BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031N09

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP22086.1|  hypothetical protein JCGZ_25917                         112   6e-25   Jatropha curcas
ref|XP_002314070.2|  hypothetical protein POPTR_0009s05900g             111   1e-24   
ref|XP_011025525.1|  PREDICTED: uncharacterized protein LOC105126373    109   5e-24   Populus euphratica
ref|XP_011090367.1|  PREDICTED: uncharacterized protein LOC105171060    108   1e-23   Sesamum indicum [beniseed]
ref|XP_010102336.1|  GTPase Der                                         108   1e-23   Morus notabilis
ref|XP_002513491.1|  GTP-binding protein enga, putative                 107   5e-23   
gb|EYU26176.1|  hypothetical protein MIMGU_mgv1a002590mg                106   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_007214806.1|  hypothetical protein PRUPE_ppa023138m1g            101   7e-22   
emb|CDP04574.1|  unnamed protein product                                103   9e-22   Coffea canephora [robusta coffee]
ref|XP_009347314.1|  PREDICTED: uncharacterized protein LOC103938985    102   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_009376882.1|  PREDICTED: uncharacterized protein LOC103965542    102   2e-21   
ref|XP_006361748.1|  PREDICTED: uncharacterized protein LOC102597805    101   3e-21   Solanum tuberosum [potatoes]
gb|EPS73678.1|  hypothetical protein M569_01078                         101   3e-21   Genlisea aurea
ref|XP_010257317.1|  PREDICTED: uncharacterized protein LOC104597...    101   6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010257319.1|  PREDICTED: uncharacterized protein LOC104597...    100   6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002282837.2|  PREDICTED: uncharacterized protein LOC100260...    100   7e-21   
ref|XP_004250946.1|  PREDICTED: uncharacterized protein LOC101251249    100   8e-21   Solanum lycopersicum
ref|XP_010519745.1|  PREDICTED: uncharacterized protein LOC104799102    100   8e-21   Tarenaya hassleriana [spider flower]
gb|KCW51184.1|  hypothetical protein EUGRSUZ_J00770                   99.8    9e-21   Eucalyptus grandis [rose gum]
gb|KJB21894.1|  hypothetical protein B456_004G019700                    100   1e-20   Gossypium raimondii
gb|KHG00071.1|  GTPase Der                                              100   1e-20   Gossypium arboreum [tree cotton]
ref|XP_008227136.1|  PREDICTED: uncharacterized protein LOC103326678    100   1e-20   Prunus mume [ume]
ref|XP_010031794.1|  PREDICTED: uncharacterized protein LOC104421519  99.8    2e-20   Eucalyptus grandis [rose gum]
gb|KDO61272.1|  hypothetical protein CISIN_1g005504mg                 97.4    2e-20   Citrus sinensis [apfelsine]
ref|XP_010651244.1|  PREDICTED: uncharacterized protein LOC100260...  99.8    2e-20   Vitis vinifera
emb|CBI16384.3|  unnamed protein product                              99.4    2e-20   Vitis vinifera
ref|XP_008385564.1|  PREDICTED: uncharacterized protein LOC103448103  99.4    3e-20   
gb|AGL34232.1|  plastid GTPase Der                                    98.6    4e-20   Nicotiana benthamiana
ref|XP_009768584.1|  PREDICTED: uncharacterized protein LOC104219584  98.6    4e-20   Nicotiana sylvestris
gb|KDO61270.1|  hypothetical protein CISIN_1g005504mg                 97.4    4e-20   Citrus sinensis [apfelsine]
gb|KDO61269.1|  hypothetical protein CISIN_1g005504mg                 97.4    6e-20   Citrus sinensis [apfelsine]
ref|XP_006446112.1|  hypothetical protein CICLE_v10014514mg           97.8    8e-20   Citrus clementina [clementine]
ref|XP_009375054.1|  PREDICTED: uncharacterized protein LOC103963899  97.8    8e-20   Pyrus x bretschneideri [bai li]
ref|XP_006470605.1|  PREDICTED: uncharacterized protein LOC102625...  97.8    8e-20   
gb|KDO61267.1|  hypothetical protein CISIN_1g005504mg                 97.8    9e-20   Citrus sinensis [apfelsine]
ref|XP_007015041.1|  GTP-binding family protein                       97.4    1e-19   
ref|XP_009615948.1|  PREDICTED: uncharacterized protein LOC104108581  97.1    1e-19   Nicotiana tomentosiformis
ref|XP_006850201.1|  hypothetical protein AMTR_s00022p00249930        97.1    2e-19   Amborella trichopoda
ref|XP_010257318.1|  PREDICTED: uncharacterized protein LOC104597...  95.9    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_008449721.1|  PREDICTED: uncharacterized protein LOC103491517  95.5    5e-19   Cucumis melo [Oriental melon]
ref|XP_008813436.1|  PREDICTED: uncharacterized protein LOC103724...  94.7    6e-19   
dbj|BAD93758.1|  hypothetical protein                                 92.4    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673632.1|  PREDICTED: uncharacterized protein LOC104889980  94.0    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011469726.1|  PREDICTED: uncharacterized protein LOC101310...  93.2    3e-18   Fragaria vesca subsp. vesca
ref|XP_004289593.1|  PREDICTED: uncharacterized protein LOC101310...  93.2    3e-18   Fragaria vesca subsp. vesca
ref|NP_001078139.1|  putative double era-like GTPase                  92.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187815.2|  putative double era-like GTPase                     92.4    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004169435.1|  PREDICTED: GTPase Der-like                       90.1    9e-18   
ref|XP_004507094.1|  PREDICTED: GTPase Der-like                       91.3    1e-17   Cicer arietinum [garbanzo]
gb|KEH30215.1|  GTPase Der protein                                    91.3    1e-17   Medicago truncatula
ref|XP_002882766.1|  EMB2738                                          90.9    2e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_004142117.1|  PREDICTED: GTPase Der-like                       90.1    3e-17   Cucumis sativus [cucumbers]
gb|KGN54174.1|  hypothetical protein Csa_4G291380                     90.1    3e-17   
ref|XP_010486897.1|  PREDICTED: uncharacterized protein LOC104764969  89.7    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010498493.1|  PREDICTED: uncharacterized protein LOC104776175  89.4    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006297160.1|  hypothetical protein CARUB_v10013165mg           89.0    8e-17   Capsella rubella
ref|XP_010464959.1|  PREDICTED: uncharacterized protein LOC104745422  88.6    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006407372.1|  hypothetical protein EUTSA_v10020226mg           88.2    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_007132015.1|  hypothetical protein PHAVU_011G059500g           87.8    2e-16   Phaseolus vulgaris [French bean]
ref|XP_011469724.1|  PREDICTED: uncharacterized protein LOC101310...  87.8    2e-16   Fragaria vesca subsp. vesca
gb|KFK38573.1|  hypothetical protein AALP_AA3G131000                  87.0    3e-16   Arabis alpina [alpine rockcress]
emb|CDY01098.1|  BnaC05g41020D                                        87.0    4e-16   
ref|XP_002449905.1|  hypothetical protein SORBIDRAFT_05g025430        86.7    5e-16   
tpg|DAA42328.1|  TPA: hypothetical protein ZEAMMB73_012049            86.7    5e-16   
ref|XP_004979812.1|  PREDICTED: uncharacterized protein LOC101764561  86.7    6e-16   
ref|NP_001146320.1|  uncharacterized protein LOC100279896             86.3    6e-16   
emb|CDY08458.1|  BnaA05g26940D                                        85.5    1e-15   Brassica napus [oilseed rape]
ref|XP_009146648.1|  PREDICTED: uncharacterized protein LOC103870279  85.1    1e-15   Brassica rapa
gb|EEC68516.1|  hypothetical protein OsI_36791                        83.2    6e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009394388.1|  PREDICTED: uncharacterized protein LOC103979...  82.4    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG51052.1|AC069473_14  GTPase, putative; 34281-30152              82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592177.1|  PREDICTED: uncharacterized protein LOC100777...  81.3    3e-14   
ref|XP_003539473.1|  PREDICTED: uncharacterized protein LOC100777...  80.9    4e-14   Glycine max [soybeans]
gb|KHN21905.1|  GTPase Der                                            80.5    4e-14   Glycine soja [wild soybean]
gb|KHN25243.1|  GTPase Der                                            80.5    7e-14   Glycine soja [wild soybean]
dbj|BAB01956.1|  GTP-binding protein-like                             77.8    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394390.1|  PREDICTED: uncharacterized protein LOC103979...  76.3    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394391.1|  PREDICTED: uncharacterized protein LOC103979...  76.3    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813437.1|  PREDICTED: uncharacterized protein LOC103724...  75.1    3e-12   
gb|EMS63685.1|  GTPase Der                                            74.3    5e-12   Triticum urartu
ref|XP_010907852.1|  PREDICTED: uncharacterized protein LOC105034...  73.2    1e-11   Elaeis guineensis
ref|XP_010907854.1|  PREDICTED: uncharacterized protein LOC105034...  72.8    2e-11   
ref|XP_010907853.1|  PREDICTED: uncharacterized protein LOC105034...  72.8    2e-11   Elaeis guineensis
ref|XP_010237503.1|  PREDICTED: uncharacterized protein LOC100845...  72.4    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_010237502.1|  PREDICTED: uncharacterized protein LOC100845...  72.4    2e-11   Brachypodium distachyon [annual false brome]
gb|EEE52426.1|  hypothetical protein OsJ_34551                        70.9    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMT17683.1|  GTP-binding protein engA                              65.9    3e-09   
ref|XP_001770231.1|  predicted protein                                65.5    4e-09   
ref|XP_002985833.1|  hypothetical protein SELMODRAFT_123195           63.9    1e-08   
ref|XP_002984773.1|  hypothetical protein SELMODRAFT_121150           63.5    2e-08   
ref|XP_001420333.1|  predicted protein                                62.0    6e-08   Ostreococcus lucimarinus CCE9901
ref|XP_005843504.1|  hypothetical protein CHLNCDRAFT_37436            61.2    9e-08   Chlorella variabilis
ref|XP_007509383.1|  GTP-binding protein EngA                         61.2    1e-07   Bathycoccus prasinos
emb|CEF99667.1|  P-loop containing nucleoside triphosphate hydrolase  60.8    1e-07   Ostreococcus tauri
gb|KIY92949.1|  GTP-binding protein                                   54.7    2e-06   Monoraphidium neglectum
ref|XP_005651191.1|  P-loop containing nucleoside triphosphate hy...  57.4    2e-06   Coccomyxa subellipsoidea C-169
ref|WP_015442115.1|  ribosome-associated GTPase EngA                  54.3    2e-05   
ref|XP_003082033.1|  GTP-binding protein-like (ISS)                   54.3    2e-05   
ref|WP_038133265.1|  hypothetical protein                             50.4    2e-05   
ref|XP_010259076.1|  PREDICTED: uncharacterized protein LOC104598616  53.9    3e-05   Nelumbo nucifera [Indian lotus]
ref|WP_015743770.1|  ribosome-associated GTPase EngA                  53.5    3e-05   
ref|XP_003061511.1|  predicted protein                                53.5    3e-05   Micromonas pusilla CCMP1545
ref|XP_005848465.1|  hypothetical protein CHLNCDRAFT_144853           53.5    4e-05   Chlorella variabilis
ref|WP_029665584.1|  hypothetical protein                             53.1    4e-05   
ref|WP_029233883.1|  hypothetical protein                             53.1    5e-05   
ref|WP_022803927.1|  hypothetical protein                             53.1    5e-05   
ref|WP_029666999.1|  hypothetical protein                             53.1    5e-05   
ref|WP_029230440.1|  MULTISPECIES: hypothetical protein               53.1    5e-05   
ref|WP_011413185.1|  ribosome-associated GTPase EngA                  52.8    6e-05   Erythrobacter litoralis
ref|XP_002519374.1|  GTP-binding protein enga, putative               52.8    7e-05   Ricinus communis
gb|KIZ00088.1|  GTP-binding protein                                   52.4    1e-04   Monoraphidium neglectum
ref|WP_003620437.1|  ribosome-associated GTPase EngA                  52.0    1e-04   Komagataeibacter hansenii
ref|WP_025825836.1|  ribosome-associated GTPase EngA                  52.0    1e-04   
ref|WP_043550735.1|  ribosome-associated GTPase EngA                  51.6    1e-04   Acetobacter malorum
ref|WP_022806683.1|  hypothetical protein                             51.6    1e-04   
gb|EQD25394.1|  GTP-binding protein engA                              51.2    2e-04   Leptospirillum sp. Group IV 'UBA BS'
ref|WP_008602967.1|  ribosome-associated GTPase EngA                  51.6    2e-04   Pacificimonas flava
ref|WP_010024483.1|  GTP-binding protein Der                          48.5    2e-04   
ref|WP_015423156.1|  ribosome-associated GTPase EngA                  51.2    2e-04   Candidatus Endomicrobium trichonymphae
gb|KDP32444.1|  hypothetical protein JCGZ_13369                       51.2    2e-04   Jatropha curcas
ref|WP_040492190.1|  ribosome-associated GTPase EngA                  51.2    2e-04   Ilumatobacter nonamiensis
ref|WP_043285078.1|  ribosome-associated GTPase EngA                  51.2    2e-04   Reyranella massiliensis
ref|WP_026396422.1|  ribosome-associated GTPase EngA                  51.2    2e-04   Acetobacter nitrogenifigens
ref|WP_012744727.1|  ribosome-associated GTPase EngA                  50.8    2e-04   Kosmotoga
gb|EES52176.1|  GTP-binding protein (EngA)                            50.8    3e-04   Leptospirillum ferrodiazotrophum
ref|WP_013950922.1|  ribosome-associated GTPase EngA                  50.8    3e-04   Candidatus Midichloria mitochondrii
ref|WP_014730754.1|  ribosome-associated GTPase EngA                  50.8    3e-04   Mesotoga prima
ref|WP_022325807.1|  ribosome-associated GTPase EngA                  50.8    3e-04   
ref|XP_005708451.1|  GTP-binding protein                              50.8    3e-04   Galdieria sulphuraria
ref|WP_006492786.1|  ribosome-associated GTPase EngA                  50.8    3e-04   
ref|WP_038039529.1|  ribosome-associated GTPase EngA                  50.8    3e-04   
ref|XP_010088699.1|  GTPase Der                                       50.8    3e-04   
ref|WP_039278381.1|  ribosome-associated GTPase EngA                  50.4    3e-04   Novosphingobium malaysiense
ref|WP_013833055.1|  MULTISPECIES: ribosome-associated GTPase EngA    50.4    3e-04   Novosphingobium
ref|XP_008238266.1|  PREDICTED: uncharacterized protein LOC103336908  50.8    3e-04   Prunus mume [ume]
ref|WP_043360659.1|  ribosome-associated GTPase EngA                  50.4    3e-04   Belnapia sp. F-4-1
ref|XP_007209043.1|  hypothetical protein PRUPE_ppa002689mg           50.8    3e-04   
ref|WP_008833521.1|  MULTISPECIES: ribosome-associated GTPase EngA    50.4    3e-04   Sphingomonadaceae
ref|WP_033924188.1|  ribosome-associated GTPase EngA                  50.4    3e-04   Sphingomonas sp. 35-24ZXX
ref|WP_043341680.1|  ribosome-associated GTPase EngA                  50.4    4e-04   Belnapia moabensis
ref|WP_023837383.1|  ribosome-associated GTPase EngA                  50.4    4e-04   
gb|EHJ62125.1|  GTP-binding protein EngA                              50.4    4e-04   Novosphingobium pentaromativorans US6-1
gb|KGB22406.1|  GTP-binding protein EngA                              50.4    4e-04   Acetobacter tropicalis
gb|ABI63193.1|  GTP-binding protein                                   50.4    4e-04   Granulibacter bethesdensis CGDNIH1
ref|WP_035055612.1|  GTP-binding protein Der                          47.4    4e-04   
ref|WP_021232171.1|  ribosome-associated GTPase EngA                  50.4    4e-04   Novosphingobium lindaniclasticum
ref|WP_035381076.1|  ribosome-associated GTPase EngA                  50.4    4e-04   
ref|WP_025826043.1|  ribosome-associated GTPase EngA                  50.4    4e-04   
ref|WP_039391334.1|  ribosome-associated GTPase EngA                  50.4    4e-04   Novosphingobium sp. MBES04
ref|WP_010513528.1|  ribosome-associated GTPase EngA                  50.4    4e-04   Komagataeibacter
ref|XP_010696202.1|  PREDICTED: uncharacterized protein LOC104908749  49.7    4e-04   
ref|WP_040870722.1|  GTP-binding protein Der                          47.4    4e-04   
ref|WP_039735651.1|  ribosome-associated GTPase EngA                  50.1    4e-04   Komagataeibacter intermedius
ref|WP_014104624.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Komagataeibacter medellinensis
ref|WP_041977481.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Pyrinomonas methylaliphatogenes
ref|WP_025438660.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Komagataeibacter xylinus
ref|WP_010507796.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Komagataeibacter europaeus
ref|WP_010942865.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Geobacter sulfurreducens
ref|WP_013406044.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Halanaerobium hydrogeniformans
ref|WP_026019733.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Komagataeibacter europaeus
ref|WP_011525430.1|  ribosome-associated GTPase EngA                  50.1    5e-04   
ref|WP_039643828.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Geobacter soli
ref|WP_022658406.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Desulfovibrio desulfuricans
ref|WP_034928178.1|  MULTISPECIES: ribosome-associated GTPase EngA    50.1    5e-04   Acetobacteraceae
ref|WP_010414923.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Citromicrobium sp. JLT1363
gb|EGE47758.1|  GTP-binding protein EngA                              50.1    5e-04   Acetobacter pomorum DM001
ref|WP_017670574.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Blastomonas sp. AAP53
ref|WP_039905366.1|  GTP-binding protein Der                          49.7    5e-04   
ref|WP_005488816.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Halanaerobium saccharolyticum
ref|WP_040621345.1|  ribosome-associated GTPase EngA                  50.1    5e-04   
ref|WP_020402934.1|  ribosome-associated GTPase EngA                  50.1    5e-04   Gracilimonas tropica
ref|WP_018282653.1|  ribosome-associated GTPase EngA                  50.1    5e-04   
ref|WP_027182070.1|  ribosome-associated GTPase EngA                  50.1    6e-04   Desulfovibrio alaskensis
ref|WP_039096884.1|  ribosome-associated GTPase EngA                  50.1    6e-04   Porphyrobacter mercurialis
ref|WP_008492023.1|  MULTISPECIES: ribosome-associated GTPase EngA    50.1    6e-04   Acidocella
ref|WP_025208507.1|  ribosome-associated GTPase EngA                  50.1    6e-04   Candidatus Hepatoplasma crinochetorum
gb|AHC14743.1|  GTP-binding protein EngA                              50.1    6e-04   Salinispira pacifica
ref|WP_043976345.1|  GTP-binding protein Der                          49.7    6e-04   Novosphingobium sp. P6W
ref|WP_011366249.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Desulfovibrio alaskensis
ref|WP_020944166.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Acetobacter pasteurianus
dbj|GAB27696.1|  GTP-binding protein EngA                             49.7    6e-04   
ref|WP_025861259.1|  ribosome-associated GTPase EngA                  49.7    6e-04   
ref|WP_008995546.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Novosphingobium sp. Rr 2-17
ref|WP_007434646.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Acetobacteraceae bacterium AT-5844
ref|WP_011526196.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Lawsonia intracellularis
ref|WP_023172386.1|  ribosome-associated GTPase EngA                  49.7    6e-04   Gloeobacter kilaueensis
ref|WP_026019256.1|  ribosome-associated GTPase EngA                  49.7    6e-04   
gb|KJB46314.1|  hypothetical protein B456_007G360100                  49.7    7e-04   Gossypium raimondii
gb|AHJ67834.1|  GTP-binding protein                                   49.7    7e-04   Granulibacter bethesdensis
ref|WP_004513306.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Geobacter metallireducens
gb|AHJ64199.1|  GTP-binding protein                                   49.7    7e-04   Granulibacter bethesdensis
gb|AHJ65213.1|  GTP-binding protein                                   49.7    7e-04   Granulibacter bethesdensis CGDNIH4
ref|WP_018979577.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Saccharibacter floricola
ref|WP_027718750.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Desulfovirgula thermocuniculi
ref|WP_013433167.1|  MULTISPECIES: ribosome-associated GTPase EngA    49.7    7e-04   Caldicellulosiruptor
ref|WP_023978351.1|  MULTISPECIES: ribosome-associated GTPase EngA    49.7    7e-04   Asaia
ref|WP_014552973.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Halanaerobium praevalens
ref|WP_012625103.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Desulfovibrio
gb|ACL09206.1|  small GTP-binding protein                             49.7    7e-04   Desulfovibrio vulgaris str. 'Miyazaki F'
ref|WP_037527885.1|  ribosome-associated GTPase EngA                  49.7    7e-04   Sphingomonas wittichii
gb|AAW61706.1|  GTP-binding protein                                   49.7    8e-04   Gluconobacter oxydans 621H
ref|WP_034953656.1|  ribosome-associated GTPase EngA                  49.7    8e-04   Gluconobacter oxydans
ref|WP_039742878.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Geobacter pickeringii
ref|WP_013430826.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Caldicellulosiruptor kronotskyensis
ref|WP_013411579.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Caldicellulosiruptor owensensis
ref|WP_015907304.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Caldicellulosiruptor bescii
ref|WP_013403800.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Caldicellulosiruptor hydrothermalis
ref|WP_011143202.1|  ribosome-associated GTPase EngA                  49.3    8e-04   Gloeobacter violaceus
gb|AFG35933.1|  ribosome-associated GTPase EngA                       49.3    8e-04   Fervidobacterium pennivorans DSM 9078
ref|WP_038285615.1|  ribosome-associated GTPase EngA                  49.3    8e-04   
ref|WP_042058241.1|  ribosome-associated GTPase EngA                  49.3    9e-04   Acidomonas methanolica
ref|WP_008624046.1|  ribosome-associated GTPase EngA                  49.3    9e-04   Mariniradius saccharolyticus
ref|WP_023510379.1|  ribosome-associated GTPase EngA                  49.3    9e-04   Sporolactobacillus laevolacticus
ref|WP_013289998.1|  ribosome-associated GTPase EngA                  49.3    9e-04   Caldicellulosiruptor obsidiansis
gb|EGY25060.1|  small GTP-binding domain protein                      48.5    0.001   Desulfovibrio sp. A2
ref|WP_011916460.1|  ribosome-associated GTPase EngA                  49.3    0.001   Caldicellulosiruptor saccharolyticus
ref|WP_014853440.1|  ribosome-associated GTPase EngA                  49.3    0.001   Pseudomonas
ref|WP_039765359.1|  ribosome-associated GTPase EngA                  49.3    0.001   Caldicellulosiruptor sp. F32
gb|KJB46315.1|  hypothetical protein B456_007G360100                  49.3    0.001   Gossypium raimondii
ref|WP_024022170.1|  ribosome-associated GTPase EngA                  49.3    0.001   Sphingobium sp. C100
ref|WP_041569683.1|  ribosome-associated GTPase EngA                  49.3    0.001   
ref|WP_009379431.1|  ribosome-associated GTPase EngA                  49.3    0.001   Bilophila sp. 4_1_30
ref|WP_013314080.1|  ribosome-associated GTPase EngA                  49.3    0.001   Spirochaeta thermophila



