---DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-  444
            +   I+   L+PS   DTF  RH       Q  M E  G+ SLD+LID  VP+SIRL + 
Sbjct  14   ENNEIASSRLQPSMMEDTFKHRHLGVDRTAQQLMLETLGYDSLDSLIDTAVPESIRLHNP  73

Query  445  MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  624
            +K P+    LTE Q +  +K++A +NKV++SYIGMGYYN   P VI RNI+ENP WYT Y
Sbjct  74   LKLPQ---PLTETQALNQLKSIAQQNKVYRSYIGMGYYNCITPAVIQRNILENPNWYTAY  130

Query  625  TPY  633
            TPY
Sbjct  131  TPY  133



>ref|WP_019556676.1| glycine dehydrogenase [Thiomicrospira arctica]
Length=973

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = +1

Query  265  ASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-D  441
            A+  Q    S+E L+ SD F  RH     ++Q  M       SL+ L+D  VP SIR  D
Sbjct  4    ATLSQLADCSLEELQQSDKFITRHLGPDDDEQLAMLRSLKMASLNELLDKVVPSSIRRHD  63

Query  442  SMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             M   +   GLTE Q +E +K +ASKN V KSYIGMGYYNTF PP I RNI+ENP WYT 
Sbjct  64   PMDLAE---GLTEQQSLEKLKAIASKNIVLKSYIGMGYYNTFTPPTIQRNILENPAWYTA  120

Query  622  YTPY  633
            YTPY
Sbjct  121  YTPY  124



>ref|WP_035151567.1| glycine dehydrogenase [Calothrix sp. 336/3]
 gb|KFB82829.1| glycine dehydrogenase [Calothrix sp. 336/3]
Length=964

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQM  489
            S  FP RH   + ED  +M +  G  SLD LI  TVPQ IRL  S+  P      +E   
Sbjct  26   SSDFPARHIGVSTEDIPQMLDVLGVASLDDLISKTVPQGIRLAQSLNLPAAK---SEYAA  82

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++H+K +AS+NK+++S+IGMGYY+T  P VILRNI+ENPGWYT YTPY
Sbjct  83   LQHLKEIASQNKIYRSFIGMGYYDTITPTVILRNILENPGWYTAYTPY  130



>ref|WP_019586329.1| glycine dehydrogenase [Deinococcus apachensis]
Length=953

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  483
            L  +D F RRH   +  +Q++M    G  SLD L+++T+P+SIR +     +    +TEA
Sbjct  7    LMQTDEFTRRHIGPSEAEQAEMLAALGVSSLDELVESTLPESIRFEGEL--QVGGPVTEA  64

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            Q +  +K +A+KNKVF+SYIGMGYY T VPPVI RN++ENPGWYT YTPY
Sbjct  65   QALADLKAVAAKNKVFRSYIGMGYYGTHVPPVIGRNMLENPGWYTAYTPY  114



>ref|WP_019499546.1| glycine dehydrogenase [Pseudanabaena sp. PCC 6802]
Length=1041

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 5/117 (4%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS---MKFPKF  462
            S +   P+DTF  RH  + PE+  +M    GF  LDALID  VP SIR      +  P  
Sbjct  34   STDPFVPTDTFVHRHIGSNPEEIQQMLASMGFDDLDALIDKAVPPSIRQKQPLKLGDPGV  93

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              G  E +++E +K +ASKN++ +S+IGMGY+N   PPVI RNI+ENPGWYTQYTPY
Sbjct  94   QRG--ERELLEELKAIASKNQLCRSFIGMGYHNCITPPVIQRNILENPGWYTQYTPY  148



>ref|WP_009544701.1| MULTISPECIES: glycine dehydrogenase [Cyanothece]
 gb|ACB51957.1| glycine cleavage system protein P [Cyanothece sp. ATCC 51142]
Length=985

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  480
            L P+D+F  RH     ++  KM +  GF +L+ LIDATVPQ IRL  S+  P+     +E
Sbjct  25   LAPTDSFINRHIGPNRQEIDKMLKMLGFSTLEQLIDATVPQGIRLSKSLNLPE---AQSE  81

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               +  +K++ASKN++F+SYIGMGY++   PPVI RNI+ENPGWYT YTPY
Sbjct  82   YGALAQLKSIASKNQIFRSYIGMGYHDCITPPVIQRNILENPGWYTAYTPY  132



>ref|WP_028220613.1| glycine dehydrogenase [Burkholderia oxyphila]
Length=987

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFPKF  462
            ++S+ AL+  D F  RH    P DQ  M +  GF S  ALIDA +P +IR  D++    F
Sbjct  16   ALSLAALEAHDAFAARHIGPDPADQQAMLDTLGFASRAALIDAVIPAAIRRKDALPLGPF  75

