BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031L24

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614688.1|  PREDICTED: uncharacterized protein LOC104107557    214   3e-67   Nicotiana tomentosiformis
ref|XP_009771818.1|  PREDICTED: uncharacterized protein LOC104222288    214   3e-67   Nicotiana sylvestris
ref|XP_004235349.1|  PREDICTED: uncharacterized protein LOC101267974    213   7e-67   Solanum lycopersicum
ref|XP_006363986.1|  PREDICTED: uncharacterized protein LOC102600005    212   2e-66   Solanum tuberosum [potatoes]
ref|XP_004241464.1|  PREDICTED: uncharacterized protein LOC101243717    211   9e-66   
gb|AFK41896.1|  unknown                                                 208   8e-65   Lotus japonicus
ref|XP_006347359.1|  PREDICTED: uncharacterized protein LOC102591891    207   2e-64   Solanum tuberosum [potatoes]
ref|XP_002317708.2|  hypothetical protein POPTR_0012s03970g             208   7e-64   
ref|XP_011073148.1|  PREDICTED: uncharacterized protein LOC105158189    206   8e-64   Sesamum indicum [beniseed]
ref|XP_008466920.1|  PREDICTED: uncharacterized protein LOC103504239    203   8e-63   Cucumis melo [Oriental melon]
gb|ABK93075.1|  unknown                                                 202   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002533450.1|  conserved hypothetical protein                     202   2e-62   Ricinus communis
ref|XP_004137517.1|  PREDICTED: uncharacterized protein LOC101203379    202   2e-62   Cucumis sativus [cucumbers]
ref|XP_011003763.1|  PREDICTED: uncharacterized protein LOC105110426    202   2e-62   Populus euphratica
ref|XP_007036950.1|  B-cell receptor-associated 31-like                 201   5e-62   Theobroma cacao [chocolate]
ref|XP_011047790.1|  PREDICTED: uncharacterized protein LOC105142038    201   5e-62   Populus euphratica
ref|XP_011083307.1|  PREDICTED: uncharacterized protein LOC105165839    201   7e-62   Sesamum indicum [beniseed]
gb|EPS65758.1|  hypothetical protein M569_09018                         201   7e-62   Genlisea aurea
ref|XP_006374250.1|  hypothetical protein POPTR_0015s05390g             201   7e-62   Populus trichocarpa [western balsam poplar]
gb|EYU21865.1|  hypothetical protein MIMGU_mgv1a016250mg                201   7e-62   Erythranthe guttata [common monkey flower]
gb|KHG18500.1|  putative C9E9.04                                        200   1e-61   Gossypium arboreum [tree cotton]
gb|KJB30251.1|  hypothetical protein B456_005G134500                    199   2e-61   Gossypium raimondii
emb|CDP20402.1|  unnamed protein product                                199   2e-61   Coffea canephora [robusta coffee]
gb|KJB39220.1|  hypothetical protein B456_007G002900                    199   4e-61   Gossypium raimondii
ref|XP_004512776.1|  PREDICTED: uncharacterized protein LOC101501449    199   4e-61   Cicer arietinum [garbanzo]
gb|KHG12256.1|  putative tRNA threonylcarbamoyladenosine biosynth...    197   1e-60   Gossypium arboreum [tree cotton]
gb|EYU24489.1|  hypothetical protein MIMGU_mgv1a016251mg                197   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_010271202.1|  PREDICTED: uncharacterized protein LOC104607286    197   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_003619887.1|  hypothetical protein MTR_6g071330                  196   5e-60   Medicago truncatula
ref|XP_003614315.1|  hypothetical protein MTR_5g048060                  196   5e-60   Medicago truncatula
ref|XP_010693104.1|  PREDICTED: uncharacterized protein LOC104906089    196   5e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009356002.1|  PREDICTED: uncharacterized protein LOC103946904    194   2e-59   Pyrus x bretschneideri [bai li]
gb|ACJ83831.1|  unknown                                                 194   2e-59   Medicago truncatula
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       205   1e-58   Cucumis sativus [cucumbers]
ref|XP_006493266.1|  PREDICTED: uncharacterized protein LOC102610667    192   2e-58   Citrus sinensis [apfelsine]
ref|XP_008375015.1|  PREDICTED: uncharacterized protein LOC103438259    191   5e-58   Malus domestica [apple tree]
ref|XP_010069441.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   1e-57   Eucalyptus grandis [rose gum]
gb|KDP37424.1|  hypothetical protein JCGZ_07951                         188   4e-57   Jatropha curcas
ref|XP_006826588.1|  hypothetical protein AMTR_s00138p00051570          188   5e-57   Amborella trichopoda
ref|XP_009360047.1|  PREDICTED: uncharacterized protein LOC103950546    188   7e-57   Pyrus x bretschneideri [bai li]
ref|XP_008367612.1|  PREDICTED: uncharacterized protein LOC103431253    187   2e-56   Malus domestica [apple tree]
ref|XP_008240412.1|  PREDICTED: uncharacterized protein LOC103338917    184   2e-55   Prunus mume [ume]
ref|XP_007209760.1|  hypothetical protein PRUPE_ppa013321mg             184   3e-55   Prunus persica
ref|XP_006406692.1|  hypothetical protein EUTSA_v10021758mg             181   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010551129.1|  PREDICTED: uncharacterized protein LOC104821825    181   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_004299507.1|  PREDICTED: uncharacterized protein LOC101300250    179   2e-53   Fragaria vesca subsp. vesca
ref|NP_001235874.1|  uncharacterized protein LOC100500288               179   2e-53   Glycine max [soybeans]
ref|XP_002883086.1|  hypothetical protein ARALYDRAFT_479261             179   3e-53   
gb|KFK39106.1|  hypothetical protein AALP_AA3G201800                    178   3e-53   Arabis alpina [alpine rockcress]
ref|XP_003528988.1|  PREDICTED: uncharacterized protein LOC100779979    178   4e-53   Glycine max [soybeans]
ref|XP_010487673.1|  PREDICTED: uncharacterized protein LOC104765623    178   6e-53   Camelina sativa [gold-of-pleasure]
emb|CDX75928.1|  BnaC03g40110D                                          177   8e-53   
ref|XP_006393407.1|  hypothetical protein EUTSA_v10011861mg             177   8e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009113753.1|  PREDICTED: uncharacterized protein LOC103839031    177   1e-52   Brassica rapa
ref|NP_188405.1|  uncharacterized protein                               177   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505894.1|  PREDICTED: uncharacterized protein LOC104782611    177   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009107356.1|  PREDICTED: uncharacterized protein LOC103833002    176   2e-52   
emb|CDY71089.1|  BnaCnng71290D                                          176   2e-52   Brassica napus [oilseed rape]
gb|KHN43655.1|  hypothetical protein glysoja_027721                     176   2e-52   Glycine soja [wild soybean]
ref|XP_010939999.1|  PREDICTED: uncharacterized protein LOC105058688    176   2e-52   Elaeis guineensis
ref|XP_002891431.1|  hypothetical protein ARALYDRAFT_473983             176   3e-52   
emb|CDX82347.1|  BnaA03g34740D                                          176   3e-52   
ref|NP_001049510.1|  Os03g0240700                                       176   3e-52   
emb|CDX92160.1|  BnaA05g22470D                                          176   4e-52   
ref|XP_009145977.1|  PREDICTED: uncharacterized protein LOC103869652    176   4e-52   Brassica rapa
emb|CDX75934.1|  BnaC03g40170D                                          176   4e-52   
ref|XP_008798490.1|  PREDICTED: uncharacterized protein LOC103713366    175   6e-52   Phoenix dactylifera
gb|KFK36093.1|  hypothetical protein AALP_AA4G076500                    175   7e-52   Arabis alpina [alpine rockcress]
ref|NP_564527.1|  B-cell receptor-associated 31-like protein            175   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136035.1|  PREDICTED: uncharacterized protein LOC103860192    175   1e-51   
ref|XP_006649710.1|  PREDICTED: uncharacterized protein LOC102721815    174   3e-51   Oryza brachyantha
ref|XP_009414793.1|  PREDICTED: uncharacterized protein LOC103995818    173   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936892.1|  PREDICTED: uncharacterized protein LOC105056401    172   6e-51   Elaeis guineensis
emb|CDX95822.1|  BnaC05g35730D                                          172   7e-51   
ref|XP_004985052.1|  PREDICTED: uncharacterized protein LOC101783228    172   1e-50   Setaria italica