>gb|KDP22086.1| hypothetical protein JCGZ_25917 [Jatropha curcas]
Length=642

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            A+ A RE+S SLSRQLR +D+   +KETRK KR K+TS  +PDHLLP+V IVGRPNVGKS
Sbjct  101  AEDAVREYSSSLSRQLRIDDEIDDKKETRKHKRQKATSPEIPDHLLPRVAIVGRPNVGKS  160

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGNRAIVVD
Sbjct  161  ALFNRLVGGNRAIVVD  176



>ref|XP_002314070.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
 gb|EEE88025.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
Length=651

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            AK A +E S SLSRQL  EDD   ++E+RKQKR K+TS  +PDHLLPKV IVGRPNVGKS
Sbjct  103  AKFAVKELSTSLSRQLTIEDDTDEKRESRKQKRKKATSKDIPDHLLPKVAIVGRPNVGKS  162

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGNRAIVVD
Sbjct  163  ALFNRLVGGNRAIVVD  178



>ref|XP_011025525.1| PREDICTED: uncharacterized protein LOC105126373 [Populus euphratica]
Length=651

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            AK A +E S SLSRQL  ED+   ++E+RKQKR K+TS  +PDHLLPKV IVGRPNVGKS
Sbjct  103  AKFAVKELSTSLSRQLTIEDETDEKRESRKQKRKKATSKDIPDHLLPKVAIVGRPNVGKS  162

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGNRAIVVD
Sbjct  163  ALFNRLVGGNRAIVVD  178



>ref|XP_011090367.1| PREDICTED: uncharacterized protein LOC105171060 [Sesamum indicum]
Length=657

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AKQ  ++FS SLSR+L+ EDD + +KETR KQKR  +T S++PDHLLP+V IVGRPNVGK
Sbjct  109  AKQVVKDFSVSLSRELKIEDDVSNQKETRGKQKRRTNTGSNIPDHLLPRVAIVGRPNVGK  168

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGN+AIVVD
Sbjct  169  SALFNRLVGGNKAIVVD  185



>ref|XP_010102336.1| GTPase Der [Morus notabilis]
 gb|EXB93297.1| GTPase Der [Morus notabilis]
Length=661

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            A  A R+FS SLS QL+ ED+K   KE  RKQKR KST  S+PDHLLPKV IVGRPNVGK
Sbjct  103  ALDAVRDFSSSLSNQLKIEDEKIDHKEIGRKQKRHKSTVKSIPDHLLPKVAIVGRPNVGK  162

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  163  SALFNRLVGGNRAIVVD  179



>ref|XP_002513491.1| GTP-binding protein enga, putative [Ricinus communis]
 gb|EEF48894.1| GTP-binding protein enga, putative [Ricinus communis]
Length=624

 Score =   107 bits (266),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGKS  575
            A+   RE+S SLSRQLR EDD   +KETRKQKR K T   +PD+LLP+V IVGRPNVGKS
Sbjct  95   AEDVVREYSTSLSRQLRIEDDSDDKKETRKQKRQKFTIPDIPDNLLPRVAIVGRPNVGKS  154

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGN+AIVVD
Sbjct  155  ALFNRLVGGNKAIVVD  170



>gb|EYU26176.1| hypothetical protein MIMGU_mgv1a002590mg [Erythranthe guttata]
Length=656