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                +EA+ I  ++ LA KN+VF+SYIG GYY+T  P VILRN++ENP WYT YTPY
Sbjct  76   GEPRSEAEAIAALRALADKNQVFRSYIGQGYYDTHTPAVILRNVLENPAWYTAYTPY  132



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKF  462
            S+  + L P+D+F RRH    P++  +M E  G PSLDALI+ TVP +IRL   ++ P  
Sbjct  17   SLPGQRLAPADSFVRRHIGPRPDEIRQMLEVLGVPSLDALIEKTVPAAIRLKQPLQLPAA  76

Query  463  DHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
                +E   +  +K +ASKN++F+S+ G GY++   PPVILRNI+ENPGWYT YTPY
Sbjct  77   G---SEYAALAQLKEIASKNEIFRSFTGTGYHDCITPPVILRNILENPGWYTAYTPY  130



>ref|WP_044179699.1| glycine dehydrogenase [Photobacterium damselae]
Length=957

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQMI  492
            +TF  RHN  T E Q  M    G  SLD LID TVP +IRL   ++ PK    + E  ++
Sbjct  11   NTFVNRHNGPTLEQQQTMLAAIGVDSLDQLIDQTVPANIRLPQPLQLPK---AINEEMLL  67

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + +K++A KN + KSYIG GYYNT+ P VILRNI+ENPGWYT YTPY
Sbjct  68   QQLKHIAQKNIINKSYIGQGYYNTYTPSVILRNILENPGWYTAYTPY  114



>gb|KGT34387.1| glycine dehydrogenase, partial [Vibrio parahaemolyticus]
Length=197

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  471
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+  M   +    
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPMTLAE---A  61

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  62   KSEADMLATMKQFAEQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  115



>gb|EVU15264.1| glycine cleavage system P-family protein, partial [Vibrio parahaemolyticus 
V-223/04]
Length=200

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHG  471
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+  M   +    
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPMTLAE---A  61

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  62   KSEADMLATMKQFAKQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  115



>ref|WP_018979919.1| glycine dehydrogenase [Saccharibacter floricola]
Length=963

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = +1

Query  322  FPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIEHM  501
            F RRHN  +P DQ +M    G  SLD L+D  VPQSIR  S+K      G++EA+ +E +
Sbjct  23   FSRRHNGPSPADQQEMLRTLGLESLDELVDQVVPQSIR-PSIKGASIGQGVSEAEALERL  81

Query  502  KNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + +A KN+   S IG GYY+TF+P V++RN+MENP WYT YTPY
Sbjct  82   RRMARKNRPMTSMIGQGYYDTFMPSVVMRNVMENPAWYTAYTPY  125



>ref|WP_027857624.1| glycine dehydrogenase [Marinobacterium jannaschii]
Length=963

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  483
            L+  + F RRH      +Q  M E  G  +LD LI  TVP SIRLD       D G++E+
Sbjct  11   LEQRNEFTRRHVGPDAAEQQAMLETLGVNTLDELIAQTVPDSIRLDDAL--DMDLGISES  68

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              +  ++ +A KN V KSYIGMGYYNT VP VILRN+MENPGWYT YTPY
Sbjct  69   DALAELRAMADKNTVNKSYIGMGYYNTKVPNVILRNVMENPGWYTAYTPY  118



>ref|XP_010875485.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Esox lucius]
Length=1028

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMIE  495
            D F  RH      ++ +M EF G  S+  LI+ TVP+SIR+   +  K D  L E +++E
Sbjct  70   DDFAERHIGPGEREKREMLEFLGLESIAQLIEDTVPESIRIQ--RSMKMDDPLCENEVLE  127

Query  496  HMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            H++ +ASKNKV++SYIGMGYYN  VPPVI RN++EN GW TQYTPY
Sbjct  128  HLQKIASKNKVWRSYIGMGYYNCSVPPVIQRNLLENSGWVTQYTPY  173



>ref|WP_015784226.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
 gb|ACV01421.1| glycine dehydrogenase [Cyanothece sp. PCC 8802]
Length=983

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            L P+D+F  RH     ++  +M +  GF +LD LIDATVP+SIRL   +K P+     +E
Sbjct  25   LAPTDSFINRHIGPNSDEIDQMLKVLGFSTLDQLIDATVPESIRLSQPLKLPEPQ---SE  81