emb|CDX77312.1|  BnaC08g03570D                                          171   2e-50   
ref|XP_007152652.1|  hypothetical protein PHAVU_004G147600g             171   2e-50   Phaseolus vulgaris [French bean]
ref|XP_008787911.1|  PREDICTED: uncharacterized protein LOC103705820    170   6e-50   Phoenix dactylifera
ref|XP_006305724.1|  hypothetical protein CARUB_v10010483mg             171   7e-50   
ref|XP_002465577.1|  hypothetical protein SORBIDRAFT_01g041440          170   8e-50   Sorghum bicolor [broomcorn]
ref|XP_009383620.1|  PREDICTED: uncharacterized protein LOC103971348    167   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500370.1|  PREDICTED: uncharacterized protein LOC104777761    167   9e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001130825.1|  uncharacterized protein LOC100191929 precursor     166   3e-48   Zea mays [maize]
gb|ABK21211.1|  unknown                                                 166   3e-48   Picea sitchensis
dbj|BAJ93962.1|  predicted protein                                      165   6e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010461666.1|  PREDICTED: uncharacterized protein LOC104742361    163   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002285098.1|  PREDICTED: uncharacterized protein LOC100259425    163   4e-47   Vitis vinifera
gb|EMT11703.1|  hypothetical protein F775_29923                         150   4e-42   
gb|EEE58670.1|  hypothetical protein OsJ_10088                          143   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006406691.1|  hypothetical protein EUTSA_v10021758mg             142   3e-39   
gb|EMS52490.1|  hypothetical protein TRIUR3_23930                       139   2e-38   Triticum urartu
ref|XP_003558389.1|  PREDICTED: uncharacterized protein LOC100825757    136   1e-36   Brachypodium distachyon [annual false brome]
gb|KJB39221.1|  hypothetical protein B456_007G002900                    130   7e-35   Gossypium raimondii
gb|KJB30252.1|  hypothetical protein B456_005G134500                    129   1e-34   Gossypium raimondii
gb|KEH26740.1|  B-cell receptor-associated-like protein                 127   1e-33   Medicago truncatula
ref|XP_010091755.1|  hypothetical protein L484_019343                   127   2e-33   
ref|XP_006441339.1|  hypothetical protein CICLE_v100228441mg            123   3e-32   
gb|KDO46494.1|  hypothetical protein CISIN_1g033003mg                   124   4e-32   Citrus sinensis [apfelsine]
gb|KEH27880.1|  B-cell receptor-associated-like protein                 122   6e-32   Medicago truncatula
ref|XP_010042814.1|  PREDICTED: uncharacterized protein LOC104432003    121   5e-31   Eucalyptus grandis [rose gum]
emb|CDX75929.1|  BnaC03g40120D                                          115   6e-29   
gb|AAF79693.1|AC020889_1  T1N15.5                                       110   4e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90058.1|  predicted protein                                      104   6e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004297447.1|  PREDICTED: uncharacterized protein LOC101298116    103   5e-24   Fragaria vesca subsp. vesca
ref|XP_010492659.1|  PREDICTED: uncharacterized protein LOC104770010    102   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002282972.1|  PREDICTED: uncharacterized protein LOC100264712    102   1e-23   Vitis vinifera
ref|XP_010420425.1|  PREDICTED: uncharacterized protein LOC104706006    101   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010558658.1|  PREDICTED: uncharacterized protein LOC104827222    101   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_007160414.1|  hypothetical protein PHAVU_002G319800g             100   5e-23   Phaseolus vulgaris [French bean]
ref|XP_008221450.1|  PREDICTED: uncharacterized protein LOC103321430    100   6e-23   Prunus mume [ume]
ref|XP_010412946.1|  PREDICTED: uncharacterized protein LOC104699324    100   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009351534.1|  PREDICTED: uncharacterized protein LOC103943064    100   9e-23   Pyrus x bretschneideri [bai li]
ref|XP_007226115.1|  hypothetical protein PRUPE_ppa013297mg           99.4    2e-22   Prunus persica
gb|AAM67218.1|  unknown                                               99.4    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110603.1|  hypothetical protein L484_003991                 99.0    2e-22   Morus notabilis
ref|NP_197221.1|  uncharacterized protein                             99.0    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001751217.1|  predicted protein                                99.0    2e-22   
ref|XP_006400249.1|  hypothetical protein EUTSA_v10015011mg           99.0    2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_001776047.1|  predicted protein                                97.8    5e-22   
ref|XP_009126167.1|  PREDICTED: uncharacterized protein LOC103851086  97.8    5e-22   Brassica rapa
gb|EYU45788.1|  hypothetical protein MIMGU_mgv1a016220mg              97.8    5e-22   Erythranthe guttata [common monkey flower]
ref|XP_009602433.1|  PREDICTED: uncharacterized protein LOC104097557  97.8    6e-22   Nicotiana tomentosiformis
ref|XP_006448186.1|  hypothetical protein CICLE_v10018373mg           97.4    7e-22   Citrus clementina [clementine]
ref|XP_002525982.1|  conserved hypothetical protein                   97.4    7e-22   Ricinus communis
ref|XP_004236939.1|  PREDICTED: uncharacterized protein LOC101267398  97.4    8e-22   Solanum lycopersicum
emb|CDY28742.1|  BnaCnng06280D                                        97.4    9e-22   Brassica napus [oilseed rape]
ref|XP_009130340.1|  PREDICTED: uncharacterized protein LOC103855136  97.4    9e-22   Brassica rapa
ref|XP_006408334.1|  hypothetical protein EUTSA_v10021756mg           97.4    9e-22   
gb|ACJ85899.1|  unknown                                               97.4    9e-22   Medicago truncatula
ref|XP_006355070.1|  PREDICTED: uncharacterized protein LOC102581892  97.4    9e-22   Solanum tuberosum [potatoes]
ref|XP_011021790.1|  PREDICTED: uncharacterized protein LOC105123770  97.1    1e-21   Populus euphratica
ref|XP_004167650.1|  PREDICTED: uncharacterized protein LOC101231117  97.1    1e-21   
ref|XP_002284875.1|  PREDICTED: uncharacterized protein LOC100252692  97.1    1e-21   Vitis vinifera
emb|CDP01640.1|  unnamed protein product                              97.1    1e-21   Coffea canephora [robusta coffee]
ref|XP_010463764.1|  PREDICTED: uncharacterized protein LOC104744405  96.7    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002882276.1|  hypothetical protein ARALYDRAFT_477563           96.7    1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_007045246.1|  Integral to membrane, endoplasmic reticulum      96.3    2e-21   
ref|XP_011085846.1|  PREDICTED: uncharacterized protein LOC105167724  96.3    2e-21   Sesamum indicum [beniseed]
ref|XP_002871753.1|  hypothetical protein ARALYDRAFT_488581           96.3    2e-21   
gb|ACG47575.1|  hypothetical protein                                  94.4    2e-21   Zea mays [maize]
ref|NP_566195.1|  uncharacterized protein                             96.3    2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85472.1|  BnaA02g03410D                                        99.4    2e-21   
ref|XP_002311526.1|  hypothetical protein POPTR_0008s13310g           95.9    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004250171.1|  PREDICTED: uncharacterized protein LOC101253957  95.9    3e-21   Solanum lycopersicum
gb|KFK37757.1|  hypothetical protein AALP_AA3G026000                  95.9    3e-21   Arabis alpina [alpine rockcress]
emb|CDX92034.1|  BnaC03g33360D                                        95.5    4e-21   
gb|ACN39834.1|  unknown                                               95.5    4e-21   Picea sitchensis
ref|XP_002315860.1|  hypothetical protein POPTR_0010s11830g           95.5    4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010509009.1|  PREDICTED: uncharacterized protein LOC104785488  95.5    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006298811.1|  hypothetical protein CARUB_v10014915mg           95.5    4e-21   Capsella rubella