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTSSVPDHLLPKVVIVGRPNVGK  572
            AK+A +EFS+SL+R+L+ ED+   +K TR  +Q R+ + S++PDHLLP+V IVGRPNVGK
Sbjct  107  AKEAVKEFSDSLARELKIEDEVPNQKRTRGRQQPRITTVSNIPDHLLPRVAIVGRPNVGK  166

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGN+AIVVD
Sbjct  167  SALFNRLVGGNKAIVVD  183



>ref|XP_007214806.1| hypothetical protein PRUPE_ppa023138m1g, partial [Prunus persica]
 gb|EMJ16005.1| hypothetical protein PRUPE_ppa023138m1g, partial [Prunus persica]
Length=396

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            A+   +EFS SLS QLR ED+K  ++E  RKQ+R KST  S+PDHLLP+V IVGRPNVGK
Sbjct  39   ARYVVQEFSSSLSSQLRIEDEKDDQEEVGRKQRRHKSTVKSIPDHLLPRVAIVGRPNVGK  98

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLV GN+AIVVD
Sbjct  99   SALFNRLVSGNKAIVVD  115



>emb|CDP04574.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET--RKQKRLKSTSSVPDHLLPKVVIVGRPNVGK  572
            AK A +EFS++LSRQL  EDD   +KET  +++K   S  ++PDHLLP+V IVGRPNVGK
Sbjct  109  AKFAVKEFSDALSRQLTIEDDPVDQKETSIKRRKHKSSAKNIPDHLLPRVTIVGRPNVGK  168

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGN+AIVVD
Sbjct  169  SALFNRLVGGNKAIVVD  185



>ref|XP_009347314.1| PREDICTED: uncharacterized protein LOC103938985 [Pyrus x bretschneideri]
 ref|XP_009347317.1| PREDICTED: uncharacterized protein LOC103938988 [Pyrus x bretschneideri]
Length=659

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGKS  575
            A+    EFS SLS QLR +D+   EK +RKQ+RL ST  ++PDHLLP+V IVGRPNVGKS
Sbjct  111  ARYVVEEFSSSLSTQLRIDDNDDQEKVSRKQRRLTSTVKTIPDHLLPRVAIVGRPNVGKS  170

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLV GN+AIVVD
Sbjct  171  ALFNRLVSGNKAIVVD  186



>ref|XP_009376882.1| PREDICTED: uncharacterized protein LOC103965542 [Pyrus x bretschneideri]
Length=659

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGKS  575
            A+    EFS SLS QLR +D+   EK +RKQ+RL ST  ++PDHLLP+V IVGRPNVGKS
Sbjct  111  ARYVVEEFSSSLSTQLRIDDNDDQEKVSRKQRRLTSTVKTIPDHLLPRVAIVGRPNVGKS  170

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLV GN+AIVVD
Sbjct  171  ALFNRLVSGNKAIVVD  186



>ref|XP_006361748.1| PREDICTED: uncharacterized protein LOC102597805 [Solanum tuberosum]
Length=646

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 10/141 (7%)
 Frame = +3

Query  222  HRRRRCCFLNFSRRHCLPPAA----AQFYGeeeveedelleiegsdaeddeeesldvdsl  389
            H  RRC   N SR  CLPPA     ++    +E+ E    E E      ++E++LDVDSL
Sbjct  36   HHLRRC---NLSRSFCLPPAVQLSTSREDDGDEMVEIGGSEFEEEVDYAEDEDTLDVDSL  92

Query  390  ereAKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSS--VPDHLLPKVVIVGRP  560
            EREA+   REFS+SLSRQL  E++++  KE + K+KR K+T+S  +PDHLLPKV IVGRP
Sbjct  93   EREAQLVVREFSDSLSRQLIIEEERSSPKEAQVKEKRRKNTTSKNIPDHLLPKVAIVGRP  152

Query  561  NVGKSALFNRLVGGNRAIVVD  623
            NVGKSALFNRLVGG +AIVVD
Sbjct  153  NVGKSALFNRLVGGKKAIVVD  173



>gb|EPS73678.1| hypothetical protein M569_01078, partial [Genlisea aurea]
Length=544

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS--TSSVPDHLLPKVVIVGRPNVGK  572
            A+   +EFS+SLSRQL  ED+   +KETR +    S  +S+VPDHLLPKV IVGRPNVGK
Sbjct  13   AENVVKEFSQSLSRQLLIEDENALQKETRARHGRNSIFSSNVPDHLLPKVAIVGRPNVGK  72

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGN+AIVVD
Sbjct  73   SALFNRLVGGNKAIVVD  89



>ref|XP_010257317.1| PREDICTED: uncharacterized protein LOC104597468 isoform X1 [Nelumbo 
nucifera]
Length=677

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            AK A RE++ SLS +L  ED   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSELTIEDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  183

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGN+AIVVD
Sbjct  184  ALFNRLVGGNKAIVVD  199



>ref|XP_010257319.1| PREDICTED: uncharacterized protein LOC104597468 isoform X3 [Nelumbo 
nucifera]
Length=673

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            AK A RE++ SLS +L  ED   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSELTIEDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  183

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGN+AIVVD
Sbjct  184  ALFNRLVGGNKAIVVD  199



>ref|XP_002282837.2| PREDICTED: uncharacterized protein LOC100260310 isoform X2 [Vitis 
vinifera]
Length=676

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS-SVPDHLLPKVVIVGRPNVG  569
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+ ++PDHLLP+V IVGRPNVG
Sbjct  125  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNIPDHLLPRVTIVGRPNVG  184

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGN+AIVVD
Sbjct  185  KSALFNRLVGGNKAIVVD  202



>ref|XP_004250946.1| PREDICTED: uncharacterized protein LOC101251249 [Solanum lycopersicum]
Length=645

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 90/140 (64%), Gaps = 9/140 (6%)
 Frame = +3

Query  222  HRRRRCCFLNFSRRHCLPPAAAQFYGeeeveedelleiegsdaeddeeesldvdslereA  401
            H  RRC   N SR  CLPPA       E+ +E   +     + EDD  E  D   ++   
Sbjct  36   HHFRRC---NLSRSFCLPPAVQLSTSREDEDEMVDIGGSEYEEEDDYAEDEDTLDVDSLE  92

Query  402  KQA---AREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSS--VPDHLLPKVVIVGRPN  563
            ++A    REFS+SLSRQL  E++++  KE + K+KR K+T++  +PDHLLPKV IVGRPN
Sbjct  93   REAQLVVREFSDSLSRQLIIEEERSSPKEAQVKEKRRKNTTTKNIPDHLLPKVAIVGRPN  152

Query  564  VGKSALFNRLVGGNRAIVVD  623
            VGKSALFNRLVGG +AIVVD
Sbjct  153  VGKSALFNRLVGGKKAIVVD  172



>ref|XP_010519745.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
 ref|XP_010519746.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
Length=655

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A++  R+++ SLS++L+ ED+K G KE+R K+ RL   S +P+HLLP+V IVGRPNVGKS
Sbjct  106  AEEVVRDYTSSLSQELKLEDEKNGGKESRRKEIRLAKNSQIPEHLLPRVAIVGRPNVGKS  165

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  166  ALFNRLVGENRAIVVD  181



>gb|KCW51184.1| hypothetical protein EUGRSUZ_J00770 [Eucalyptus grandis]
Length=525

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKST--SSVPDHLLPKVVIVGRPNVG  569
            A++A  E+S SLSR+LR+ED+   +KE T KQKR K    + +PDHLLP+V IVGRPNVG
Sbjct  102  AREAVVEYSRSLSRELRSEDEGNEQKEATGKQKRGKRAIKNVIPDHLLPRVAIVGRPNVG  161

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGN+AIVVD
Sbjct  162  KSALFNRLVGGNKAIVVD  179



>gb|KJB21894.1| hypothetical protein B456_004G019700 [Gossypium raimondii]
Length=656

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLK-STSSVPDHLLPKVVIVGRPNVGK  572
            AK A R +S SLSRQL  ED+    K  + KQKR K +T ++PDHLLPKV IVGRPNVGK
Sbjct  107  AKDAVRSYSTSLSRQLTIEDETDDLKGFKGKQKRRKGATKTIPDHLLPKVTIVGRPNVGK  166

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  167  SALFNRLVGGNRAIVVD  183



>gb|KHG00071.1| GTPase Der [Gossypium arboreum]
Length=657

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLK-STSSVPDHLLPKVVIVGRPNVGK  572
            AK A R +S SLSRQL  ED+    K  + KQKR K +T ++PDHLLPKV IVGRPNVGK
Sbjct  108  AKDAVRSYSTSLSRQLTIEDETDDLKGFKGKQKRRKGATKTIPDHLLPKVTIVGRPNVGK  167

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  168  SALFNRLVGGNRAIVVD  184



>ref|XP_008227136.1| PREDICTED: uncharacterized protein LOC103326678 [Prunus mume]
Length=662

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            A+   +EFS +LS QLR ED+K   EK +RKQ+R KST  S+PDHLLP+V IVGRPNVGK
Sbjct  113  ARYVVQEFSSTLSSQLRIEDEKDDQEKVSRKQRRQKSTVKSIPDHLLPRVAIVGRPNVGK  172

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLV GN AIVVD
Sbjct  173  SALFNRLVSGNNAIVVD  189



>ref|XP_010031794.1| PREDICTED: uncharacterized protein LOC104421519 [Eucalyptus grandis]
Length=650

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKST--SSVPDHLLPKVVIVGRPNVG  569
            A++A  E+S SLSR+LR+ED+   +KE T KQKR K    + +PDHLLP+V IVGRPNVG
Sbjct  102  AREAVVEYSRSLSRELRSEDEGNEQKEATGKQKRGKRAIKNVIPDHLLPRVAIVGRPNVG  161

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGN+AIVVD
Sbjct  162  KSALFNRLVGGNKAIVVD  179



>gb|KDO61272.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=381

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>ref|XP_010651244.1| PREDICTED: uncharacterized protein LOC100260310 isoform X1 [Vitis 
vinifera]
Length=677

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS--SVPDHLLPKVVIVGRPNV  566
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+   +PDHLLP+V IVGRPNV
Sbjct  125  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNVIPDHLLPRVTIVGRPNV  184

Query  567  GKSALFNRLVGGNRAIVVD  623
            GKSALFNRLVGGN+AIVVD
Sbjct  185  GKSALFNRLVGGNKAIVVD  203



>emb|CBI16384.3| unnamed protein product [Vitis vinifera]
Length=658

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS--SVPDHLLPKVVIVGRPNV  566
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+   +PDHLLP+V IVGRPNV
Sbjct  139  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNVIPDHLLPRVTIVGRPNV  198

Query  567  GKSALFNRLVGGNRAIVVD  623
            GKSALFNRLVGGN+AIVVD
Sbjct  199  GKSALFNRLVGGNKAIVVD  217



>ref|XP_008385564.1| PREDICTED: uncharacterized protein LOC103448103 [Malus domestica]
Length=660

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            A+    EFS SLS QLR EDDK   EK  RKQ+  KST  ++PDHLLP+V IVGRPNVGK
Sbjct  111  ARYLVEEFSSSLSTQLRIEDDKDDQEKVGRKQRNQKSTVKTIPDHLLPRVAIVGRPNVGK  170

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLV GN+AIVVD
Sbjct  171  SALFNRLVSGNKAIVVD  187



>gb|AGL34232.1| plastid GTPase Der [Nicotiana benthamiana]
Length=651

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  572
            A+   REFS+SLSRQL  E++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  102  AELVVREFSDSLSRQLTIEEERSSRKEAQFKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  161

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGG +AIVVD
Sbjct  162  SALFNRLVGGKQAIVVD  178



>ref|XP_009768584.1| PREDICTED: uncharacterized protein LOC104219584 [Nicotiana sylvestris]
Length=652

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  572
            A+   REFS+SLSRQL  E++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  103  AELVVREFSDSLSRQLTIEEERSSPKEAQVKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  162

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGG +AIVVD
Sbjct  163  SALFNRLVGGKKAIVVD  179



>gb|KDO61270.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
 gb|KDO61271.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=484

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>gb|KDO61269.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=549

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>ref|XP_006446112.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 ref|XP_006470604.1| PREDICTED: uncharacterized protein LOC102625125 isoform X1 [Citrus 
sinensis]
 gb|ESR59352.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 gb|KDO61268.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=666

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>ref|XP_009375054.1| PREDICTED: uncharacterized protein LOC103963899 [Pyrus x bretschneideri]
Length=660

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            A+    EFS SLS QLR EDDK   EK  RKQ+  KS+  ++PDHLLP+V IVGRPNVGK
Sbjct  111  ARYLVEEFSSSLSTQLRIEDDKDDQEKVGRKQRNQKSSVKTIPDHLLPRVAIVGRPNVGK  170

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLV GN+AIVVD
Sbjct  171  SALFNRLVSGNKAIVVD  187



>ref|XP_006470605.1| PREDICTED: uncharacterized protein LOC102625125 isoform X2 [Citrus 
sinensis]
Length=665

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>gb|KDO61267.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=693

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  572
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  177  SALFNRLVGGNRAIVVD  193



>ref|XP_007015041.1| GTP-binding family protein [Theobroma cacao]
 gb|EOY32660.1| GTP-binding family protein [Theobroma cacao]
Length=648

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  572
            AK A R +S SLSR L  ED+    KE + KQKR KS S S+PD LLP+V IVGRPNVGK
Sbjct  99   AKDAVRRYSSSLSRHLTIEDEADDSKELSGKQKRRKSASKSIPDQLLPRVAIVGRPNVGK  158

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGG+RAIVVD
Sbjct  159  SALFNRLVGGDRAIVVD  175