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               +  +K++ASKN++++S+IGMGYY+   PPVI RNI+ENPGWYT YTPY
Sbjct  82   YGALAQLKSIASKNQIYRSFIGMGYYDCITPPVIQRNILENPGWYTAYTPY  132



>ref|WP_025918361.1| glycine dehydrogenase [Herminiimonas sp. CN]
Length=967

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDH  468
            S+  L+  D F  RH   +  +Q  M    G+PS  ALIDA VP  IR  D++    F  
Sbjct  5    SLPQLEARDAFIARHIGPSESEQQAMLAVLGYPSRSALIDAIVPAGIRRKDALPLGPFSE  64

Query  469  GLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +TE   +  +KNLA KN+VFKS IG GYYNTF P VILRN+ ENP WYT YTPY
Sbjct  65   AMTEQAALAKLKNLAGKNRVFKSMIGQGYYNTFTPGVILRNLFENPAWYTAYTPY  119



>ref|WP_010472943.1| glycine dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=984

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  483
            LKPSDTF  RH   +  D ++M +      L+ALIDA VP  IRL       ++ G  E 
Sbjct  31   LKPSDTFAHRHIGPSESDINQMLDTMNVEDLEALIDAAVPAQIRLKQPLKLGYERG--EY  88

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++I+ ++++A+KN++F+SYIGMGY     PPVI RNI+ENPGWYTQYTPY
Sbjct  89   ELIQELRSIAAKNQIFRSYIGMGYAGCITPPVIQRNILENPGWYTQYTPY  138



>gb|AFZ32122.1| Glycine dehydrogenase (decarboxylating) [Gloeocapsa sp. PCC 7428]
Length=979

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            VEA + S +F +RH  + PE+  +M +  G  +LDALID TVPQ+IRL+  +  + +   
Sbjct  16   VEAAQESFSFAQRHIGSKPEEIQQMLDELGLATLDALIDQTVPQAIRLN--RPLQLEPAQ  73

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +  +K +ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPY
Sbjct  74   SEYAALAKLKEIASKNQVFRSFIGMGYHDCVTPPVIQRNILENPGWYTAYTPY  126



>ref|WP_041919296.1| glycine dehydrogenase [Gloeocapsa sp. PCC 7428]
Length=969

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            VEA + S +F +RH  + PE+  +M +  G  +LDALID TVPQ+IRL+  +  + +   
Sbjct  6    VEAAQESFSFAQRHIGSKPEEIQQMLDELGLATLDALIDQTVPQAIRLN--RPLQLEPAQ  63

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +  +K +ASKN+VF+S+IGMGY++   PPVI RNI+ENPGWYT YTPY
Sbjct  64   SEYAALAKLKEIASKNQVFRSFIGMGYHDCVTPPVIQRNILENPGWYTAYTPY  116



>ref|WP_005365623.1| glycine dehydrogenase [Photobacterium angustum]
 gb|EAS66237.1| glycine dehydrogenase [Photobacterium angustum S14]
Length=959

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  471
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  117



>ref|WP_006643852.1| glycine dehydrogenase [Photobacterium sp. SKA34]
 gb|EAR53855.1| glycine dehydrogenase [Photobacterium sp. SKA34]
Length=959

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  471
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  117



>gb|KJG15141.1| glycine dehydrogenase [Photobacterium angustum]
 gb|KJG24771.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  471
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  117



>gb|KJF83041.1| glycine dehydrogenase [Photobacterium damselae subsp. damselae]
 gb|KJG47351.1| glycine dehydrogenase [Photobacterium angustum]
 gb|KJG49422.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  471
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  117



>ref|WP_007581597.1| glycine dehydrogenase [Burkholderia terrae]
 gb|EIN00160.1| glycine dehydrogenase [Burkholderia terrae BS001]
Length=976

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFP  456
            R  +S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P++IR  D++   
Sbjct  12   RTPLSLAALEVHDAFAERHIGPDTADQQSMLEALGFASRAALMDAVIPKTIRRQDALPLG  71

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             F    +EA+ +  ++ LA KN+VF+SYIG GYYNT  P VILRN++ENP WYT YTPY
Sbjct  72   PFAQPKSEAEALAALRELADKNQVFRSYIGQGYYNTHTPAVILRNVLENPAWYTAYTPY  130



>gb|KJG39760.1| glycine dehydrogenase [Photobacterium angustum]
Length=959

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHG  471
            ++AL   + F  RHN     +Q +M E  G  S+D LI  TVP SIRL + M  P+    
Sbjct  7    LQALSDDNDFSHRHNGPNALEQQRMLETIGVGSIDQLIAQTVPASIRLTEPMTLPQ---A  63