gb|ABK24135.1|  unknown                                               95.5    5e-21   Picea sitchensis
ref|XP_008350989.1|  PREDICTED: uncharacterized protein LOC103414375  95.9    5e-21   
ref|XP_006295715.1|  hypothetical protein CARUB_v10024834mg           94.7    7e-21   Capsella rubella
ref|XP_010505627.1|  PREDICTED: uncharacterized protein LOC104782403  94.7    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011070337.1|  PREDICTED: uncharacterized protein LOC105156019  94.7    8e-21   Sesamum indicum [beniseed]
gb|ADB93071.1|  conserved hypothetical protein                        94.7    9e-21   Jatropha curcas
ref|XP_002966221.1|  hypothetical protein SELMODRAFT_407584           94.7    9e-21   Selaginella moellendorffii
ref|NP_001275181.1|  Erwinia induced protein 2                        94.0    1e-20   Solanum tuberosum [potatoes]
emb|CDX74224.1|  BnaA03g28230D                                        94.0    1e-20   
ref|XP_009134722.1|  PREDICTED: uncharacterized protein LOC103858996  94.0    2e-20   Brassica rapa
ref|XP_011023985.1|  PREDICTED: uncharacterized protein LOC105125293  94.0    2e-20   Populus euphratica
ref|XP_010268861.1|  PREDICTED: uncharacterized protein LOC104605674  93.6    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_004142369.1|  PREDICTED: uncharacterized protein LOC101213354  93.6    2e-20   
ref|XP_009796285.1|  PREDICTED: uncharacterized protein LOC104242869  93.6    2e-20   Nicotiana sylvestris
ref|XP_001751735.1|  predicted protein                                93.6    3e-20   
ref|XP_010271322.1|  PREDICTED: uncharacterized protein LOC104607383  94.4    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010549811.1|  PREDICTED: uncharacterized protein LOC104820873  92.4    6e-20   Tarenaya hassleriana [spider flower]
emb|CDX69398.1|  BnaA10g17470D                                        92.0    7e-20   
ref|XP_009617070.1|  PREDICTED: uncharacterized protein LOC104109462  92.0    8e-20   Nicotiana tomentosiformis
ref|XP_002981183.1|  hypothetical protein SELMODRAFT_444756           91.7    9e-20   Selaginella moellendorffii
ref|XP_010525038.1|  PREDICTED: uncharacterized protein LOC104802914  91.7    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_009121411.1|  PREDICTED: uncharacterized protein LOC103846267  91.7    1e-19   Brassica rapa
ref|XP_009631997.1|  PREDICTED: uncharacterized protein LOC104121659  91.7    1e-19   Nicotiana tomentosiformis
ref|XP_009765334.1|  PREDICTED: uncharacterized protein LOC104216893  91.7    1e-19   Nicotiana sylvestris
ref|XP_002982660.1|  hypothetical protein SELMODRAFT_445222           90.9    2e-19   Selaginella moellendorffii
ref|XP_010044222.1|  PREDICTED: uncharacterized protein LOC104433237  90.9    2e-19   Eucalyptus grandis [rose gum]
ref|XP_003630917.1|  hypothetical protein MTR_8g104980                90.1    4e-19   Medicago truncatula
gb|KJB84366.1|  hypothetical protein B456_N021300                     91.7    4e-19   Gossypium raimondii
ref|XP_009409247.1|  PREDICTED: uncharacterized protein LOC103991491  89.7    6e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503366.1|  PREDICTED: uncharacterized protein LOC101497967  89.0    1e-18   Cicer arietinum [garbanzo]
ref|XP_001760859.1|  predicted protein                                88.6    1e-18   
ref|XP_006826907.1|  hypothetical protein AMTR_s00010p00157310        88.2    2e-18   
ref|XP_003530733.1|  PREDICTED: uncharacterized protein LOC100785159  88.2    2e-18   Glycine max [soybeans]
gb|KHN16564.1|  hypothetical protein glysoja_002661                   88.2    2e-18   Glycine soja [wild soybean]
ref|XP_011099907.1|  PREDICTED: uncharacterized protein LOC105178193  88.2    2e-18   Sesamum indicum [beniseed]
ref|XP_003525249.1|  PREDICTED: uncharacterized protein LOC100808...  87.0    6e-18   Glycine max [soybeans]
ref|XP_009403367.1|  PREDICTED: uncharacterized protein LOC103986938  87.0    6e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010681925.1|  PREDICTED: uncharacterized protein LOC104896829  87.0    6e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009794975.1|  PREDICTED: uncharacterized protein LOC104241739  87.0    6e-18   Nicotiana sylvestris
gb|EPS60480.1|  erwinia induced protein 2                             86.3    1e-17   Genlisea aurea
gb|KJB15367.1|  hypothetical protein B456_002G173500                  85.9    1e-17   Gossypium raimondii
ref|XP_009402128.1|  PREDICTED: uncharacterized protein LOC103985995  85.9    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803900.1|  PREDICTED: uncharacterized protein LOC103717341  84.3    6e-17   Phoenix dactylifera
gb|KHN21577.1|  hypothetical protein glysoja_023429                   83.2    1e-16   Glycine soja [wild soybean]
gb|EYU40721.1|  hypothetical protein MIMGU_mgv1a018086mg              82.0    4e-16   Erythranthe guttata [common monkey flower]
gb|EPS58202.1|  erwinia induced protein 2                             82.0    4e-16   Genlisea aurea
gb|EYU34496.1|  hypothetical protein MIMGU_mgv1a020406mg              81.3    7e-16   Erythranthe guttata [common monkey flower]
ref|XP_008775931.1|  PREDICTED: uncharacterized protein LOC103696169  80.9    1e-15   
ref|XP_004236688.1|  PREDICTED: uncharacterized protein LOC101267983  80.5    1e-15   Solanum lycopersicum
ref|XP_010932577.1|  PREDICTED: uncharacterized protein LOC105053193  79.3    4e-15   Elaeis guineensis
dbj|BAK03279.1|  predicted protein                                    78.6    6e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570694.1|  PREDICTED: uncharacterized protein LOC100846819  77.8    1e-14   Brachypodium distachyon [annual false brome]
gb|ACG27993.1|  erwinia induced protein 2                             76.3    4e-14   Zea mays [maize]
gb|ACG24688.1|  erwinia induced protein 2                             75.9    6e-14   Zea mays [maize]
ref|NP_001148963.1|  LOC100282583                                     75.9    7e-14   Zea mays [maize]
ref|XP_004953840.1|  PREDICTED: uncharacterized protein LOC101771529  75.5    9e-14   Setaria italica
ref|XP_002454325.1|  hypothetical protein SORBIDRAFT_04g028710        75.5    1e-13   Sorghum bicolor [broomcorn]
ref|NP_001048043.1|  Os02g0734900                                     75.1    1e-13   
ref|NP_001150948.1|  LOC100284581                                     75.1    1e-13   
ref|XP_010911288.1|  PREDICTED: uncharacterized protein LOC105037303  75.1    1e-13   Elaeis guineensis
ref|XP_006647852.1|  PREDICTED: uncharacterized protein LOC102713443  74.7    2e-13   Oryza brachyantha
ref|XP_006441338.1|  hypothetical protein CICLE_v100228442mg          70.9    7e-13   
gb|AFG54011.1|  hypothetical protein CL2046Contig1_03                 67.8    2e-11   Pinus taeda
ref|XP_006606844.1|  PREDICTED: uncharacterized protein LOC102662870  67.4    2e-11   
ref|XP_006374207.1|  hypothetical protein POPTR_0015s04930g           68.6    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010068693.1|  PREDICTED: uncharacterized protein LOC104455630  68.6    3e-11   Eucalyptus grandis [rose gum]
gb|AFG54003.1|  hypothetical protein CL2046Contig1_03                 67.0    3e-11   Pinus taeda
gb|AEW08869.1|  hypothetical protein CL2046Contig1_03                 67.0    4e-11   Pinus radiata
gb|AFG54008.1|  hypothetical protein CL2046Contig1_03                 66.6    4e-11   Pinus taeda
gb|AFG54002.1|  hypothetical protein CL2046Contig1_03                 65.9    8e-11   Pinus taeda
emb|CDY31795.1|  BnaC01g27510D                                        68.2    1e-10   Brassica napus [oilseed rape]
ref|XP_011035561.1|  PREDICTED: uncharacterized protein LOC105133318  65.5    3e-10   Populus euphratica
gb|AFG54006.1|  hypothetical protein CL2046Contig1_03                 63.9    4e-10   Pinus taeda
gb|AFK49283.1|  unknown                                               64.3    9e-10   Medicago truncatula
gb|AAT45002.1|  unknown                                               60.5    2e-08   Xerophyta humilis
gb|EAZ24531.1|  hypothetical protein OsJ_08292                        58.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910937.1|  PREDICTED: uncharacterized protein LOC105036913  49.3    2e-04   Elaeis guineensis