>ref|XP_009615948.1| PREDICTED: uncharacterized protein LOC104108581 [Nicotiana tomentosiformis]
Length=654

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  572
            A+   REFS+SLSRQL  +++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  105  AELVVREFSDSLSRQLTIDEERSSPKEAQVKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  164

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGG +AIVVD
Sbjct  165  SALFNRLVGGKKAIVVD  181



>ref|XP_006850201.1| hypothetical protein AMTR_s00022p00249930 [Amborella trichopoda]
 gb|ERN11782.1| hypothetical protein AMTR_s00022p00249930 [Amborella trichopoda]
Length=651

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRK--QKRLKSTSSVPDHLLPKVVIVGRPNVGK  572
            A+ A RE+S SLSR+L  E+D + +K   K  ++R  S   VPDHLLP+V IVGRPNVGK
Sbjct  100  AQAAVREYSLSLSRELSIEEDASDQKNQGKWQKRRAGSFQHVPDHLLPRVTIVGRPNVGK  159

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  160  SALFNRLVGGNRAIVVD  176



>ref|XP_010257318.1| PREDICTED: uncharacterized protein LOC104597468 isoform X2 [Nelumbo 
nucifera]
Length=676

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  575
            AK A RE++ SLS +L T D   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSEL-TIDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  182

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVGGN+AIVVD
Sbjct  183  ALFNRLVGGNKAIVVD  198



>ref|XP_008449721.1| PREDICTED: uncharacterized protein LOC103491517 [Cucumis melo]
Length=660

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  569
            AK   RE+S SLSR+LR +D+ T + ET ++K+ + T   + +PDHLLPKV IVGRPNVG
Sbjct  110  AKDVLREYSSSLSRELRLDDELTDQSETGRKKKKRKTTPRNVIPDHLLPKVAIVGRPNVG  169

Query  570  KSALFNRLVGGNRAIVVD  623
            KSA+FNRLVGGNRAIVVD
Sbjct  170  KSAMFNRLVGGNRAIVVD  187



>ref|XP_008813436.1| PREDICTED: uncharacterized protein LOC103724064 isoform X1 [Phoenix 
dactylifera]
Length=587

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS----VPDHLLPKVVIVGRPNV  566
            A+   RE+S SLSR+L  ++D   +K+  ++++L+ +SS    +PDHLLP++ IVGRPNV
Sbjct  108  ARDVVREYSASLSRELDIDEDIEEKKKFSEKQKLQRSSSKHFQIPDHLLPRIAIVGRPNV  167

Query  567  GKSALFNRLVGGNRAIVVD  623
            GKSALFNRLVGGNRAIVVD
Sbjct  168  GKSALFNRLVGGNRAIVVD  186



>dbj|BAD93758.1| hypothetical protein [Arabidopsis thaliana]
Length=370

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  572
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVG NRAIVVD
Sbjct  172  SALFNRLVGENRAIVVD  188



>ref|XP_010673632.1| PREDICTED: uncharacterized protein LOC104889980 [Beta vulgaris 
subsp. vulgaris]
Length=670

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +3

Query  414  REFSESLSRQLRTEDDKT---GEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALF  584
            REFS SLSR+LR E+D+    GE   +++ R     S+PDHLLPKV I GRPNVGKSALF
Sbjct  126  REFSTSLSRELRIEEDEASLRGEVGGKQKGRKILPRSIPDHLLPKVAIFGRPNVGKSALF  185

Query  585  NRLVGGNRAIVVD  623
            NRLVGGN+AIVVD
Sbjct  186  NRLVGGNKAIVVD  198



>ref|XP_011469726.1| PREDICTED: uncharacterized protein LOC101310757 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=617

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = +3

Query  414  REFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFN  587
             EFS SLS+ L  ED+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFN
Sbjct  85   EEFSSSLSKLLTIEDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFN  144

Query  588  RLVGGNRAIVVD  623
            RLV GN+AIVVD
Sbjct  145  RLVSGNKAIVVD  156



>ref|XP_004289593.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469717.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 2/71 (3%)
 Frame = +3

Query  417  EFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFNR  590
            EFS SLS+ L  ED+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFNR
Sbjct  86   EFSSSLSKLLTIEDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFNR  145

Query  591  LVGGNRAIVVD  623
            LV GN+AIVVD
Sbjct  146  LVSGNKAIVVD  156



>ref|NP_001078139.1| putative double era-like GTPase [Arabidopsis thaliana]
 gb|AEE75147.1| GTP-binding protein [Arabidopsis thaliana]
Length=587

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  572
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVG NRAIVVD
Sbjct  172  SALFNRLVGENRAIVVD  188



>ref|NP_187815.2| putative double era-like GTPase [Arabidopsis thaliana]
 gb|ACI49783.1| At3g12080 [Arabidopsis thaliana]
 gb|AEE75146.1| GTP-binding protein [Arabidopsis thaliana]
Length=663

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  572
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVG NRAIVVD
Sbjct  172  SALFNRLVGENRAIVVD  188



>ref|XP_004169435.1| PREDICTED: GTPase Der-like, partial [Cucumis sativus]
Length=414

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  569
            AK   RE+S SLSR+L  +D+ + + ET ++K+ + T   + +PDHLLP+V IVGRPNVG
Sbjct  110  AKDVLREYSSSLSRELIIDDELSDQSETGRKKKKRKTTPRNVIPDHLLPRVAIVGRPNVG  169

Query  570  KSALFNRLVGGNRAIVVD  623
            KSA+FNRLVGGNRAIVVD
Sbjct  170  KSAMFNRLVGGNRAIVVD  187



>ref|XP_004507094.1| PREDICTED: GTPase Der-like [Cicer arietinum]
Length=653

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRK-QKRLKSTSSV-PDHLLPKVVIVGRPNVGK  572
            AK    E+S SLSR L  +D+K+  KET K  KR K    + PD+LLP++ IVGRPNVGK
Sbjct  103  AKDVVLEYSNSLSRVLSIDDEKSDVKETAKTSKRSKQKKKIIPDNLLPRIAIVGRPNVGK  162

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  163  SALFNRLVGGNRAIVVD  179



>gb|KEH30215.1| GTPase Der protein [Medicago truncatula]
Length=646

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQ-KRLKSTSSV-PDHLLPKVVIVGRPNVGK  572
            AK+ A E+S SLSR L  ED+++  KET K  KR K    + PD+LLP++ IVGRPNVGK
Sbjct  92   AKEVALEYSSSLSRVLTIEDERSDVKETGKNSKRSKPKRKIIPDNLLPRIAIVGRPNVGK  151

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGN+AIVVD
Sbjct  152  SALFNRLVGGNKAIVVD  168



>ref|XP_002882766.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59025.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
Length=661

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  572
            A+   R+++  LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  110  ARDIVRDYATILSRELKLEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  169

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVG NRAIVVD
Sbjct  170  SALFNRLVGENRAIVVD  186



>ref|XP_004142117.1| PREDICTED: GTPase Der-like [Cucumis sativus]
Length=660

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  569
            AK   RE+S SLSR+L  +D+ + + ET ++K+ + T   + +PDHLLP+V IVGRPNVG
Sbjct  110  AKDVLREYSSSLSRELIIDDELSDQSETGRKKKKRKTTPRNVIPDHLLPRVAIVGRPNVG  169

Query  570  KSALFNRLVGGNRAIVVD  623
            KSA+FNRLVGGNRAIVVD
Sbjct  170  KSAMFNRLVGGNRAIVVD  187



>gb|KGN54174.1| hypothetical protein Csa_4G291380 [Cucumis sativus]
Length=697

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  569
            AK   RE+S SLSR+L  +D+ + + ET ++K+ + T   + +PDHLLP+V IVGRPNVG
Sbjct  147  AKDVLREYSSSLSRELIIDDELSDQSETGRKKKKRKTTPRNVIPDHLLPRVAIVGRPNVG  206

Query  570  KSALFNRLVGGNRAIVVD  623
            KSA+FNRLVGGNRAIVVD
Sbjct  207  KSAMFNRLVGGNRAIVVD  224



>ref|XP_010486897.1| PREDICTED: uncharacterized protein LOC104764969 [Camelina sativa]
Length=663

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    KETR K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  113  ARDIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  172

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  173  ALFNRLVGENRAIVVD  188



>ref|XP_010498493.1| PREDICTED: uncharacterized protein LOC104776175 [Camelina sativa]
Length=656

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    KETR K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  106  ARDIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  165

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  166  ALFNRLVGENRAIVVD  181



>ref|XP_006297160.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
 gb|EOA30058.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
Length=655

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    K TR K KR   T+ +P+HLL +V IVGRPNVGKS
Sbjct  106  ARDIVRDYATTLSRELKLEDELIEGKATRRKGKRQAKTTQIPEHLLQRVAIVGRPNVGKS  165

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  166  ALFNRLVGENRAIVVD  181



>ref|XP_010464959.1| PREDICTED: uncharacterized protein LOC104745422 [Camelina sativa]
Length=656

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    KETR K KR      +P+HLL +V IVGRPNVGKS
Sbjct  107  ARAIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNKEIPEHLLQRVAIVGRPNVGKS  166

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  167  ALFNRLVGENRAIVVD  182



>ref|XP_006407372.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
 gb|ESQ48825.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
Length=664

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+  AR+++ +LSR+L+ ED+    KE+R K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  114  ARDIARDYATTLSRELKLEDEIIEGKESRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  173

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG N+AIVVD
Sbjct  174  ALFNRLVGENKAIVVD  189



>ref|XP_007132015.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
 gb|ESW04009.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
Length=633

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  569
            AK AA+ +S SLS+ L  ED++  + E   Q R +S   T S+PD+LL +V IVGRPNVG
Sbjct  82   AKDAAQAYSSSLSQVLTIEDEEKNDHEETAQSRSRSARRTKSIPDNLLQRVAIVGRPNVG  141

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVG NRAIVVD
Sbjct  142  KSALFNRLVGRNRAIVVD  159



>ref|XP_011469724.1| PREDICTED: uncharacterized protein LOC101310757 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=628

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 3/71 (4%)
 Frame = +3

Query  417  EFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFNR  590
            EFS SLS+ L T D+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFNR
Sbjct  86   EFSSSLSKLL-TIDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFNR  144

Query  591  LVGGNRAIVVD  623
            LV GN+AIVVD
Sbjct  145  LVSGNKAIVVD  155



>gb|KFK38573.1| hypothetical protein AALP_AA3G131000 [Arabis alpina]
Length=658

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    KE+R K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  108  ARDIVRDYASTLSRELKLEDEIVEGKESRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  167

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG N+AIVVD
Sbjct  168  ALFNRLVGENKAIVVD  183



>emb|CDY01098.1| BnaC05g41020D [Brassica napus]
Length=656

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  569
            A+  AR+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  104  ARDIARDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQAQIPEHLLQRVAIVGRPNVG  163

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVG N+AIVVD
Sbjct  164  KSALFNRLVGENKAIVVD  181



>ref|XP_002449905.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
 gb|EES08893.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
Length=684

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 5/77 (6%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  572
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  115  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  171

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  172  SALFNRLVGGNRAIVVD  188



>tpg|DAA42328.1| TPA: hypothetical protein ZEAMMB73_012049 [Zea mays]
Length=653

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 5/77 (6%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  572
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  109  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  165

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  166  SALFNRLVGGNRAIVVD  182



>ref|XP_004979812.1| PREDICTED: uncharacterized protein LOC101764561 [Setaria italica]
Length=661

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 5/77 (6%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  572
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  117  ARGAATDLAKRLARELHIDDDV---REKRRNIRDKTSVSKQIPDNLLPKVAIIGRPNVGK  173

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  174  SALFNRLVGGNRAIVVD  190



>ref|NP_001146320.1| uncharacterized protein LOC100279896 [Zea mays]
 gb|ACL53683.1| unknown [Zea mays]
Length=653

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 5/77 (6%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  572
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  109  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  165

Query  573  SALFNRLVGGNRAIVVD  623
            SALFNRLVGGNRAIVVD
Sbjct  166  SALFNRLVGGNRAIVVD  182



>emb|CDY08458.1| BnaA05g26940D [Brassica napus]
Length=659

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  569
            A+   R+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  107  ARDIVRDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQTQIPEHLLQRVAIVGRPNVG  166

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVG N+AIVVD
Sbjct  167  KSALFNRLVGENKAIVVD  184



>ref|XP_009146648.1| PREDICTED: uncharacterized protein LOC103870279 [Brassica rapa]
Length=657

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 60/78 (77%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  569
            A+   R+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  105  ARDIVRDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQTQIPEHLLQRVAIVGRPNVG  164

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVG N+AIVVD
Sbjct  165  KSALFNRLVGENKAIVVD  182



>gb|EEC68516.1| hypothetical protein OsI_36791 [Oryza sativa Indica Group]
Length=676

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 5/74 (7%)
 Frame = +3

Query  408  AAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGKSAL  581
            A  + SE LSR+LR +DD    ++ R+  R K+++S  +PD+LLP+V I+GRPNVGKSAL
Sbjct  121  AVADLSERLSRELRIDDDV---RDKRRIIRDKTSASKHIPDNLLPRVAIIGRPNVGKSAL  177

Query  582  FNRLVGGNRAIVVD  623
            FNRLVGGNRAIVVD
Sbjct  178  FNRLVGGNRAIVVD  191



>ref|XP_009394388.1| PREDICTED: uncharacterized protein LOC103979879 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=634