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +EA M+  +K +A KN + KSYIG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  64   QSEAAMLAELKQIAGKNIINKSYIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  117



>gb|EJK45128.1| hypothetical protein THAOC_36273 [Thalassiosira oceanica]
Length=1020

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLT  477
            +AL  +DTF RRH     ED   M +  GF S ++L+++TVP +I   S K    +  L+
Sbjct  41   DALDMADTFSRRHLGPAEEDTKVMLQSIGFDSFESLVNSTVPANIL--SGKELNLEPALS  98

Query  478  EAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            E + ++ +K++A KN V KSYIGMGYY+T VP VILRN++ENPGWYT YTPY
Sbjct  99   ETEALKRIKSMADKNTVMKSYIGMGYYDTIVPNVILRNMLENPGWYTAYTPY  150



>ref|WP_028981454.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGLTE  480
            L     F  RH   +  DQ +M +  G  SLD LI+ T+P+SIRL   +  P+    LTE
Sbjct  5    LNQKSGFNERHIGPSKNDQKEMLDLIGVKSLDQLINETIPESIRLKKELSLPE---PLTE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             + ++H   LA++NK+FKSYIG+GYY    PPVILRNI+ENPGWYT YTPY
Sbjct  62   FEFLKHFGALANENKIFKSYIGLGYYACITPPVILRNILENPGWYTAYTPY  112



>ref|WP_012402353.1| glycine dehydrogenase [Burkholderia phymatum]
 gb|ACC72175.1| glycine dehydrogenase [Burkholderia phymatum STM815]
Length=976

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFP  456
            R  +S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +PQ+IR  D++   
Sbjct  12   RTPLSLAALEVHDAFAERHIGPDGADQQSMLEALGFASRAALMDAVIPQAIRRQDALPLG  71

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             F    +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPY
Sbjct  72   PFGQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPAVILRNVLENPAWYTAYTPY  130



>ref|WP_017772230.1| glycine dehydrogenase [Burkholderia kururiensis]
Length=983

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = +1

Query  262  PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-L  438
            P     R  +S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P++IR  
Sbjct  6    PDHLMNRTPLSLAALEVHDAFAERHIGPDAAGQQAMLDALGFASRAALIDAVIPKAIRRA  65

Query  439  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  618
            D +    F   L+EA+ +  ++ LA+KN+VF++YIG GYYN   PPVILRN++ENP WYT
Sbjct  66   DPLPLGPFAQPLSEAEALAALRELANKNQVFRTYIGQGYYNAHTPPVILRNVLENPAWYT  125

Query  619  QYTPY  633
             YTPY
Sbjct  126  AYTPY  130



>ref|WP_042302959.1| glycine dehydrogenase [Burkholderia kururiensis]
Length=983

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = +1

Query  262  PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-L  438
            P     R  +S+ AL+  D F  RH       Q  M +  GF S  ALIDA +P++IR  
Sbjct  6    PDHLMNRTPLSLAALEVHDAFAERHIGPDAAGQQAMLDALGFASRAALIDAVIPKAIRRA  65

Query  439  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  618
            D +    F   L+EA+ +  ++ LA+KN+VF++YIG GYYN   PPVILRN++ENP WYT
Sbjct  66   DPLPLGPFAQPLSEAEALAALRELANKNQVFRTYIGQGYYNAHTPPVILRNVLENPAWYT  125

Query  619  QYTPY  633
             YTPY
Sbjct  126  AYTPY  130



>ref|WP_031817094.1| glycine dehydrogenase, partial [Vibrio parahaemolyticus]
Length=224

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            +++L   + F  RHN     DQ KM E     SLDALI  TVP +IRL+           
Sbjct  5    LQSLSTQNEFVGRHNGPKLSDQQKMLEAINAVSLDALISETVPANIRLEQPM--TLAEAK  62

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +EA M+  MK  A +N+V +++IG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  63   SEADMLATMKQFAEQNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  115



>ref|WP_044451621.1| glycine dehydrogenase, partial [Mastigocladus laminosus]
 gb|KIY11150.1| glycine dehydrogenase, partial [Mastigocladus laminosus UU774]
Length=736

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  474
            E+ + S  F +RH     +D  +M +  G  S+DALI+ TVPQSIRL  ++  P+    L
Sbjct  18   ESTEKSSDFKQRHIGPNADDMQQMLDLLGVSSVDALINQTVPQSIRLSRALNLPE---AL  74

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +  +K++A KN++F+S+IGMGYY+T  P VI RNI+ENPGWYT YTPY
Sbjct  75   SEYAAVAKLKDIALKNQIFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPY  127