>ref|XP_009614688.1| PREDICTED: uncharacterized protein LOC104107557 [Nicotiana tomentosiformis]
Length=129

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+AILLTLPSPK ++SRIVSLISLTLQPSLFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAVAILLTLPSPKAIKSRIVSLISLTLQPSLFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTAAERDRYEKSIYKAQRN ILC+AACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNAILCLAACLLYWCIYRVCKYYKEIQSVE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRLKDE  129



>ref|XP_009771818.1| PREDICTED: uncharacterized protein LOC104222288 [Nicotiana sylvestris]
Length=129

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+AILLTLPSPK ++SRIVSLISLTLQPSLFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAVAILLTLPSPKAIKSRIVSLISLTLQPSLFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTAAERDRYEKSIYKAQRN ILC+AACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNAILCLAACLLYWCIYRVCKYYKEIQSIE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRLKDE  129



>ref|XP_004235349.1| PREDICTED: uncharacterized protein LOC101267974 [Solanum lycopersicum]
Length=129

 Score =   213 bits (543),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIAILLTLPSPK ++SR VSLISLTLQPSLFI+PFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAILLTLPSPKAIKSRFVSLISLTLQPSLFIIPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTAAERDRYEKSIYKAQRN ILCVAACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNAILCVAACLLYWCIYRVCKYYKEIQSVE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRLKDE  129



>ref|XP_006363986.1| PREDICTED: uncharacterized protein LOC102600005 [Solanum tuberosum]
Length=129

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIAILLTLPSPK ++SR VSLISLTLQPSLFI+PFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAILLTLPSPKAIKSRFVSLISLTLQPSLFIIPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTAAERDRYE+SIYKAQRN ILCVAACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTAAERDRYERSIYKAQRNAILCVAACLLYWCIYRVCKYYKEIQSVE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRLKDE  129



>ref|XP_004241464.1| PREDICTED: uncharacterized protein LOC101243717 [Solanum lycopersicum]
Length=129

 Score =   211 bits (536),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIAILLTLPSPKPL+SR VSLISL LQPSLF+VPF+ FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAILLTLPSPKPLKSRFVSLISLALQPSLFVVPFSVFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTA+ERDRYEKSIYKAQRN ILC+AACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTASERDRYEKSIYKAQRNVILCLAACLLYWCIYRVCKYYKEIQSIE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRYKDQ  129



>gb|AFK41896.1| unknown [Lotus japonicus]
Length=129

 Score =   208 bits (529),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+AILLTLPSPK LR+R VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWLILTYIVAAEAAVAILLTLPSPKLLRNRFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGE+CTAAERDRYEKSIYKAQRN ILCV+ACLLYWCIYRICKY K++Q +E
Sbjct  61   WKNEHRLMCTGEVCTAAERDRYEKSIYKAQRNAILCVSACLLYWCIYRICKYQKDLQSLE  120

Query  403  EVEKRAKDN  429
            EVEKRAK  
Sbjct  121  EVEKRAKSQ  129



>ref|XP_006347359.1| PREDICTED: uncharacterized protein LOC102591891 [Solanum tuberosum]
Length=129

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIAILLTLPSPK L+SR VSLISL LQPSLF+VPF+AFQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAILLTLPSPKALKSRFVSLISLALQPSLFVVPFSAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTGEICTA+ERDRYEKSIYKAQRN ILC+AACLLYWCIYR+CKY KEIQ +E
Sbjct  61   WKNEHRLMCTGEICTASERDRYEKSIYKAQRNVILCLAACLLYWCIYRVCKYYKEIQSIE  120

Query  403  EVEKRAKDN  429
            EVEK  KD 
Sbjct  121  EVEKSYKDQ  129



>ref|XP_002317708.2| hypothetical protein POPTR_0012s03970g, partial [Populus trichocarpa]
 gb|EEE95928.2| hypothetical protein POPTR_0012s03970g, partial [Populus trichocarpa]
Length=189

 Score =   208 bits (529),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  22   ENTEKKTMALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAA  201
            EN  +K MALQW+ILTY VA EA IA+LLTLPSPK L+ R+VSLISL LQP+LF+VPFA 
Sbjct  54   ENQRQKKMALQWMILTYLVAAEAVIAVLLTLPSPKLLKYRLVSLISLVLQPALFVVPFAG  113

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYN  381
            FQLLDIYWK EHRLMCTGE CTAAERDRYEKSIYKAQRN ILC++ACLLYWC+YR+CK+ 
Sbjct  114  FQLLDIYWKMEHRLMCTGETCTAAERDRYEKSIYKAQRNVILCISACLLYWCVYRVCKFY  173

Query  382  KEIQRMEEVEKRAKDN  429
            KEIQ +EEVEKR KD 
Sbjct  174  KEIQSLEEVEKRYKDQ  189



>ref|XP_011073148.1| PREDICTED: uncharacterized protein LOC105158189 [Sesamum indicum]
Length=129

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL Y VA EAA+AI+LTLPSPK L+SRIVSLISL LQPSLFI+PF+ FQLLDIY
Sbjct  1    MALQWVILAYVVAAEAAVAIILTLPSPKALKSRIVSLISLILQPSLFIIPFSGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+GEICTAAERDRYEKSIYK+QRN +LC AACLLYWCIYRICKY++EIQ ME
Sbjct  61   WKNEHRLMCSGEICTAAERDRYEKSIYKSQRNAVLCSAACLLYWCIYRICKYHREIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRYKDQ  129



>ref|XP_008466920.1| PREDICTED: uncharacterized protein LOC103504239 [Cucumis melo]
Length=129