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS------VPDHLLPKVVIVGRP  560
            A  A R++S+SLS ++  ED+     E RK    K          +PDHLLP+V IVGRP
Sbjct  103  AIDAVRQYSQSLSTEMGFEDEV---NERRKHSSEKQKLKKSSSKHIPDHLLPRVTIVGRP  159

Query  561  NVGKSALFNRLVGGNRAIVVD  623
            NVGKSALFNRLVGGNRAIVVD
Sbjct  160  NVGKSALFNRLVGGNRAIVVD  180



>gb|AAG51052.1|AC069473_14 GTPase, putative; 34281-30152 [Arabidopsis thaliana]
Length=659

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 4/76 (5%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  575
            A+   R+++ +LSR+L+ ED+    KETR K KRL        HLL +V IVGRPNVGKS
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNVK---HLLQRVAIVGRPNVGKS  168

Query  576  ALFNRLVGGNRAIVVD  623
            ALFNRLVG NRAIVVD
Sbjct  169  ALFNRLVGENRAIVVD  184



>ref|XP_006592177.1| PREDICTED: uncharacterized protein LOC100777588 isoform X2 [Glycine 
max]
Length=572

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  569
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  82   AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  141

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGNRAIVVD
Sbjct  142  KSALFNRLVGGNRAIVVD  159



>ref|XP_003539473.1| PREDICTED: uncharacterized protein LOC100777588 isoform X1 [Glycine 
max]
Length=632

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  569
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  82   AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  141

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGNRAIVVD
Sbjct  142  KSALFNRLVGGNRAIVVD  159



>gb|KHN21905.1| GTPase Der [Glycine soja]
Length=518

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  569
            AK A + +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  81   AKDAVQAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  140

Query  570  KSALFNRLVGGNRAIVVD  623
            KSAL+NRLVGGNRAIVVD
Sbjct  141  KSALYNRLVGGNRAIVVD  158



>gb|KHN25243.1| GTPase Der [Glycine soja]
Length=957

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  569
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  407  AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  466

Query  570  KSALFNRLVGGNRAIVVD  623
            KSALFNRLVGGNRAIVVD
Sbjct  467  KSALFNRLVGGNRAIVVD  484



>dbj|BAB01956.1| GTP-binding protein-like [Arabidopsis thaliana]
Length=537

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +3

Query  453  EDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGKSALFNRLVG NRAIVVD
Sbjct  4    EDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGKSALFNRLVGENRAIVVD  62



>ref|XP_009394390.1| PREDICTED: uncharacterized protein LOC103979879 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +3

Query  510  SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +S+PDHLLP+V IVGRPNVGKSALFNRLVGGNRAIVVD
Sbjct  15   ASIPDHLLPRVTIVGRPNVGKSALFNRLVGGNRAIVVD  52



>ref|XP_009394391.1| PREDICTED: uncharacterized protein LOC103979879 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  513  SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S+PDHLLP+V IVGRPNVGKSALFNRLVGGNRAIVVD
Sbjct  2    SIPDHLLPRVTIVGRPNVGKSALFNRLVGGNRAIVVD  38



>ref|XP_008813437.1| PREDICTED: uncharacterized protein LOC103724064 isoform X2 [Phoenix 
dactylifera]
Length=479

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +PDHLLP++ IVGRPNVGKSALFNRLVGGNRAIVVD
Sbjct  43   IPDHLLPRIAIVGRPNVGKSALFNRLVGGNRAIVVD  78



>gb|EMS63685.1| GTPase Der [Triticum urartu]
Length=640

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 7/66 (11%)
 Frame = +3

Query  438  RQLRTEDDKTGEKETRKQKRLKSTSS----VPDHLLPKVVIVGRPNVGKSALFNRLVGGN  605
            R+LR + D    +E R+  R K+++S    +PD  LPKV ++GRPNVGKSALFNRLVGGN
Sbjct  110  RELRLDGDV---REKRRTMRDKTSTSKHVGIPDSKLPKVAVIGRPNVGKSALFNRLVGGN  166

Query  606  RAIVVD  623
            RAIVVD
Sbjct  167  RAIVVD  172



>ref|XP_010907852.1| PREDICTED: uncharacterized protein LOC105034405 isoform X1 [Elaeis 
guineensis]
Length=657

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 60/79 (76%), Gaps = 4/79 (5%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS----VPDHLLPKVVIVGRPNV  566
            A+   RE+S SLSR+L  E++   +K+   +K+ + +SS    +PDHLLP++ IVGRPNV
Sbjct  108  ARDVVREYSASLSRELDIEEEIDEKKKFSGKKKSQRSSSKHFQIPDHLLPRIAIVGRPNV  167

Query  567  GKSALFNRLVGGNRAIVVD  623
            GKSALFNRLVGG+RAIVVD
Sbjct  168  GKSALFNRLVGGSRAIVVD  186



>ref|XP_010907854.1| PREDICTED: uncharacterized protein LOC105034405 isoform X3 [Elaeis 
guineensis]
Length=525

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +PDHLLP++ IVGRPNVGKSALFNRLVGG+RAIVVD
Sbjct  19   IPDHLLPRIAIVGRPNVGKSALFNRLVGGSRAIVVD  54



>ref|XP_010907853.1| PREDICTED: uncharacterized protein LOC105034405 isoform X2 [Elaeis 
guineensis]
Length=549

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +PDHLLP++ IVGRPNVGKSALFNRLVGG+RAIVVD
Sbjct  43   IPDHLLPRIAIVGRPNVGKSALFNRLVGGSRAIVVD  78



>ref|XP_010237503.1| PREDICTED: uncharacterized protein LOC100845933 isoform X2 [Brachypodium 
distachyon]
Length=645

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 5/63 (8%)
 Frame = +3

Query  441  QLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAI  614
            +LR + D    +E R+  R K+++S  +PD+ LPKV I+GRPNVGKSALFNRLVG NRAI
Sbjct  115  ELRVDGDV---REKRRTMRDKTSTSKHIPDNNLPKVAIIGRPNVGKSALFNRLVGSNRAI  171

Query  615  VVD  623
            VVD
Sbjct  172  VVD  174



>ref|XP_010237502.1| PREDICTED: uncharacterized protein LOC100845933 isoform X1 [Brachypodium 
distachyon]
Length=648

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 5/63 (8%)
 Frame = +3

Query  441  QLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAI  614
            +LR + D    +E R+  R K+++S  +PD+ LPKV I+GRPNVGKSALFNRLVG NRAI
Sbjct  115  ELRVDGDV---REKRRTMRDKTSTSKHIPDNNLPKVAIIGRPNVGKSALFNRLVGSNRAI  171

Query  615  VVD  623
            VVD
Sbjct  172  VVD  174



>gb|EEE52426.1| hypothetical protein OsJ_34551 [Oryza sativa Japonica Group]
Length=563

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = +3

Query  399  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  572
            A  A  + SE LSR+LR +DD    ++ R+  R K+++S  +PD+LLP+V I+GRPNVGK
Sbjct  117  ALGAVADLSERLSRELRIDDDV---RDKRRIIRDKTSASKHIPDNLLPRVAIIGRPNVGK  173

Query  573  SALFNRLVG  599
            SALFNRLVG
Sbjct  174  SALFNRLVG  182



>gb|EMT17683.1| GTP-binding protein engA [Aegilops tauschii]
Length=639

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  510  SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +++PD  LPKV ++GRPNVGKSALFNRLVGGNRAIVVD
Sbjct  139  NTIPDSKLPKVAVIGRPNVGKSALFNRLVGGNRAIVVD  176



>ref|XP_001770231.1| predicted protein [Physcomitrella patens]
 gb|EDQ64906.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = +3

Query  444  LRTEDDKTGEKETRKQKRL-----KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNR  608
            +R ED        R QKRL      S   +PD LLPK+ IVGRPNVGKSALFNR+ GG+ 
Sbjct  1    MRREDAGLKGMAKRSQKRLAKEEFSSELRIPDALLPKIAIVGRPNVGKSALFNRIAGGDI  60

Query  609  AIVVD  623
            AIV D
Sbjct  61   AIVHD  65



>ref|XP_002985833.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
 gb|EFJ13010.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
Length=492

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  507  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            T  VP HLLPKV IVGRPNVGKSALFNR+VG N AIV D
Sbjct  1    TLQVPSHLLPKVAIVGRPNVGKSALFNRIVGRNMAIVHD  39



>ref|XP_002984773.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
 gb|EFJ14023.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
Length=490

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            VP HLLPKV IVGRPNVGKSALFNR+VG N AIV D
Sbjct  2    VPSHLLPKVAIVGRPNVGKSALFNRIVGRNMAIVHD  37



>ref|XP_001420333.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98626.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=555

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++K  +  S VPD  LP+V +VGRPNVGKSALFNRL G  RAIV D
Sbjct  71   RRKTRRDWSKVPDEALPRVAVVGRPNVGKSALFNRLTGTKRAIVYD  116



>ref|XP_005843504.1| hypothetical protein CHLNCDRAFT_37436 [Chlorella variabilis]
 gb|EFN51402.1| hypothetical protein CHLNCDRAFT_37436 [Chlorella variabilis]
Length=540

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            VPD LLPKV IVGRPNVGKSALFNR+VG   AIV D
Sbjct  96   VPDELLPKVAIVGRPNVGKSALFNRIVGRQVAIVYD  131



>ref|XP_007509383.1| GTP-binding protein EngA [Bathycoccus prasinos]
 emb|CCO19186.1| GTP-binding protein EngA [Bathycoccus prasinos]
Length=816

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  513  SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++P  LLPKV +VGRPNVGKSALFNRL G  RAIV D
Sbjct  309  TIPQELLPKVAVVGRPNVGKSALFNRLTGTKRAIVFD  345



>emb|CEF99667.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=515

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++K  +  S VPD  LP+V +VGRPNVGKSALFNRL G  RAIV D
Sbjct  29   RRKTRRDWSKVPDAALPRVAVVGRPNVGKSALFNRLTGTKRAIVYD  74



>gb|KIY92949.1| GTP-binding protein [Monoraphidium neglectum]
Length=133

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  474  KETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            K TR  K  K   S  D LLP V IVGRPNVGKSALFNRLV    A+V D
Sbjct  20   KRTRLPKASKGPPSDEDALLPMVAIVGRPNVGKSALFNRLVRKKEALVYD  69



>ref|XP_005651191.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE26647.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
Length=610

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  459  DKTGEKETRKQK-RLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D    K TR+ +  + + + +P   LPKV IVGRPNVGKSALFNR+ G N AIV D
Sbjct  109  DAKKSKRTREARGSIPTDNGIPLADLPKVAIVGRPNVGKSALFNRITGSNLAIVYD  164



>ref|WP_015442115.1| ribosome-associated GTPase EngA [Ilumatobacter coccineus]
 dbj|BAN02868.1| GTP-binding protein EngA [Ilumatobacter coccineus YM16-304]
Length=476

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            VP+  LP VVI+GRPNVGKS LFNR+VG  +AIV D
Sbjct  28   VPEAELPTVVIIGRPNVGKSTLFNRVVGSQQAIVED  63


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P+V IVGRPNVGKS LFNRLVG +RA+V D
Sbjct  224  PRVAIVGRPNVGKSTLFNRLVGEDRAVVHD  253



>ref|XP_003082033.1| GTP-binding protein-like (ISS) [Ostreococcus tauri]
Length=500

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  522  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D  LP+V +VGRPNVGKSALFNRL G  RAIV D
Sbjct  26   DAALPRVAVVGRPNVGKSALFNRLTGTKRAIVYD  59



>ref|WP_038133265.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA168-F10]
Length=65

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP V IVGRPNVGKS +FNRLVG  +AIV D
Sbjct  1    MLPTVSIVGRPNVGKSTIFNRLVGERQAIVHD  32



>ref|XP_010259076.1| PREDICTED: uncharacterized protein LOC104598616 [Nelumbo nucifera]
Length=660

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 5/60 (8%)
 Frame = +3

Query  459  DKTGEKETRKQKRLKSTS-----SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D  G  ET++ KR+++ S      V   LLP V++VGRPNVGKSALFNR +    A+V +
Sbjct  125  DTAGSAETKRVKRIRNKSFVEFSKVDTELLPTVILVGRPNVGKSALFNRFIRRREALVYN  184



>ref|WP_015743770.1| ribosome-associated GTPase EngA [Candidatus Methylomirabilis 
oxyfera]
 emb|CBE68269.1| GTP-binding protein engA [Candidatus Methylomirabilis oxyfera]
Length=439

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V IVGRPNVGKS LFNRLVGG RAIV D
Sbjct  3    LPIVTIVGRPNVGKSTLFNRLVGGRRAIVHD  33



>ref|XP_003061511.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54141.1| predicted protein [Micromonas pusilla CCMP1545]
Length=470

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP+V IVGRPNVGKSALFNRL G  RAIV D
Sbjct  3    LPRVAIVGRPNVGKSALFNRLTGTKRAIVYD  33



>ref|XP_005848465.1| hypothetical protein CHLNCDRAFT_144853 [Chlorella variabilis]
 gb|EFN56363.1| hypothetical protein CHLNCDRAFT_144853 [Chlorella variabilis]
Length=581

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  507  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++++PD LLP V I+GRPNVGKSALFNRLV    A+V D
Sbjct  30   STALPDSLLPVVAIIGRPNVGKSALFNRLVRRREAVVHD  68



>ref|WP_029665584.1| hypothetical protein [Candidatus Calescibacterium nevadense]
Length=467

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  E  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLEVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>ref|WP_029233883.1| hypothetical protein [Calescamantes bacterium JGI 0000106-H18]
Length=467