>dbj|GAL17115.1| glycine dehydrogenase [Vibrio maritimus]
Length=298

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 70/113 (62%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  VEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGL  474
            + +L   + F  RHN     DQ KM +     +LD LID TVP  IRL+  +    D  +
Sbjct  5    LNSLSTQNEFVARHNGPNKSDQQKMLDAINVLNLDTLIDETVPAQIRLE--QPMTLDAPM  62

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +EA M+  MK  A  N+V +++IG GYYNTF P VILRN++ENPGWYT YTPY
Sbjct  63   SEADMLVEMKKFADLNQVKRTFIGQGYYNTFTPNVILRNVLENPGWYTAYTPY  115



>ref|WP_044106198.1| glycine dehydrogenase [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17488.1| glycine dehydrogenase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=984

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTE  480
            LK +D+F +RH  A  E+  +M +  GF +L+ LI+AT+P+SIR+   +K P      +E
Sbjct  25   LKTTDSFVKRHIGANKEEIKQMLKVLGFSTLEQLIEATIPKSIRMSQPLKLPASQ---SE  81

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               +  +K++ASKN++++S+IGMGYY++  PPVI RNI+ENPGWYT YTPY
Sbjct  82   YAALVQLKSIASKNQIYRSFIGMGYYDSITPPVIQRNILENPGWYTAYTPY  132



>ref|WP_039366657.1| glycine dehydrogenase [Pandoraea pnomenusa]
 gb|KHQ96797.1| glycine dehydrogenase [Pandoraea pnomenusa]
 gb|KHS00128.1| glycine dehydrogenase [Pandoraea pnomenusa]
Length=972

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 8/123 (7%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRH-NSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFP  456
            RRS++   L+  D F  RH    TPE Q+ +AE  G+ S  ALIDA VP SIR DS +F 
Sbjct  8    RRSLA--ELEQRDNFSARHIGPDTPEQQAMLAEL-GYASRAALIDAVVPASIRRDSGQFA  64

Query  457  ----KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQY  624
                +F    TE+Q +  ++ LA +N+VFKS+IG GY+NTF P VILRN++ENP WYT Y
Sbjct  65   TSLGQFAAPKTESQALAQLRALADQNQVFKSFIGQGYFNTFTPGVILRNVLENPAWYTAY  124

Query  625  TPY  633
            TPY
Sbjct  125  TPY  127



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGL  474
            E+ + S  F  RH     +D  +M    G  SLDALID TVPQSIRL   +K P+    L
Sbjct  18   ESTQKSSNFKERHIGPNADDIQQMLAVLGISSLDALIDQTVPQSIRLSRPLKLPE---AL  74

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +E   +  +K +A KN+VF+S+IGMGYY+T  P VI RNI+ENPGWYT YTPY
Sbjct  75   SEYAALTKLKEIALKNQVFRSFIGMGYYDTITPAVIQRNILENPGWYTAYTPY  127



>ref|WP_037439120.1| glycine dehydrogenase [Shewanella sp. YQH10]
 gb|KFZ39174.1| glycine dehydrogenase [Shewanella sp. YQH10]
Length=962

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEA  483
            L+  D F RRH  +  E Q +M  + G  SL+ L    VP +IRL   +    D   TEA
Sbjct  9    LEQHDLFIRRHIGSDAEQQHQMLNYVGADSLEDLTAQIVPGAIRLG--RELALDDSCTEA  66

Query  484  QMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              IE+++ +A KN+VFKSYIGMGYY T VP VILRN++ENPGWYT YTPY
Sbjct  67   AGIEYLREIADKNQVFKSYIGMGYYGTEVPNVILRNVLENPGWYTAYTPY  116



>ref|XP_008334077.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Cynoglossus semilaevis]
Length=610

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +1

Query  295  VEALKP-SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  471
            +E++ P  D F  RH      ++ +M +  GF S+D LID TVP SIRL      K D  
Sbjct  63   IESIFPRHDDFSERHIGPGEREKKEMLDLLGFKSIDQLIDKTVPSSIRLQGNM--KMDDP  120

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + E +++E ++ +ASKNK++KSYIGMGYYN  VPP I RN++EN GW TQYTPY
Sbjct  121  VCENEVLETLQKIASKNKLWKSYIGMGYYNCSVPPPIQRNLLENSGWVTQYTPY  174



>ref|WP_020402760.1| glycine dehydrogenase [Gracilimonas tropica]
Length=964

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQMI  492
            + F  RHN    E   KM E     SLD LID T+P+ IRL+  ++ P     L+EA  +
Sbjct  8    EVFAHRHNGPNSESIKKMLEVIKADSLDKLIDETIPEGIRLEKPLELPD---SLSEADFL  64