 Score =   203 bits (516),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW++L Y VAVEAAIAILLT+PSPK L+ R VSLISL LQP+LF+VPFA FQ+LDIY
Sbjct  1    MALQWMLLAYTVAVEAAIAILLTVPSPKLLKKRFVSLISLILQPALFVVPFAGFQILDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKSIYKAQRN ILCVAACLLYWCIYR+CKYNKEI+ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSIYKAQRNVILCVAACLLYWCIYRVCKYNKEIESLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEQ  129



>gb|ABK93075.1| unknown [Populus trichocarpa]
Length=129

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EA IA+LLTLPSPK L+ R+VSLISL LQP+LF+VPFA FQLLDIY
Sbjct  1    MALQWMILTYLVAAEAVIAVLLTLPSPKLLKYRLVSLISLVLQPALFVVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCTGE CTAAERDRYEKSIYKAQRN ILC++ACLLYWC+YR+CK+ KEIQ +E
Sbjct  61   WKMEHRLMCTGETCTAAERDRYEKSIYKAQRNVILCISACLLYWCVYRVCKFYKEIQSLE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRYKDQ  129



>ref|XP_002533450.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28934.1| conserved hypothetical protein [Ricinus communis]
Length=129

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VAVEAA+A +LT+PSPK L+ R+VSL+SL LQP+LF+VPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAVEAALAAVLTVPSPKALKYRLVSLVSLILQPALFVVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKSIYKAQRN ILC +ACLLYWC+YRIC Y KEIQ++E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSIYKAQRNVILCASACLLYWCVYRICHYYKEIQKLE  120

Query  403  EVEKRAKDN  429
            EVEKR+KD 
Sbjct  121  EVEKRSKDQ  129



>ref|XP_004137517.1| PREDICTED: uncharacterized protein LOC101203379 [Cucumis sativus]
 ref|XP_004167488.1| PREDICTED: uncharacterized protein LOC101228810 [Cucumis sativus]
Length=129

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW++L Y VAVEAAIA+LLT+PSPK L+ R VSLISL LQP+LF+VPF+ FQ+LDIY
Sbjct  1    MALQWMLLAYTVAVEAAIALLLTVPSPKLLKKRFVSLISLILQPALFVVPFSGFQILDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKSIYKAQRN ILC+AACLLYWCIYRICKYNKEI+ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSIYKAQRNVILCIAACLLYWCIYRICKYNKEIESLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEQ  129



>ref|XP_011003763.1| PREDICTED: uncharacterized protein LOC105110426 [Populus euphratica]
Length=129

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EA IA+LLTLPSPK L+ R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYLVAAEAVIAVLLTLPSPKLLKDRLVSLISLLLQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCTGE CTAAERDRYEKSIYK+QRN ILC++ACLLYWC+YR+CK++KEIQ +E
Sbjct  61   WKMEHRLMCTGETCTAAERDRYEKSIYKSQRNVILCISACLLYWCVYRVCKFHKEIQSLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEQ  129



>ref|XP_007036950.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY21451.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=129

 Score =   201 bits (511),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLTLP PK L++R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAVALLLTLPYPKLLKNRLVSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKS++KAQRN ILC  ACLLYWCIYRICKYNKEIQ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSVFKAQRNVILCATACLLYWCIYRICKYNKEIQSLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRYKN  128



>ref|XP_011047790.1| PREDICTED: uncharacterized protein LOC105142038 [Populus euphratica]
Length=129

 Score =   201 bits (511),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIA LLTLPSPK L+ R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAALLTLPSPKLLKDRLVSLISLLLQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC GE CTA+ERDRYEKSIYKAQRN ILCV+ACLLYWC+YRICKY KEIQ +E
Sbjct  61   WKNEHRLMCAGESCTASERDRYEKSIYKAQRNVILCVSACLLYWCVYRICKYYKEIQSLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKNQ  129



>ref|XP_011083307.1| PREDICTED: uncharacterized protein LOC105165839 [Sesamum indicum]
Length=129

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL Y VA EAA+AI++TLPSPK ++SRIVSL+SL LQPSLFI+PF+AFQLLDIY
Sbjct  1    MALQWMILAYVVAAEAAVAIIVTLPSPKAVKSRIVSLVSLILQPSLFIIPFSAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+GE CTAAERDR+EKSIYKAQRN +LCV+ACLLYWCIYRICKY+++IQ ME
Sbjct  61   WKNEHRLMCSGETCTAAERDRHEKSIYKAQRNAVLCVSACLLYWCIYRICKYHRDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEE  129



>gb|EPS65758.1| hypothetical protein M569_09018 [Genlisea aurea]
Length=129

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL Y VA E A+A+LLTLPSPK +RSRIVSL+SL LQP+LF+VPF+ FQLLDIY
Sbjct  1    MALQWVILAYVVAAETALAVLLTLPSPKAVRSRIVSLVSLILQPALFVVPFSGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C+G+ CTA+ERDRYEKSIYKAQRN ILC A+CL+YW IYRICKYN+EI+RME
Sbjct  61   WKNEHRLICSGDTCTASERDRYEKSIYKAQRNAILCAASCLVYWFIYRICKYNREIERME  120

Query  403  EVEKRAKDN  429
            E+EKR K+ 
Sbjct  121  ELEKRFKEE  129



>ref|XP_006374250.1| hypothetical protein POPTR_0015s05390g [Populus trichocarpa]
 gb|ERP52047.1| hypothetical protein POPTR_0015s05390g [Populus trichocarpa]
Length=129

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIA LLTLPSPK L+ R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIAALLTLPSPKLLKDRLVSLISLLLQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC GE CTA+ERDRYEKSIYKAQRN ILCV+ACLLYWC+YRICKY KEIQ +E
Sbjct  61   WKNEHRLMCAGENCTASERDRYEKSIYKAQRNVILCVSACLLYWCVYRICKYYKEIQSLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKNQ  129



>gb|EYU21865.1| hypothetical protein MIMGU_mgv1a016250mg [Erythranthe guttata]
Length=129

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+ILTY VA EAA+A++LTLPSPK ++SRIVSL+SL LQPSLFI+PF+AFQLLDIY
Sbjct  1    MGLQWMILTYVVAAEAAVAVVLTLPSPKAVKSRIVSLVSLILQPSLFIIPFSAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCTG++CTA+ERDRYEKSIYK+QRN ILC  ACLLYW IYR+CKY K+IQ ME
Sbjct  61   WKNEHRLMCTGDVCTASERDRYEKSIYKSQRNSILCTVACLLYWFIYRVCKYCKDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRYKDQ  129



>gb|KHG18500.1| putative C9E9.04 [Gossypium arboreum]
Length=129

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLT PSPK L++R VSLISL LQP+LFI+PFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALALLLTFPSPKLLKNRFVSLISLILQPTLFIIPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKS++KAQRN ILC  ACLLYWCIYRICKY+KEIQ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSVFKAQRNVILCTTACLLYWCIYRICKYHKEIQSLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRYKN  128



>gb|KJB30251.1| hypothetical protein B456_005G134500 [Gossypium raimondii]
Length=129

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLT PSPK L++R VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALALLLTFPSPKLLKNRFVSLISLILQPTLFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT +ICTAAERDRYEKS++KAQRN ILC  ACLLYWCIYRICKY+KEIQ +E
Sbjct  61   WKNEHRLMCTSDICTAAERDRYEKSVFKAQRNVILCTTACLLYWCIYRICKYHKEIQSLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRYKN  128



>emb|CDP20402.1| unnamed protein product [Coffea canephora]
 emb|CDO98651.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQWIILTY VA EAA AILLT+P+PK ++S++VSL+SL LQPSLFIVPF+ FQL+DIY
Sbjct  1    MALQWIILTYVVAAEAATAILLTVPTPKLIKSKMVSLVSLVLQPSLFIVPFSVFQLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCTGE CTA+ERDRYEKSIYKAQRN ILC AA LLYWCIYRICKY K+IQ ME
Sbjct  61   WKQEHRLMCTGETCTASERDRYEKSIYKAQRNVILCAAAVLLYWCIYRICKYYKDIQSME  120