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  E  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLEVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>ref|WP_022803927.1| hypothetical protein [Calescamantes bacterium JGI 0000106-G12]
Length=467

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  E  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLEVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>ref|WP_029666999.1| hypothetical protein [Calescamantes bacterium JGI 0000106-N7]
Length=467

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  E  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLEVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>ref|WP_029230440.1| MULTISPECIES: hypothetical protein [unclassified Bacteria]
Length=467

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  E  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLEVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>ref|WP_011413185.1| ribosome-associated GTPase EngA [Erythrobacter litoralis]
 gb|ABC62309.1| predicted GTPase [Erythrobacter litoralis HTCC2594]
Length=485

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P HL P V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MPHHLKPTVIIIGRPNVGKSTLFNRLVGKKLALVDD  36



>ref|XP_002519374.1| GTP-binding protein enga, putative [Ricinus communis]
 gb|EEF42991.1| GTP-binding protein enga, putative [Ricinus communis]
Length=635

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  450  TEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +E D   ++E    ++L   + +  +LLP V+I+GRPNVGKSALFNRL+    A+V +
Sbjct  99   SELDSVVKEEKVSDEKLIDFTKIDSNLLPTVIIIGRPNVGKSALFNRLIRRREALVYN  156



>gb|KIZ00088.1| GTP-binding protein [Monoraphidium neglectum]
Length=613

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +S   +P   LPKV +VGRPNVGKSA+FNR+ G + A+V D
Sbjct  118  RSAQQLPLSALPKVAVVGRPNVGKSAMFNRIAGSSVAVVYD  158



>ref|WP_003620437.1| ribosome-associated GTPase EngA [Komagataeibacter hansenii]
 gb|EFG83823.1| GTP-binding protein EngA [Komagataeibacter hansenii ATCC 23769]
Length=470

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  519  PDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P H LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  9    PGHDLPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_025825836.1| ribosome-associated GTPase EngA [Acetobacter persici]
Length=477

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + VP   LP V IVGRPNVGKS LFNRLVG  +A+V D
Sbjct  1    MRPVAPVPSADLPLVAIVGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_043550735.1| ribosome-associated GTPase EngA [Acetobacter malorum]
 gb|KFL90262.1| GTP-binding protein EngA [Acetobacter malorum]
Length=480

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + VP   LP V IVGRPNVGKS LFNRLVG  +A+V D
Sbjct  1    MRPVAPVPSADLPLVAIVGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_022806683.1| hypothetical protein [Calescamantes bacterium SCGC AAA471-M6]
Length=467

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +3

Query  405  QAAREFSESLSRQLRTEDDKTGEKETRKQ-----KRLKSTSSVPDHLLPKVVIVGRPNVG  569
            +A+ +F E +  +L  E+   G  +  K+     +R KST  + D   PK VIVG+PNVG
Sbjct  173  EASIDFPEDVDWELPYENLYQGVLQVSKKVKEIAQRWKSTKVLIDG--PKCVIVGKPNVG  230

Query  570  KSALFNRLVGGNRAIV  617
            KS++FN ++G +RAIV
Sbjct  231  KSSIFNAILGQSRAIV  246



>gb|EQD25394.1| GTP-binding protein engA [Leptospirillum sp. Group IV 'UBA BS']
Length=320

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V I+GRPNVGKS LFNRL+G NRAIV D
Sbjct  11   LPLVAILGRPNVGKSTLFNRLLGENRAIVED  41



>ref|WP_008602967.1| ribosome-associated GTPase EngA [alpha proteobacterium JLT2015]
 gb|EMD82245.1| GTP-binding protein EngA [alpha proteobacterium JLT2015]
Length=450

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LPKVVI+GRPNVGKS LFNRLVG   A+V D
Sbjct  3    LPKVVIIGRPNVGKSTLFNRLVGKRIALVDD  33



>ref|WP_010024483.1| GTP-binding protein Der, partial [Sporolactobacillus inulinus]
Length=97

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P + IVGRPNVGKS LFNR+VGG  AIV D
Sbjct  4    PTIAIVGRPNVGKSTLFNRIVGGRLAIVED  33



>ref|WP_015423156.1| ribosome-associated GTPase EngA [uncultured Termite group 1 bacterium]
 ref|YP_001956088.1| GTP-binding protein EngA [uncultured Termite group 1 bacterium 
phylotype Rs-D17]
 dbj|BAG13627.1| GTP-binding protein EngA [uncultured Termite group 1 bacterium 
phylotype Rs-D17]
Length=441

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIV  617
            +L KV IVGRPNVGKSALFNRL+G  +AI+
Sbjct  3    MLTKVAIVGRPNVGKSALFNRLIGRKKAII  32



>gb|KDP32444.1| hypothetical protein JCGZ_13369 [Jatropha curcas]
Length=395

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  465  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIV  617
            T EKE    ++L   + +   LLP V++VGRPNVGKSALFNRL+    A+V
Sbjct  11   TVEKEKVVHEKLLDFTKIDIDLLPTVILVGRPNVGKSALFNRLIRRREALV  61



>ref|WP_040492190.1| ribosome-associated GTPase EngA [Ilumatobacter nonamiensis]
Length=456

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP VVI+GRPNVGKS LFNR++G  +AIV D
Sbjct  14   LPTVVIIGRPNVGKSTLFNRIIGSQQAIVED  44


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P++ IVGRPNVGKS LFNRLVG  RA+V D
Sbjct  204  PRIAIVGRPNVGKSTLFNRLVGEERAVVHD  233



>ref|WP_043285078.1| ribosome-associated GTPase EngA [Reyranella massiliensis]
Length=467

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P+V IVGRPNVGKS LFNRLVG  RAIV D
Sbjct  1    MPRVAIVGRPNVGKSTLFNRLVGRRRAIVDD  31



>ref|WP_026396422.1| ribosome-associated GTPase EngA [Acetobacter nitrogenifigens]
Length=536

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P   LP VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  17   LPKEGLPTVVIAGRPNVGKSTLFNRLVGRRQALVAD  52



>ref|WP_012744727.1| ribosome-associated GTPase EngA [Kosmotoga olearia]
 sp|C5CIV1.1|DER_KOSOT RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Kosmotoga olearia TBF 19.5.1]
 gb|ACR78940.1| small GTP-binding protein [Kosmotoga olearia TBF 19.5.1]
Length=442

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +  V+IVGRPNVGKS LFNRLVGG RAI+ D
Sbjct  1    MATVLIVGRPNVGKSTLFNRLVGGRRAIIDD  31



>gb|EES52176.1| GTP-binding protein (EngA) [Leptospirillum ferrodiazotrophum]
Length=468

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V I+GRPNVGKS LFNRL+G NRAI +D
Sbjct  11   LPLVAILGRPNVGKSTLFNRLLGENRAITMD  41



>ref|WP_013950922.1| ribosome-associated GTPase EngA [Candidatus Midichloria mitochondrii]
 gb|AEI88710.1| GTP-binding protein [Candidatus Midichloria mitochondrii IricVA]
Length=448

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            PKVVIVG+PNVGKSALFNRL G   AIV D
Sbjct  4    PKVVIVGKPNVGKSALFNRLCGRKIAIVTD  33



>ref|WP_014730754.1| ribosome-associated GTPase EngA [Mesotoga prima]
 gb|AFK06748.1| ribosome-associated GTPase EngA [Mesotoga prima MesG1.Ag.4.2]
Length=441

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +  V+I+GRPNVGKS LFNRLVGG RAIV D
Sbjct  1    MATVLIIGRPNVGKSTLFNRLVGGRRAIVDD  31



>ref|WP_022325807.1| ribosome-associated GTPase EngA [Clostridium sp. CAG:798]
 emb|CDD16222.1| gTPase Der [Clostridium sp. CAG:798]
Length=442

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
             T+   D L  KV I+GRPNVGKS+L N+++G NRAIV D
Sbjct  168  ETTDTSDDLTIKVAIIGRPNVGKSSLVNKILGENRAIVSD  207



>ref|XP_005708451.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME31931.1| GTP-binding protein [Galdieria sulphuraria]
Length=541

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = +3

Query  420  FSESLSRQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVG  599
            FS+ +++Q  T+DD T + E + +K +  T  +  +L P V IVGRPNVGKS L NRL  
Sbjct  54   FSQLVAKQNSTKDDLTSQTEEKTRKEIPKTRIIRRNL-PLVAIVGRPNVGKSTLLNRLTR  112

Query  600  GNR--AIVVD  623
              R  AI VD
Sbjct  113  DFRFGAIAVD  122



>ref|WP_006492786.1| ribosome-associated GTPase EngA [Mesotoga infera]
 emb|CCU86284.1| GTPase Der [Mesotoga infera]
Length=441

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +  V+I+GRPNVGKS LFNRLVGG RAIV D
Sbjct  1    MATVLIIGRPNVGKSTLFNRLVGGRRAIVDD  31



>ref|WP_038039529.1| ribosome-associated GTPase EngA, partial [Thermomicrobiales bacterium 
KI4]
Length=453

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P+  LP V IVGRPNVGKS LFNR++G  RAIV D
Sbjct  1    MPEGPLPLVAIVGRPNVGKSTLFNRILGQRRAIVED  36



>ref|XP_010088699.1| GTPase Der [Morus notabilis]
 gb|EXB36880.1| GTPase Der [Morus notabilis]
Length=585

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  456  DDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D + G+   R +K +  T  V  +LLP VVI+GRPNVGKSALFNRL+    A+V +
Sbjct  119  DSEIGKAHDRYRKPIDFTK-VKKNLLPTVVIIGRPNVGKSALFNRLIRRREALVYN  173



>ref|WP_039278381.1| ribosome-associated GTPase EngA [Novosphingobium malaysiense]
 gb|KHK93038.1| GTP-binding protein Der [Novosphingobium malaysiense]
Length=458

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLVGKRLALVDD  32



>ref|WP_013833055.1| MULTISPECIES: ribosome-associated GTPase EngA [Novosphingobium]
 emb|CCA92730.1| GTP-binding protein EngA [Novosphingobium sp. PP1Y]
 gb|AIT81267.1| GTP-binding protein Der [Novosphingobium pentaromativorans US6-1]
Length=458

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLVGKKLALVDD  32



>ref|XP_008238266.1| PREDICTED: uncharacterized protein LOC103336908 [Prunus mume]
Length=648

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +3

Query  459  DKTGEKETRKQKRLKST----SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D  G+  T+  +R+  T    + V  +LLP VV++GRPNVGKSALFNRL+    A+V +
Sbjct  111  DSDGDVTTKTIRRVYQTPVDFTKVNKNLLPTVVLIGRPNVGKSALFNRLIRRREALVYN  169



>ref|WP_043360659.1| ribosome-associated GTPase EngA [Belnapia sp. F-4-1]
Length=446

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP +VI+GRPNVGKS+LFNRLVG   AIV D
Sbjct  1    MLPTIVILGRPNVGKSSLFNRLVGRKIAIVDD  32



>ref|XP_007209043.1| hypothetical protein PRUPE_ppa002689mg [Prunus persica]
 gb|EMJ10242.1| hypothetical protein PRUPE_ppa002689mg [Prunus persica]
Length=644

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +3

Query  459  DKTGEKETRKQKRLKST----SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            D  G+  T+  +R+  T    + V  +LLP VV++GRPNVGKSALFNRL+    A+V +
Sbjct  110  DSDGDVTTKTIRRVYQTPVDFTKVNKNLLPTVVLIGRPNVGKSALFNRLIRRREALVYN  168



>ref|WP_008833521.1| MULTISPECIES: ribosome-associated GTPase EngA [Sphingomonadaceae]
 gb|EJU09032.1| GTP-binding protein Der [Sphingomonas sp. LH128]
 gb|EZP83670.1| GTP-binding protein EngA [Novosphingobium resinovorum]
Length=459

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLVGKKLALVDD  32



>ref|WP_033924188.1| ribosome-associated GTPase EngA [Sphingomonas sp. 35-24ZXX]
Length=468

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP++VI+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPEIVIIGRPNVGKSTLFNRLVGKKLALVDD  32



>ref|WP_043341680.1| ribosome-associated GTPase EngA [Belnapia moabensis]
Length=446

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP +VI+GRPNVGKS+LFNRLVG   AIV D
Sbjct  1    MLPTIVILGRPNVGKSSLFNRLVGRKIAIVDD  32



>ref|WP_023837383.1| ribosome-associated GTPase EngA [Blastomonas sp. CACIA14H2]
 gb|ESZ87688.1| GTP-binding protein Der [Blastomonas sp. CACIA14H2]
Length=468

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP++VI+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPEIVIIGRPNVGKSTLFNRLVGKKLALVDD  32



>gb|EHJ62125.1| GTP-binding protein EngA [Novosphingobium pentaromativorans US6-1]
Length=476

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  19   MLPQVIIIGRPNVGKSTLFNRLVGKKLALVDD  50



>gb|KGB22406.1| GTP-binding protein EngA [Acetobacter tropicalis]
Length=484

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + +P   LP V IVGRPNVGKS LFNRLVG  +A+V D
Sbjct  8    MRPVAPLPSGDLPVVAIVGRPNVGKSTLFNRLVGRRQALVAD  49



>gb|ABI63193.1| GTP-binding protein [Granulibacter bethesdensis CGDNIH1]
Length=483

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++T   P   LP V I GRPNVGKS LFNRLVG   A+V D
Sbjct  9    ETTDEAPAERLPIVAIAGRPNVGKSTLFNRLVGRRMALVAD  49