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               K LAS+NK+FKS+IGMGYY+T +P VI RNI+ENPGWYT YTPY
Sbjct  65   AEFKKLASRNKIFKSFIGMGYYDTLMPNVIKRNILENPGWYTAYTPY  111



>ref|WP_015137299.1| glycine dehydrogenase, decarboxylating [Nostoc sp. PCC 7524]
 gb|AFY46843.1| glycine dehydrogenase, decarboxylating [Nostoc sp. PCC 7524]
Length=981

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 75/113 (66%), Gaps = 4/113 (4%)
 Frame = +1

Query  298  EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLD-SMKFPKFDHGL  474
            ++L     F +RH   + ED  +M E  G  SLD  ID TVP +IRL+ S++ P+     
Sbjct  22   QSLDKQYNFIQRHIGPSSEDIQQMLEVLGLSSLDDFIDKTVPTAIRLNQSLQLPEAQ---  78

Query  475  TEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            TE   +  ++ +A+KN+VF+SYIGMGYY+T  PPVI RNI+ENPGWYT YTPY
Sbjct  79   TEYAALAKLQQIATKNQVFRSYIGMGYYDTITPPVIQRNILENPGWYTAYTPY  131



>ref|WP_005304561.1| glycine dehydrogenase [Photobacterium damselae]
 gb|EEZ39485.1| glycine dehydrogenase [decarboxylating] [Photobacterium damselae 
subsp. damselae CIP 102761]
Length=957

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  DTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTEAQMI  492
            +TF  RHN  T E Q  M    G  +LD LID TVP +IRL   ++ PK    + E  ++
Sbjct  11   NTFVNRHNGPTLEQQQTMLAAIGVDNLDQLIDQTVPANIRLPQPLQLPK---AINEEMLL  67

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            + +K++A KN + KSYIG GYYNT+ P VILRNI+ENPGWYT YTPY
Sbjct  68   QQLKHIAQKNIINKSYIGQGYYNTYTPSVILRNILENPGWYTAYTPY  114



>ref|XP_007339769.1| glycine dehydrogenase [Auricularia delicata TFB-10046 SS5]
 gb|EJD51925.1| glycine dehydrogenase [Auricularia delicata TFB-10046 SS5]
Length=1011

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +1

Query  310  PSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG-LTEAQ  486
            P DTF  RH      + +KM +  G+ S+DA +  TVPQ IR+ +          LTE++
Sbjct  60   PLDTFVGRHIGPDAHEAAKMLQRLGYDSMDAFVADTVPQHIRIAAAAVSNESIAPLTESE  119

Query  487  MIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +++  K LA++NKVF+SYIGMGY+N  VPPVILRNI+ENP WYT YTPY
Sbjct  120  LLDRAKELAAQNKVFRSYIGMGYHNAVVPPVILRNILENPAWYTPYTPY  168



>ref|WP_015157279.1| glycine dehydrogenase subunit alpha/beta [Chroococcidiopsis thermalis]
 gb|AFY90741.1| glycine dehydrogenase (decarboxylating) beta subunit, glycine 
dehydrogenase (decarboxylating) alpha subunit [Chroococcidiopsis 
thermalis PCC 7203]
Length=988

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = +1

Query  274  QQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  453
            +Q++ IS E++    +F +RH    P +  +M E  G P+LDALID TVPQ+IR    + 
Sbjct  12   RQQKQISSESI----SFRQRHIGPQPIEVEQMLEVLGLPTLDALIDRTVPQAIR--QQRS  65

Query  454  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             + +   +E   +  +K +ASKN+VF+S+IGMGYY    PPVI RNI+ENPGWYT YTPY
Sbjct  66   LQLEGDRSEHAALAQLKAIASKNQVFRSFIGMGYYGCITPPVIQRNILENPGWYTAYTPY  125



>ref|XP_002182636.1| glycine decarboxylase p- protein [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC45923.1| glycine decarboxylase p- protein [Phaeodactylum tricornutum CCAP 
1055/1]
Length=1005

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = +1

Query  286  SISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFD  465
            ++  +AL   DTF RRH   +PED   M    GF S + LI +TVP +I   S +    +
Sbjct  25   AVFADALDMKDTFARRHVGPSPEDSKSMLATIGFDSFEGLIKSTVPPNIL--SPRDLALE  82

Query  466  HGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
               TE++ +  +K +A KNKV KSYIG GYY+T VPPVILRN++ENPGWYT YTPY
Sbjct  83   PARTESEALHRIKEMAKKNKVMKSYIGAGYYDTQVPPVILRNMLENPGWYTAYTPY  138