Query  403  EVEKRAKDN  429
            EVE+R KD 
Sbjct  121  EVERRYKDE  129



>gb|KJB39220.1| hypothetical protein B456_007G002900 [Gossypium raimondii]
 gb|KJB39222.1| hypothetical protein B456_007G002900 [Gossypium raimondii]
 gb|KJB39224.1| hypothetical protein B456_007G002900 [Gossypium raimondii]
Length=129

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLTLPSPK L++R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYMVAAEAALALLLTLPSPKLLKNRLVSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKS YK+QRN ILCV ACLLYWCI RICKYNKEIQ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSFYKSQRNVILCVTACLLYWCIQRICKYNKEIQSLE  120

Query  403  EVEKRAKD  426
            E+EKR KD
Sbjct  121  EIEKRYKD  128



>ref|XP_004512776.1| PREDICTED: uncharacterized protein LOC101501449 [Cicer arietinum]
Length=129

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA+EA +AIL+TLPSPK LR+R+ SLISL LQP+LFI+PFA FQLLDIY
Sbjct  1    MALQWMILSYVVALEAVVAILVTLPSPKLLRNRLTSLISLVLQPALFIIPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT ++CTAAERDRYEK+IYK+QRN ILC++AC+LYWCIYR+CK+ K+IQ ME
Sbjct  61   WKNEHRLMCTSDVCTAAERDRYEKAIYKSQRNVILCISACILYWCIYRVCKFQKDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR K  
Sbjct  121  EVEKRYKSK  129



>gb|KHG12256.1| putative tRNA threonylcarbamoyladenosine biosynthesis Gcp [Gossypium 
arboreum]
Length=129

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLTLPSPK L++R+VSLIS+ LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALALLLTLPSPKLLKNRLVSLISVILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKS YK+QRN ILCV ACLLYWCI RICKYNKEIQ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSFYKSQRNVILCVTACLLYWCIQRICKYNKEIQSLE  120

Query  403  EVEKRAKD  426
            E+EKR KD
Sbjct  121  EIEKRYKD  128



>gb|EYU24489.1| hypothetical protein MIMGU_mgv1a016251mg [Erythranthe guttata]
Length=129

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL Y VA EAA+AI+LTLPSPK ++SRI SL+SL LQPSLFI+PF+AFQLLDIY
Sbjct  1    MALQWMILAYVVAAEAAVAIILTLPSPKAIKSRITSLVSLVLQPSLFIIPFSAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+GE CTAAERDRYEKS YKAQRN +LCV+ACLLYWCIYRICKY+++IQ ME
Sbjct  61   WKNEHRLMCSGETCTAAERDRYEKSTYKAQRNAVLCVSACLLYWCIYRICKYHRDIQSME  120

Query  403  EVEKRAKDN  429
            EVEK  K+ 
Sbjct  121  EVEKSYKEE  129



>ref|XP_010271202.1| PREDICTED: uncharacterized protein LOC104607286 [Nelumbo nucifera]
Length=129

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQWIIL+Y VAVEAAIA+LLTLP+PK L+SR+VSLIS+ LQP++ IVPFAAFQLLDIY
Sbjct  1    MALQWIILSYVVAVEAAIALLLTLPAPKLLKSRVVSLISILLQPAMGIVPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CTAAERDRYEKSIYKAQRN +LC AACLLYW ++R+CKY KEIQ++E
Sbjct  61   WKNEHRLMCTSEVCTAAERDRYEKSIYKAQRNVVLCAAACLLYWFVFRLCKYYKEIQKLE  120

Query  403  EVEKRAKDN  429
            E EK+ KD 
Sbjct  121  EAEKKLKDQ  129



>ref|XP_003619887.1| hypothetical protein MTR_6g071330 [Medicago truncatula]
 gb|AES76105.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=129

 Score =   196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA+EAA+AILLTLPSPK LR+R+ SLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAIEAAVAILLTLPSPKLLRNRLTSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT ++CTAAERDRYEK+ YKAQRN ILC++ACLLYW IYRICK+ K+IQ ME
Sbjct  61   WKAEHRLMCTSDVCTAAERDRYEKTTYKAQRNVILCISACLLYWAIYRICKFQKDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR K  
Sbjct  121  EVEKRIKSK  129



>ref|XP_003614315.1| hypothetical protein MTR_5g048060 [Medicago truncatula]
 gb|AES97273.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK37201.1| unknown [Medicago truncatula]
Length=129

 Score =   196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA+EAA+AILLTLPSPK LR+R+ SLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAIEAAVAILLTLPSPKLLRNRLTSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT ++CTAAERDRYEK+ YKAQRN ILC++ACLLYW IYRICK+ K+IQ ME
Sbjct  61   WKAEHRLMCTSDVCTAAERDRYEKTTYKAQRNVILCISACLLYWSIYRICKFQKDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR K  
Sbjct  121  EVEKRIKSK  129



>ref|XP_010693104.1| PREDICTED: uncharacterized protein LOC104906089 [Beta vulgaris 
subsp. vulgaris]
Length=129

 Score =   196 bits (498),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAI +L++LPSPK +RSRIVSLISL LQP +F+VPFAAFQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIFLLISLPSPKLIRSRIVSLISLLLQPLMFVVPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEK  YKAQRN ILC  +CLLYWCIYR CKY K+I++ME
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKQTYKAQRNIILCATSCLLYWCIYRACKYYKDIEKME  120

Query  403  EVEKRAK  423
            EVEKR K
Sbjct  121  EVEKRYK  127



>ref|XP_009356002.1| PREDICTED: uncharacterized protein LOC103946904 [Pyrus x bretschneideri]
Length=129

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLT+P+PKPL++R VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALAFLLTIPAPKPLKNRFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT E CTA++RDRYEKS+YKAQRN ILC +ACLLYWC++RICKY K+IQ +E
Sbjct  61   WKNEHRLACTSETCTASDRDRYEKSLYKAQRNVILCASACLLYWCLFRICKYYKDIQNLE  120

Query  403  EVEKRAKD  426
            EVEKR KD
Sbjct  121  EVEKRYKD  128



>gb|ACJ83831.1| unknown [Medicago truncatula]
Length=129

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA+EAA+AILLTLPSPK LR+R+ SLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAIEAAVAILLTLPSPKLLRNRLTSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT ++CTAAERDRYEK  YKAQRN ILC++ACLLYW IYRICK+ K+IQ ME
Sbjct  61   WKAEHRLMCTSDVCTAAERDRYEKITYKAQRNVILCISACLLYWSIYRICKFQKDIQSME  120

Query  403  EVEKRAKDN  429
            EVEKR K  
Sbjct  121  EVEKRIKSK  129



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW++L Y VAVEAAIA+LLT+PSPK L+ R VSLISL LQP+LF+VPF+ FQ+LDIY
Sbjct  1    MALQWMLLAYTVAVEAAIALLLTVPSPKLLKKRFVSLISLILQPALFVVPFSGFQILDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKSIYKAQRN ILC+AACLLYWCIYRICKYNKEI+ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSIYKAQRNVILCIAACLLYWCIYRICKYNKEIESLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRYKE  128



>ref|XP_006493266.1| PREDICTED: uncharacterized protein LOC102610667 [Citrus sinensis]
 gb|KDO46493.1| hypothetical protein CISIN_1g033003mg [Citrus sinensis]
Length=129