>ref|WP_035055612.1| GTP-binding protein Der, partial [Desulfuromonas sp. TF]
Length=89

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++P V IVGRPNVGKS LFNR++G  +AIV D
Sbjct  1    MIPVVAIVGRPNVGKSTLFNRILGQRKAIVED  32



>ref|WP_021232171.1| ribosome-associated GTPase EngA [Novosphingobium lindaniclasticum]
 gb|EQB19620.1| GTP-binding protein Der [Novosphingobium lindaniclasticum LE124]
Length=458

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLVGKKLALVDD  32



>ref|WP_035381076.1| ribosome-associated GTPase EngA [Acetobacter tropicalis]
Length=477

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + +P   LP V IVGRPNVGKS LFNRLVG  +A+V D
Sbjct  1    MRPVAPLPSGDLPVVAIVGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_025826043.1| ribosome-associated GTPase EngA [Acetobacter okinawensis]
Length=471

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P   LP VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  7    IPTGDLPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_039391334.1| ribosome-associated GTPase EngA [Novosphingobium sp. MBES04]
 dbj|GAM05702.1| GTP-binding protein EngA [Novosphingobium sp. MBES04]
Length=460

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLVGKRLALVDD  32



>ref|WP_010513528.1| ribosome-associated GTPase EngA [Komagataeibacter oboediens]
Length=473

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|XP_010696202.1| PREDICTED: uncharacterized protein LOC104908749 [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  417  EFSESLSRQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLV  596
            EF+ ++S +L  E+     K     ++L   + V   LLP  +IVGRPNVGKSALFNRL+
Sbjct  118  EFNSNIS-ELAEENLIEVVKTKGLSRKLVDFTQVDKELLPTAIIVGRPNVGKSALFNRLI  176



>ref|WP_040870722.1| GTP-binding protein Der, partial [delta proteobacterium MLMS-1]
Length=100

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIV  617
            LP V +VGRPNVGKS+LFNR+ GG +AIV
Sbjct  7    LPLVALVGRPNVGKSSLFNRIAGGRKAIV  35



>ref|WP_039735651.1| ribosome-associated GTPase EngA [Komagataeibacter intermedius]
Length=473

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_014104624.1| ribosome-associated GTPase EngA [Komagataeibacter medellinensis]
 dbj|BAK83052.1| GTP-binding protein [Komagataeibacter medellinensis NBRC 3288]
Length=476

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  513  SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  7    SAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_041977481.1| ribosome-associated GTPase EngA [Pyrinomonas methylaliphatogenes]
 emb|CDM66290.1| ribosome-associated GTPase EngA [Pyrinomonas methylaliphatogenes]
Length=459

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V I+GRPNVGKS LFNRL+G  RAIV D
Sbjct  12   LPLVAIIGRPNVGKSTLFNRLIGQRRAIVGD  42



>ref|WP_025438660.1| ribosome-associated GTPase EngA [Komagataeibacter xylinus]
Length=474

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_010507796.1| ribosome-associated GTPase EngA [Komagataeibacter europaeus]
Length=474

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_010942865.1| ribosome-associated GTPase EngA [Geobacter sulfurreducens]
 ref|NP_953274.1| GTP-binding protein Der [Geobacter sulfurreducens PCA]
 sp|Q74AX4.1|DER_GEOSL RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Geobacter sulfurreducens PCA]
 gb|AAR35601.1| GTPase EngA [Geobacter sulfurreducens PCA]
 gb|ADI84983.1| GTPase EngA [Geobacter sulfurreducens KN400]
Length=438

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP V IVGRPNVGKS LFNRLVG  +AIV D
Sbjct  2    ILPIVAIVGRPNVGKSTLFNRLVGRRKAIVDD  33



>ref|WP_013406044.1| ribosome-associated GTPase EngA [Halanaerobium hydrogeniformans]
 gb|ADQ14967.1| ribosome-associated GTPase EngA [Halanaerobium hydrogeniformans]
Length=438

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  540  VVIVGRPNVGKSALFNRLVGGNRAIV  617
            V IVGRPNVGKS LFNRLVGG RAIV
Sbjct  6    VAIVGRPNVGKSTLFNRLVGGRRAIV  31



>ref|WP_026019733.1| ribosome-associated GTPase EngA [Komagataeibacter europaeus]
Length=474

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_011525430.1| ribosome-associated GTPase EngA [Candidatus Koribacter versatilis]
 gb|ABF43633.1| Small GTP-binding protein [Candidatus Koribacter versatilis Ellin345]
Length=511

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            K T ++P  L+  + IVGRPNVGKS LFNRLVG  RAIV D
Sbjct  6    KETVTLP--LVGMIAIVGRPNVGKSTLFNRLVGQRRAIVGD  44



>ref|WP_039643828.1| ribosome-associated GTPase EngA [Geobacter sp. GSS01]
 gb|KIE41831.1| GTP-binding protein Der [Geobacter sp. GSS01]
Length=438

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP V IVGRPNVGKS LFNRLVG  +AIV D
Sbjct  2    ILPIVAIVGRPNVGKSTLFNRLVGRRKAIVDD  33



>ref|WP_022658406.1| ribosome-associated GTPase EngA [Desulfovibrio desulfuricans]
Length=455

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP+V++VGRPNVGKS LFNRL+  NRAI  D
Sbjct  5    LPRVILVGRPNVGKSTLFNRLIRSNRAITHD  35



>ref|WP_034928178.1| MULTISPECIES: ribosome-associated GTPase EngA [Acetobacteraceae]
 gb|KDU94552.1| GTP-binding protein Der [Komagataeibacter rhaeticus AF1]
Length=476

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  504  STSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            S  S P   LP VVI GRPNVGKS +FNRLVG  +A+V D
Sbjct  4    SFPSAPVDALPVVVIAGRPNVGKSTIFNRLVGRRQALVAD  43



>ref|WP_010414923.1| ribosome-associated GTPase EngA [Citromicrobium sp. JLT1363]
Length=465

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPRVIIIGRPNVGKSTLFNRLVGKRLALVDD  32



>gb|EGE47758.1| GTP-binding protein EngA [Acetobacter pomorum DM001]
 gb|KGB27007.1| GTP-binding protein EngA [Acetobacter pomorum]
Length=479

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++K ++    +P   +P VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  4    RRKSMRPPPPLPTGDMPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  49



>ref|WP_017670574.1| ribosome-associated GTPase EngA [Blastomonas sp. AAP53]
Length=468

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP++VI+GRPNVGKS +FNRLVG   A+V D
Sbjct  1    MLPEIVIIGRPNVGKSTMFNRLVGKKLALVDD  32



>ref|WP_039905366.1| GTP-binding protein Der, partial [Acetobacter tropicalis]
Length=267

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + +P   LP V IVGRPNVGKS LFNRLVG  +A+V D
Sbjct  1    MRPVAPLPSGDLPVVAIVGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_005488816.1| ribosome-associated GTPase EngA [Halanaerobium saccharolyticum]
 emb|CCU79480.1| GTP-binding protein EngA [Halanaerobium saccharolyticum subsp. 
saccharolyticum DSM 6643]
Length=438

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  540  VVIVGRPNVGKSALFNRLVGGNRAIV  617
            V IVGRPNVGKS LFNRLVGG RAIV
Sbjct  6    VAIVGRPNVGKSTLFNRLVGGRRAIV  31



>ref|WP_040621345.1| ribosome-associated GTPase EngA [Smithella sp. ME-1]
Length=439

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P + IVGRPNVGKS LFNR+VG  +AIV+D
Sbjct  5    PVIAIVGRPNVGKSTLFNRIVGKQKAIVID  34



>ref|WP_020402934.1| ribosome-associated GTPase EngA [Gracilimonas tropica]
Length=435

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP V IVGRPNVGKS LFNRL+G  +AIV D
Sbjct  1    MLPVVSIVGRPNVGKSTLFNRLIGSRKAIVHD  32



>ref|WP_018282653.1| ribosome-associated GTPase EngA [zeta proteobacterium SCGC AB-137-C09]
Length=474

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V IVGRPNVGKS LFNRLVG  +AIV D
Sbjct  6    LPIVAIVGRPNVGKSTLFNRLVGSRKAIVGD  36



>ref|WP_027182070.1| ribosome-associated GTPase EngA [Desulfovibrio alaskensis]
Length=455

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LPK+ ++GRPNVGKS LFNRL+  NRAI  D
Sbjct  1    MLPKIALIGRPNVGKSTLFNRLIRSNRAITHD  32



>ref|WP_039096884.1| ribosome-associated GTPase EngA [Kirrobacter mercurialis]
 gb|KHL24460.1| GTP-binding protein Der [Kirrobacter mercurialis]
Length=459

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  525  HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
             +LP+VVI+GRPNVGKS LFNRLVG   A+V D
Sbjct  3    KVLPQVVIIGRPNVGKSTLFNRLVGRKLALVDD  35



>ref|WP_008492023.1| MULTISPECIES: ribosome-associated GTPase EngA [Acidocella]
 gb|EKN01404.1| GTP-binding protein Der [Acidocella sp. MX-AZ02]
Length=448

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP++VI GRPNVGKS LFNRLVG   A+V D
Sbjct  4    LPRIVIAGRPNVGKSTLFNRLVGSRLALVAD  34



>ref|WP_025208507.1| ribosome-associated GTPase EngA [Candidatus Hepatoplasma crinochetorum]
 gb|AHK22206.1| GTP-binding protein EngA [Candidatus Hepatoplasma crinochetorum 
Av]
Length=437

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +PKVVI+GRPNVGKS LFNRL+G   +I  D
Sbjct  4    IPKVVIIGRPNVGKSTLFNRLIGKKISITFD  34



>gb|AHC14743.1| GTP-binding protein EngA [Salinispira pacifica]
Length=507

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAI  614
            K+  ++    V   +LP+V IVGRPNVGKS LFNR +G  +AI
Sbjct  6    KEGLIRRLDEVEKAVLPRVAIVGRPNVGKSTLFNRFIGSRKAI  48



>ref|WP_043976345.1| GTP-binding protein Der [Novosphingobium sp. P6W]
 gb|KIS31472.1| GTP-binding protein Der [Novosphingobium sp. P6W]
Length=459

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS LFNRL+G   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTLFNRLIGKKLALVDD  32



>ref|WP_011366249.1| ribosome-associated GTPase EngA [Desulfovibrio alaskensis]
 gb|ABB36863.2| GTP-binding protein engA [Desulfovibrio alaskensis G20]
Length=455

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LPK+ ++GRPNVGKS LFNRL+  NRAI  D
Sbjct  1    MLPKIALIGRPNVGKSTLFNRLIRSNRAITHD  32



>ref|WP_020944166.1| ribosome-associated GTPase EngA [Acetobacter pasteurianus]
 ref|YP_008391490.1| GTP-binding protein EngA [Acetobacter pasteurianus 386B]
 emb|CCT58771.1| GTP-binding protein EngA [Acetobacter pasteurianus 386B]
Length=479

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++K ++    +P   +P VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  4    RRKSMRPPPPLPTGDMPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  49



>dbj|GAB27696.1| GTP-binding protein EngA [Acetobacter pasteurianus NBRC 101655]
 dbj|GAB30789.1| GTP-binding protein EngA [Acetobacter pasteurianus subsp. pasteurianus 
LMG 1262 = NBRC 106471]
Length=479

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  486  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++K ++    +P   +P VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  4    RRKSMRPPPPLPTGDMPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  49



>ref|WP_025861259.1| ribosome-associated GTPase EngA [Acetobacter papayae]
Length=468

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  498  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++  + +P   LP VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  1    MRPPAPLPTGDLPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  42



>ref|WP_008995546.1| ribosome-associated GTPase EngA [Novosphingobium sp. Rr 2-17]
 gb|EIZ78571.1| GTP-binding protein EngA [Novosphingobium sp. Rr 2-17]
Length=458

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP+V+I+GRPNVGKS +FNRLVG   A+V D
Sbjct  1    MLPQVIIIGRPNVGKSTMFNRLVGKKLALVDD  32



>ref|WP_007434646.1| ribosome-associated GTPase EngA [Acetobacteraceae bacterium AT-5844]
 gb|EHM03287.1| ribosome biogenesis GTPase Der [Acetobacteraceae bacterium AT-5844]
Length=447

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP++ I+GRPNVGKS LFNRLVG   AIV D
Sbjct  1    MLPRIAIIGRPNVGKSTLFNRLVGRKLAIVDD  32



>ref|WP_011526196.1| ribosome-associated GTPase EngA [Lawsonia intracellularis]
 sp|Q1MS56.1|DER_LAWIP RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Lawsonia intracellularis PHE/MN1-00]
 emb|CAJ54169.1| predicted GTPases [Lawsonia intracellularis PHE/MN1-00]
 gb|AGC49513.1| GTP-binding protein EngA [Lawsonia intracellularis N343]
Length=453

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LPK+ +VGRPNVGKS LFNRL+  NRAI  D
Sbjct  1    MLPKIALVGRPNVGKSTLFNRLIRKNRAITHD  32



>ref|WP_023172386.1| ribosome-associated GTPase EngA [Gloeobacter kilaueensis]
 gb|AGY57317.1| GTP-binding protein EngA [Gloeobacter kilaueensis JS1]
Length=456

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V IVGRPNVGKS L NRL GG+ AIV D
Sbjct  3    LPVVAIVGRPNVGKSTLLNRLAGGSEAIVYD  33