>ref|WP_028364014.1| glycine dehydrogenase [Burkholderia sp. UYPR1.413]
Length=976

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 75/125 (60%), Gaps = 1/125 (1%)
 Frame = +1

Query  262  PASHQQRRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-L  438
            P     R  +S+ AL+  D F  RH      DQ  M E  GF S  AL+DA +P+SIR  
Sbjct  6    PDRLMNRTPLSLAALEVHDAFAERHIGPDGADQQSMLEALGFASRAALMDAVIPKSIRRQ  65

Query  439  DSMKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYT  618
            D++    F    +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT
Sbjct  66   DALPLGPFGQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYT  125

Query  619  QYTPY  633
             YTPY
Sbjct  126  AYTPY  130



>ref|XP_004991539.1| glycine decarboxylase multi-enzyme complex P subunit [Salpingoeca 
rosetta]
 gb|EGD76625.1| glycine decarboxylase multi-enzyme complex P subunit [Salpingoeca 
rosetta]
Length=982

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = +1

Query  277  QRRSISV-EALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKF  453
            Q R + V + ++P D F  RH    P +   M   C F  LD +I   VP+ IRL   + 
Sbjct  23   QTRHLRVPDWVEPCDKFLFRHIGPDPAEIQTMLRTCSFEDLDDMIAKAVPEDIRL--RRT  80

Query  454  PKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            P  D  LTE++++E +K L S+N+VF+SYIGMGYY T  P  I RN++ENPGWYT YTPY
Sbjct  81   PHLDEPLTESEVLERLKQLGSRNQVFRSYIGMGYYGTLTPTAIKRNVLENPGWYTPYTPY  140



>ref|WP_034341915.1| glycine dehydrogenase [Deinococcus misasensis]
Length=964

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (65%), Gaps = 2/114 (2%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  471
            S+++L   D F  RH   +  +  +M    G  SL+ L+D+T+P+SIR +     K    
Sbjct  5    SLQSLTQQDDFISRHLGPSEHEIQEMLSTLGVNSLEELVDSTLPESIRFNGEL--KVGRT  62

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             TE + +  +K+ ASKNKVFKSYIGMGYY T VP VILRNI+ENPGWYT YTPY
Sbjct  63   FTEVEALADLKSKASKNKVFKSYIGMGYYGTLVPNVILRNILENPGWYTAYTPY  116



>ref|WP_029991321.1| glycine dehydrogenase [Tatumella ptyseos]
 gb|KFD17231.1| glycine dehydrogenase [Tatumella ptyseos ATCC 33301]
Length=957

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +1

Query  292  SVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHG  471
            ++  L+  + F  RH   +P+ Q KM +  G  SL ALIDA VPQ IRL   + P     
Sbjct  4    TLSQLENQNEFIARHIGPSPQQQEKMLQTIGAGSLPALIDAIVPQDIRLP--ELPAVGEA  61

Query  472  LTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            +TE Q +  +K +A +NK FKS+IGMGY     PPVILRN++ENPGWYT YTPY
Sbjct  62   ITEQQALAELKAIAGRNKRFKSWIGMGYSAVITPPVILRNLLENPGWYTAYTPY  115



>dbj|GAL84002.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTE  480
            L     F  RH   +  DQ +M +  G  +LD LI+ T+P+SIRL + +  P+    LTE
Sbjct  5    LNQKSGFNERHIGPSKNDQKEMLDLIGVKNLDQLINETIPESIRLKNDLNLPE---PLTE  61

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             + ++H  +LA++NK++KSYIG+GYY    PPVILRNI+ENPGWYT YTPY
Sbjct  62   FEFLKHFGSLANENKIYKSYIGLGYYACITPPVILRNILENPGWYTAYTPY  112



>dbj|BAH37805.1| glycine dehydrogenase [Gemmatimonas aurantiaca T-27]
Length=965

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 2/107 (2%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDSMKFPKFDHGLTEAQMI  492
             D+F  RH   +  DQ  M    G+P+LDA IDA VP++IR  S      +   TEA+++
Sbjct  15   GDSFIPRHVGPSAADQQAMLSTLGYPTLDAFIDAVVPEAIRFRSTLQTGAEQ--TEAEVL  72

Query  493  EHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
              ++ +AS+N+V++SYIGMGYY T  P VILRNIMENP WYT YTPY
Sbjct  73   ASLRQIASRNRVYRSYIGMGYYGTHTPNVILRNIMENPAWYTAYTPY  119