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL YAVA EAAIAILLT+PSPK L++R+VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWLILAYAVAAEAAIAILLTIPSPKLLKNRLVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK+EHRLMCT EICTAAERDRYEKSIYKAQRN ILC AACLLYW I+RICKY K++QR+E
Sbjct  61   WKSEHRLMCTSEICTAAERDRYEKSIYKAQRNVILCAAACLLYWSIFRICKYYKDVQRLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEE  129



>ref|XP_008375015.1| PREDICTED: uncharacterized protein LOC103438259 [Malus domestica]
Length=129

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLT+P+PK L++R VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALAFLLTIPAPKLLKNRFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT + CTA+ERDRYEKS+YKAQRN ILC +ACLLYWC++RICKY K+IQ +E
Sbjct  61   WKNEHRLACTSDTCTASERDRYEKSLYKAQRNVILCASACLLYWCLFRICKYYKDIQNLE  120

Query  403  EVEKRAKD  426
            EVEKR KD
Sbjct  121  EVEKRYKD  128



>ref|XP_010069441.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104456365 
[Eucalyptus grandis]
Length=131

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaa--iaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLD  216
            MALQW+ILTY VA EAA   + LLTLPSPK L++ +VS +SL LQP+LF+VPFA FQLLD
Sbjct  1    MALQWMILTYVVAAEAAVASSFLLTLPSPKFLKNHLVSFVSLVLQPALFVVPFAGFQLLD  60

Query  217  IYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQR  396
            IYWK+EHRL CT +ICTAAERDRYEK+IYKAQRN ILC +ACLLYWCIYRICKY KEIQ+
Sbjct  61   IYWKSEHRLSCTSDICTAAERDRYEKAIYKAQRNVILCASACLLYWCIYRICKYYKEIQK  120

Query  397  MEEVEKRAKDN  429
            +EE+EKR KD 
Sbjct  121  LEEIEKRFKDQ  131



>gb|KDP37424.1| hypothetical protein JCGZ_07951 [Jatropha curcas]
Length=129

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTYAVAVEA +A +LTLPSPK L+ R+VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYAVAVEAVLAAVLTLPSPKLLKYRLVSLVSLLLQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTAAERDRYEKSIYK+QRN ILC +ACLLYWCIYRICKY+KEIQ +E
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSIYKSQRNVILCASACLLYWCIYRICKYHKEIQSLE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRYKDQ  129



>ref|XP_006826588.1| hypothetical protein AMTR_s00138p00051570 [Amborella trichopoda]
 gb|ERM93825.1| hypothetical protein AMTR_s00138p00051570 [Amborella trichopoda]
Length=129

 Score =   188 bits (478),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+IL+Y VA EAA+A+ LTLPSP  ++SRIVSL+SL LQP+L IVPFA FQL+DIY
Sbjct  1    MGLQWVILSYVVAAEAAVALFLTLPSPSIIKSRIVSLVSLILQPALGIVPFAGFQLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT E CTAAERDRYEKSIYKAQRN ILC+AACLLYW ++RIC Y KE+QR+E
Sbjct  61   WKQEHRLMCTSETCTAAERDRYEKSIYKAQRNAILCLAACLLYWFVHRICNYYKELQRLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRRKN  128



>ref|XP_009360047.1| PREDICTED: uncharacterized protein LOC103950546 [Pyrus x bretschneideri]
Length=129

 Score =   188 bits (477),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+ILTY VA EAA+A LLT+P+PK L++R VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MGLQWMILTYVVAAEAALAFLLTIPAPKLLKNRFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT +ICTA+ERDRYEKS+YKAQRN ILC +ACLLYWC++RICK  K+IQ +E
Sbjct  61   WKNEHRLACTSDICTASERDRYEKSMYKAQRNVILCASACLLYWCLFRICKLCKDIQNLE  120

Query  403  EVEKRAKD  426
            EVEKR KD
Sbjct  121  EVEKRYKD  128



>ref|XP_008367612.1| PREDICTED: uncharacterized protein LOC103431253 [Malus domestica]
Length=129

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLT+P+PK L++R VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALAFLLTIPAPKLLKNRFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT +ICTA+ERDRYEKS+YKAQ N +LC +ACLLYWC++RICK  K+IQ +E
Sbjct  61   WKNEHRLACTSDICTASERDRYEKSMYKAQGNVVLCASACLLYWCLFRICKLYKDIQNLE  120

Query  403  EVEKRAKD  426
            EVEKR KD
Sbjct  121  EVEKRYKD  128



>ref|XP_008240412.1| PREDICTED: uncharacterized protein LOC103338917 [Prunus mume]
Length=129

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLTLP+PK L+++ VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALAFLLTLPAPKLLKNQFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT EICTAAERDRYEKSIYKAQRN ILC +ACLLYWC+ RICKY K+IQ++E
Sbjct  61   WKNEHRLSCTSEICTAAERDRYEKSIYKAQRNVILCASACLLYWCLIRICKYYKDIQKLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRYKEE  129



>ref|XP_007209760.1| hypothetical protein PRUPE_ppa013321mg [Prunus persica]
 gb|EMJ10959.1| hypothetical protein PRUPE_ppa013321mg [Prunus persica]
Length=129

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLTLP+PK L+++ VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALAFLLTLPAPKLLKNQFVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL CT EICTAAERDRYEKSIYKAQRN ILC +ACLLYWC+ RICKY K+IQ +E
Sbjct  61   WKNEHRLSCTSEICTAAERDRYEKSIYKAQRNVILCASACLLYWCLVRICKYYKDIQNLE  120

Query  403  EVEKRAKD  426
            EVEKR K+
Sbjct  121  EVEKRCKE  128



>ref|XP_006406692.1| hypothetical protein EUTSA_v10021758mg [Eutrema salsugineum]
 gb|ESQ48145.1| hypothetical protein EUTSA_v10021758mg [Eutrema salsugineum]
Length=129

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AI I+LTLP P  L+ RIVSLISL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVAIVIILTLPYPMLLKKRIVSLISLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN ++C A  LLYWCI+RICKYNK+++R+E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVMCAAGILLYWCIFRICKYNKDLERLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRYK  127



>ref|XP_010551129.1| PREDICTED: uncharacterized protein LOC104821825 [Tarenaya hassleriana]
Length=129

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA EAA+A++LTLPSP  ++ RIVSLISL LQP++ IVPFA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEAAVAVILTLPSPNLIKKRIVSLISLILQPAVSIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CTA+ERD YEKSIYKAQRN +LC  A LLYWCIYR+CKY K+++ +E
Sbjct  61   WKNEHRLMCTSEVCTASERDHYEKSIYKAQRNVVLCAIAILLYWCIYRVCKYYKDLESLE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  EAEKRYKEE  129



>ref|XP_004299507.1| PREDICTED: uncharacterized protein LOC101300250 [Fragaria vesca 
subsp. vesca]
Length=129

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAAIA+LLTLP+PK L+ R VSLISL LQP+LF+VPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAIALLLTLPAPKLLKFRFVSLISLILQPALFVVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRL CT +ICTAAERDR EKS+YKAQRN ILC AACLLYWCIYRICKY K+I+ +E
Sbjct  61   WKMEHRLTCTSDICTAAERDRSEKSLYKAQRNVILCSAACLLYWCIYRICKYYKDIESLE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRFKEE  129



>ref|NP_001235874.1| uncharacterized protein LOC100500288 [Glycine max]
 gb|ACU15325.1| unknown [Glycine max]
Length=129

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+ILTY VA EAA+AILLTLP+PK LR+R  SL+SL LQP+LFIVPFA F LLD+Y
Sbjct  1    MGLQWLILTYVVATEAAVAILLTLPTPKLLRNRFASLVSLILQPALFIVPFAGFHLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CTAAERDRYEKSIYKAQRN ILCV ACLLYW I RICKY KEIQ +E
Sbjct  61   WKNEHRLMCTSEVCTAAERDRYEKSIYKAQRNVILCVTACLLYWSISRICKYQKEIQSLE  120