>ref|WP_026019256.1| ribosome-associated GTPase EngA [Acetobacter pasteurianus]
Length=472

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  516  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +P   +P VVI GRPNVGKS LFNRLVG  +A+V D
Sbjct  7    IPTGDMPVVVIAGRPNVGKSTLFNRLVGRRQALVAD  42



>gb|KJB46314.1| hypothetical protein B456_007G360100 [Gossypium raimondii]
Length=457

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  456  DDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            + KT E+ T   ++    + +  +LLP V+I+GRPNVGKSALFNRL+    A+V +
Sbjct  108  NSKTLEEATLANQKSIDFTKLDINLLPTVMIIGRPNVGKSALFNRLIRRREALVYN  163



>gb|AHJ67834.1| GTP-binding protein [Granulibacter bethesdensis CGDNIH2]
Length=487

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++T   P   LP V I GRPNVGKS LFNRLVG   A+V D
Sbjct  13   ETTDESPAERLPIVAIAGRPNVGKSTLFNRLVGRRMALVAD  53



>ref|WP_004513306.1| ribosome-associated GTPase EngA [Geobacter metallireducens]
 sp|Q39T85.1|DER_GEOMG RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Geobacter metallireducens GS-15]
 gb|ABB32539.1| GTPase EngA [Geobacter metallireducens GS-15]
 gb|EHP86434.1| ribosome-associated GTPase EngA [Geobacter metallireducens RCH3]
Length=439

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++P V IVGRPNVGKS LFNRLVG  +AIV D
Sbjct  1    MMPLVAIVGRPNVGKSTLFNRLVGRRKAIVDD  32



>gb|AHJ64199.1| GTP-binding protein [Granulibacter bethesdensis CGDNIH3]
Length=487

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++T   P   LP V I GRPNVGKS LFNRLVG   A+V D
Sbjct  13   ETTDESPAERLPIVAIAGRPNVGKSTLFNRLVGRRMALVAD  53



>gb|AHJ65213.1| GTP-binding protein [Granulibacter bethesdensis CGDNIH4]
Length=483

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  501  KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++T   P   LP V I GRPNVGKS LFNRLVG   A+V D
Sbjct  9    ETTDESPAERLPIVAIAGRPNVGKSTLFNRLVGRRMALVAD  49



>ref|WP_018979577.1| ribosome-associated GTPase EngA [Saccharibacter floricola]
Length=455

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V +VGRPNVGKS LFNRL+G  RAIV D
Sbjct  10   LPVVAVVGRPNVGKSTLFNRLIGRRRAIVSD  40



>ref|WP_027718750.1| ribosome-associated GTPase EngA [Desulfovirgula thermocuniculi]
Length=438

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRLVGG  AIV D
Sbjct  4    PIVAIVGRPNVGKSTLFNRLVGGRVAIVED  33



>ref|WP_013433167.1| MULTISPECIES: ribosome-associated GTPase EngA [Caldicellulosiruptor]
 gb|ADQ41442.1| ribosome-associated GTPase EngA [Caldicellulosiruptor kristjanssonii 
I77R1B]
 gb|AEM73056.1| GTP-binding protein engA [Caldicellulosiruptor lactoaceticus 
6A]
Length=440

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_023978351.1| MULTISPECIES: ribosome-associated GTPase EngA [Asaia]
 gb|ETC98655.1| GTP-binding protein Der [Asaia sp. SF2.1]
 emb|CDG38174.1| GTP-binding protein EngA [Asaia platycodi SF2.1]
Length=468

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
             LP VVI GRPNVGKS LFNRLVG  +AIV D
Sbjct  6    FLPLVVIAGRPNVGKSTLFNRLVGRRQAIVSD  37



>ref|WP_014552973.1| ribosome-associated GTPase EngA [Halanaerobium praevalens]
 gb|ADO76940.1| ribosome-associated GTPase EngA [Halanaerobium praevalens DSM 
2228]
Length=438

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  540  VVIVGRPNVGKSALFNRLVGGNRAIV  617
            V IVGRPNVGKS LFNRLVGG RAIV
Sbjct  6    VAIVGRPNVGKSTLFNRLVGGRRAIV  31



>ref|WP_012625103.1| ribosome-associated GTPase EngA [Desulfovibrio desulfuricans]
 gb|ACL49379.1| small GTP-binding protein [Desulfovibrio desulfuricans subsp. 
desulfuricans str. ATCC 27774]
Length=454

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP++++VGRPNVGKS LFNRL+  NRAI  D
Sbjct  5    LPRIILVGRPNVGKSTLFNRLIRSNRAITHD  35



>gb|ACL09206.1| small GTP-binding protein [Desulfovibrio vulgaris str. 'Miyazaki 
F']
Length=506

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LPK+ +VGRPNVGKS LFNRL+  NRAI  D
Sbjct  17   LPKIALVGRPNVGKSTLFNRLIRANRAITHD  47



>ref|WP_037527885.1| ribosome-associated GTPase EngA [Sphingomonas wittichii]
Length=454

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP VVIVGRPNVGKS LFNRLVG   A+V D
Sbjct  4    LPTVVIVGRPNVGKSTLFNRLVGKKLALVDD  34



>gb|AAW61706.1| GTP-binding protein [Gluconobacter oxydans 621H]
 gb|AHK71955.1| GTP-binding protein EngA [Gluconobacter oxydans DSM 3504]
Length=463

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP VVI GRPNVGKS LFNRLVG  +AIV D
Sbjct  10   LPVVVIAGRPNVGKSTLFNRLVGRRQAIVSD  40



>ref|WP_034953656.1| ribosome-associated GTPase EngA [Gluconobacter oxydans]
Length=459

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP VVI GRPNVGKS LFNRLVG  +AIV D
Sbjct  6    LPVVVIAGRPNVGKSTLFNRLVGRRQAIVSD  36



>ref|WP_039742878.1| ribosome-associated GTPase EngA [Geobacter pickeringii]
 gb|AJE03686.1| GTP-binding protein Der [Geobacter pickeringii]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            ++P V IVGRPNVGKS LFNRLVG  +AIV D
Sbjct  1    MIPIVAIVGRPNVGKSTLFNRLVGRRKAIVDD  32



>ref|WP_013430826.1| ribosome-associated GTPase EngA [Caldicellulosiruptor kronotskyensis]
 gb|ADQ46746.1| ribosome-associated GTPase EngA [Caldicellulosiruptor kronotskyensis 
2002]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_013411579.1| ribosome-associated GTPase EngA [Caldicellulosiruptor owensensis]
 gb|ADQ04174.1| ribosome-associated GTPase EngA [Caldicellulosiruptor owensensis 
OL]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_015907304.1| ribosome-associated GTPase EngA [Caldicellulosiruptor bescii]
 gb|ACM59866.1| small GTP-binding protein [Caldicellulosiruptor bescii DSM 6725]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_013403800.1| ribosome-associated GTPase EngA [Caldicellulosiruptor hydrothermalis]
 gb|ADQ07649.1| ribosome-associated GTPase EngA [Caldicellulosiruptor hydrothermalis 
108]
Length=440

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_011143202.1| ribosome-associated GTPase EngA [Gloeobacter violaceus]
 ref|NP_926156.1| GTP-binding protein EngA [Gloeobacter violaceus PCC 7421]
 sp|Q7NGF9.1|DER_GLOVI RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Gloeobacter violaceus PCC 7421]
 dbj|BAC91151.1| gll3210 [Gloeobacter violaceus PCC 7421]
Length=455

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP V I+GRPNVGKS L NRL GG+ AIV D
Sbjct  3    LPIVAIIGRPNVGKSTLLNRLAGGSEAIVYD  33



>gb|AFG35933.1| ribosome-associated GTPase EngA [Fervidobacterium pennivorans 
DSM 9078]
Length=467

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = +3

Query  438  RQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIV  617
             QL+TE++   E +TR         +V    +P V+IVG+ NVGKS LFN+L+G  ++IV
Sbjct  11   EQLKTEENVKQENKTR--------DTVDASKIPTVLIVGKSNVGKSTLFNKLIGKRKSIV  62

Query  618  VD  623
             D
Sbjct  63   AD  64



>ref|WP_038285615.1| ribosome-associated GTPase EngA [actinobacterium acAcidi]
 gb|KGA11629.1| GTP-binding protein EngA [actinobacterium acAcidi]
Length=451

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P+V +VGRPNVGKS LFNRLVG +RA+V D
Sbjct  197  PRVALVGRPNVGKSTLFNRLVGEDRAVVHD  226



>ref|WP_042058241.1| ribosome-associated GTPase EngA [Acidomonas methanolica]
 dbj|GAJ28984.1| GTP-binding protein EngA [Acidomonas methanolica NBRC 104435]
Length=462

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LP VVI GRPNVGKS LFNRLVG  +AIV D
Sbjct  11   LPVVVIAGRPNVGKSTLFNRLVGRRQAIVSD  41



>ref|WP_008624046.1| ribosome-associated GTPase EngA [Mariniradius saccharolyticus]
 gb|EMS34931.1| GTP-binding protein EngA [Mariniradius saccharolyticus AK6]
Length=437

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  519  PDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            PD  +PK+ I+GRPNVGKS+  N L+G  RAIV D
Sbjct  173  PDEGIPKIAILGRPNVGKSSFLNALLGKERAIVTD  207



>ref|WP_023510379.1| ribosome-associated GTPase EngA [Sporolactobacillus laevolacticus]
 gb|EST11711.1| GTP-binding protein Der [Sporolactobacillus laevolacticus DSM 
442]
Length=438

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P + IVGRPNVGKS LFNR+VGG  AIV D
Sbjct  4    PTIAIVGRPNVGKSTLFNRIVGGRMAIVED  33



>ref|WP_013289998.1| ribosome-associated GTPase EngA [Caldicellulosiruptor obsidiansis]
 gb|ADL41995.1| ribosome-associated GTPase EngA [Caldicellulosiruptor obsidiansis 
OB47]
Length=440

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>gb|EGY25060.1| small GTP-binding domain protein [Desulfovibrio sp. A2]
Length=220

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            LPK+ +VGRPNVGKS LFNRL+  NRAI  D
Sbjct  48   LPKIALVGRPNVGKSTLFNRLIRANRAITHD  78



>ref|WP_011916460.1| ribosome-associated GTPase EngA [Caldicellulosiruptor saccharolyticus]
 sp|A4XHX9.2|DER_CALS8 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Caldicellulosiruptor saccharolyticus DSM 8903]
 gb|ABP66514.2| small GTP-binding protein [Caldicellulosiruptor saccharolyticus 
DSM 8903]
Length=439

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>ref|WP_014853440.1| ribosome-associated GTPase EngA [Pseudomonas stutzeri]
 gb|AFN78646.1| GTP-binding protein Der [Pseudomonas stutzeri DSM 10701]
Length=495

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  402  KQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSAL  581
            +QA   F +  + Q   E +  G ++  + + LK      D    K+ I+GRPNVGKS L
Sbjct  156  EQALGSFPKDAAEQDVAEQEGEGAEQVAEGEELKRIPGPSDKDGIKIAIIGRPNVGKSTL  215

Query  582  FNRLVGGNRAIVVD  623
             NR++G  R IV D
Sbjct  216  VNRMLGEERVIVYD  229



>ref|WP_039765359.1| ribosome-associated GTPase EngA [Caldicellulosiruptor sp. F32]
Length=439

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +3

Query  534  PKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P V IVGRPNVGKS LFNRL+G  RAIV D
Sbjct  3    PTVAIVGRPNVGKSTLFNRLIGERRAIVDD  32



>gb|KJB46315.1| hypothetical protein B456_007G360100 [Gossypium raimondii]
Length=639

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  456  DDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            + KT E+ T   ++    + +  +LLP V+I+GRPNVGKSALFNRL+    A+V +
Sbjct  108  NSKTLEEATLANQKSIDFTKLDINLLPTVMIIGRPNVGKSALFNRLIRRREALVYN  163



>ref|WP_024022170.1| ribosome-associated GTPase EngA [Sphingobium sp. C100]
 gb|ETI58524.1| GTP-binding protein Der [Sphingobium sp. C100]
Length=453

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LP V IVGRPNVGKS LFNRLVG   A+V D
Sbjct  1    MLPTVAIVGRPNVGKSTLFNRLVGKKLALVDD  32



>ref|WP_041569683.1| ribosome-associated GTPase EngA [Candidatus Chloracidobacterium 
thermophilum]
Length=445

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  519  PDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            P   LP VVI+GRPNVGKS LFN+LVG  +AIV D
Sbjct  3    PPQPLPSVVILGRPNVGKSTLFNKLVGRRQAIVGD  37



>ref|WP_009379431.1| ribosome-associated GTPase EngA [Bilophila sp. 4_1_30]
 gb|EGW42330.1| GTP-binding protein engA [Bilophila sp. 4_1_30]
Length=452

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  528  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVD  623
            +LPK+ ++GRPNVGKS LFNRL+  NRAI  D
Sbjct  1    MLPKIALLGRPNVGKSTLFNRLIRSNRAITHD  32



>ref|WP_013314080.1| ribosome-associated GTPase EngA [Spirochaeta thermophila]
 gb|ADN02239.1| GTP-binding protein EngA [Spirochaeta thermophila DSM 6192]
Length=450

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  531  LPKVVIVGRPNVGKSALFNRLVGGNRAI  614
            LP+VVIVGRPNVGKS LFNRL+G  +AI
Sbjct  17   LPRVVIVGRPNVGKSTLFNRLIGRRKAI  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380