>ref|WP_010415806.1| glycine dehydrogenase [Leptospira inadai]
 gb|EQA34745.1| glycine dehydrogenase [Leptospira inadai serovar Lyme str. 10]
Length=963

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +1

Query  304  LKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRL-DSMKFPKFDHGLTE  480
            L P DTF RRH    PE    M    G PSLD L+  ++P+ IRL  S+  P+     TE
Sbjct  18   LSPLDTFLRRHVGPDPEQTKNMLSLLGLPSLDELVAKSIPEGIRLLQSLNLPEPS---TE  74

Query  481  AQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             +++E +K +ASKNK+F+SYIG GY  + +P VI RNI+ENPGWYT YTPY
Sbjct  75   RKILEDLKGIASKNKIFRSYIGAGYQGSVLPYVIQRNILENPGWYTAYTPY  125



>ref|WP_015145532.1| glycine dehydrogenase, decarboxylating [Pleurocapsa minor]
 gb|AFY79234.1| glycine dehydrogenase, decarboxylating [Pleurocapsa sp. PCC 7327]
Length=987

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = +1

Query  268  SHQQRRSISVE-ALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS  444
            ++Q+++ +S E +L P+D+F +RH   +P +  +M E  GF SL+ L++ TVP +IRL  
Sbjct  12   TNQRQQPLSPETSLAPTDSFVKRHIGPSPNEIEQMLEVLGFSSLEQLVEKTVPAAIRLAQ  71

Query  445  -MKFPKFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQ  621
             ++ P+     +E   +  +K++ASKN++F+SYIGMGYY+   P VI RNI+ENPGWYT 
Sbjct  72   PLQLPEAQ---SEYAALAQLKSIASKNEIFRSYIGMGYYDCITPSVIERNILENPGWYTA  128

Query  622  YTPY  633
            YTPY
Sbjct  129  YTPY  132



>ref|WP_013340914.1| glycine dehydrogenase [Burkholderia sp. CCGE1003]
 gb|ADN59370.1| glycine dehydrogenase [Burkholderia sp. CCGE1003]
Length=978

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  RRSISVEALKPSDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIR-LDSMKFP  456
            R  +S+ AL+  D F  RH      DQ  M E  GF S  ALIDA +PQ+IR  + +   
Sbjct  12   RTPLSLAALEVHDAFAERHIGPDSADQQAMLEALGFASRAALIDAVIPQTIRRTEPLPLG  71

Query  457  KFDHGLTEAQMIEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
             F    +EA+ +  ++ LA KN+VF+SYIG GYYN   P VILRN++ENP WYT YTPY
Sbjct  72   PFAQPKSEAEALAALRELADKNQVFRSYIGQGYYNAHTPTVILRNVLENPAWYTAYTPY  130



>ref|WP_042347795.1| glycine dehydrogenase [Capnocytophaga canimorsus]
 emb|CEN45004.1| glycine decarboxylase, PLP-dependent, subunit (protein P) of 
glycine cleavage complex [Capnocytophaga canimorsus]
Length=948

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  489
            ++ F  RH   + ED ++M +  G  SLD LID T+P+ IRL S +  PK   G++E   
Sbjct  3    TENFSIRHIGISKEDAAEMLQTIGAASLDQLIDQTIPKDIRLKSALNLPK---GISEHHF  59

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++H+  LA KNK+FKSYIG+GY+    P VI RNI ENPGWYT YTPY
Sbjct  60   LQHITELAQKNKIFKSYIGLGYHEALTPSVIKRNIFENPGWYTAYTPY  107



>ref|WP_042343522.1| glycine dehydrogenase [Capnocytophaga canimorsus]
 emb|CEN44215.1| glycine decarboxylase, PLP-dependent, subunit (protein P) of 
glycine cleavage complex [Capnocytophaga canimorsus]
Length=948

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SDTFPRRHNSATPEDQSKMAEFCGFPSLDALIDATVPQSIRLDS-MKFPKFDHGLTEAQM  489
            ++ F  RH   + ED ++M +  G  SLD LID T+P+ IRL S +  PK   G++E   
Sbjct  3    TENFSIRHIGISKEDAAEMLQTIGAASLDQLIDQTIPKDIRLKSALNLPK---GISEHHF  59

Query  490  IEHMKNLASKNKVFKSYIGMGYYNTFVPPVILRNIMENPGWYTQYTPY  633
            ++H+  LA KNK+FKSYIG+GY+    P VI RNI ENPGWYT YTPY
Sbjct  60   LQHITELAQKNKIFKSYIGLGYHEALTPSVIKRNIFENPGWYTAYTPY  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500