Query  403  EVEKRAK  423
            EVEKR K
Sbjct  121  EVEKRIK  127



>ref|XP_002883086.1| hypothetical protein ARALYDRAFT_479261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59345.1| hypothetical protein ARALYDRAFT_479261 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  ++ RIVSL+SL L P+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLMKKRIVSLVSLILNPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C+ E+CT  ERDRYEKSIYKAQRNG+LC A  LLYWCI+RICKY+K+++R+E
Sbjct  61   WKNEHRLLCSSEVCTTTERDRYEKSIYKAQRNGVLCAAGILLYWCIFRICKYHKDLERLE  120

Query  403  EVEKRAKDN  429
            E+EKR KD 
Sbjct  121  ELEKRYKDE  129



>gb|KFK39106.1| hypothetical protein AALP_AA3G201800 [Arabis alpina]
Length=129

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL L P+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMILKKRIVSLVSLILNPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++R+E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLERLE  120

Query  403  EVEKRAKDN  429
            E+EK+ K++
Sbjct  121  ELEKKYKED  129



>ref|XP_003528988.1| PREDICTED: uncharacterized protein LOC100779979 [Glycine max]
 gb|KHN25101.1| hypothetical protein glysoja_027515 [Glycine soja]
Length=129

 Score =   178 bits (452),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+AILLTLP+PK LR R  SL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWLILTYVVAAEAAVAILLTLPTPKLLRDRFASLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CTAAERDRYEKSIYKAQRN ILCV ACLLYW I RICKY KEIQ +E
Sbjct  61   WKNEHRLMCTSEVCTAAERDRYEKSIYKAQRNVILCVTACLLYWSISRICKYQKEIQSLE  120

Query  403  EVEKRAKDN  429
            E EKR K +
Sbjct  121  EGEKRIKSH  129



>ref|XP_010487673.1| PREDICTED: uncharacterized protein LOC104765623 [Camelina sativa]
Length=129

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIAI+LT P P  L+ RIVSL+SL L P+  +V F+ FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAIILTFPYPMLLKKRIVSLVSLILNPAASVVAFSGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CT  ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKY+K+I+R+E
Sbjct  61   WKNEHRLMCSSEVCTTTERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYHKDIERLE  120

Query  403  EVEKRAKDN  429
            E+EKR KD 
Sbjct  121  ELEKRCKDE  129



>emb|CDX75928.1| BnaC03g40110D [Brassica napus]
Length=129

 Score =   177 bits (450),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMLLKKRIVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++ +E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>ref|XP_006393407.1| hypothetical protein EUTSA_v10011861mg [Eutrema salsugineum]
 gb|ESQ30693.1| hypothetical protein EUTSA_v10011861mg [Eutrema salsugineum]
Length=129

 Score =   177 bits (450),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  ++ R+VSL+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVVIAVVLTLPYPMLVKKRVVSLVSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK+EHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++R+E
Sbjct  61   WKSEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLERLE  120

Query  403  EVEKRAKDN  429
            E EKR KD 
Sbjct  121  EAEKRYKDE  129



>ref|XP_009113753.1| PREDICTED: uncharacterized protein LOC103839031 [Brassica rapa]
 emb|CDY46882.1| BnaA01g27820D [Brassica napus]
Length=129

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLLKKRIVSLVSLVLQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++ +E
Sbjct  61   WKNEHRLECSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRYK  127



>ref|NP_188405.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02872.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36204.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51399.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76006.1| uncharacterized protein AT3G17780 [Arabidopsis thaliana]
Length=129

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  L+ RIVSLISL L P+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLLKKRIVSLISLILNPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C+ E+CT  ERDR+EKS+YKAQRNG+LC A  LLYWCI+RICKY+K+++R+E
Sbjct  61   WKNEHRLLCSSEVCTTTERDRHEKSVYKAQRNGVLCAAGILLYWCIFRICKYHKDLERLE  120

Query  403  EVEKRAKDN  429
            ++EKR KD 
Sbjct  121  QLEKRYKDE  129



>ref|XP_010505894.1| PREDICTED: uncharacterized protein LOC104782611 [Camelina sativa]
 ref|XP_010465836.1| PREDICTED: uncharacterized protein LOC104746126 [Camelina sativa]
Length=129

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIAI+LT P P  L+ RIVSL+SL L P+  +V F+ FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAIILTFPYPMLLKKRIVSLVSLILNPAASVVAFSGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CT  ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKY+K+++R+E
Sbjct  61   WKNEHRLMCSSEVCTTTERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYHKDLERLE  120

Query  403  EVEKRAKDN  429
            E+EKR KD 
Sbjct  121  ELEKRCKDE  129



>ref|XP_009107356.1| PREDICTED: uncharacterized protein LOC103833002 [Brassica rapa]
 emb|CDY41829.1| BnaA08g03240D [Brassica napus]
Length=129

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  ++ R+VSL+SL LQP+  IV FAAFQL DIY
Sbjct  1    MALQWLILSYVVAAEVVIAVVLTLPYPMVVKKRVVSLVSLVLQPAASIVAFAAFQLCDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++ +E
Sbjct  61   WKNEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLELLE  120

Query  403  EVEKRAKDN  429
            E EKR KD 
Sbjct  121  EAEKRHKDE  129



>emb|CDY71089.1| BnaCnng71290D [Brassica napus]
Length=129

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLLKKRIVSLVSLVLQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK++  +E
Sbjct  61   WKNEHRLECSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLDHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRYK  127



>gb|KHN43655.1| hypothetical protein glysoja_027721 [Glycine soja]
Length=129

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+ILTY VA EAA+AILLTLP+PK LR+R  SL+SL LQP+LFIVPFA F LLD+Y
Sbjct  1    MGLQWLILTYVVAAEAAVAILLTLPTPKLLRNRFASLVSLILQPALFIVPFAGFHLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CTAAERDRYEKSIYKAQRN ILCV ACLLYW I RICKY KEIQ +E
Sbjct  61   WKNEHRLMCTSEVCTAAERDRYEKSIYKAQRNVILCVTACLLYWSISRICKYQKEIQSLE  120

Query  403  EVEKRAK  423
            EVEKR K
Sbjct  121  EVEKRIK  127



>ref|XP_010939999.1| PREDICTED: uncharacterized protein LOC105058688 [Elaeis guineensis]
 ref|XP_010940000.1| PREDICTED: uncharacterized protein LOC105058688 [Elaeis guineensis]
Length=129

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL++ VA EAA+A+L+TLP+P+ L+SRIV+L SL LQP   ++PFAAFQLLD++
Sbjct  1    MALQWMILSWVVAAEAAVALLVTLPAPRLLKSRIVALASLLLQPLTGVLPFAAFQLLDLH  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C G++CT  ER RYEKSI+KAQRN ILCV ACLLYWCIY ICKYNKEI+ +E
Sbjct  61   WKNEHRLICAGDVCTTDERIRYEKSIFKAQRNVILCVLACLLYWCIYHICKYNKEIKELE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRVKEQ  129



>ref|XP_002891431.1| hypothetical protein ARALYDRAFT_473983 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67690.1| hypothetical protein ARALYDRAFT_473983 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA E  I ++LTLP P  L+ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILTYVVAAEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++R+E
Sbjct  61   WKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLERLE  120

Query  403  EVEKRAKDN  429
              EKR K+ 
Sbjct  121  ATEKRYKEE  129



>emb|CDX82347.1| BnaA03g34740D [Brassica napus]
Length=129

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMLLKKRIVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK++  +E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLDYLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>ref|NP_001049510.1| Os03g0240700 [Oryza sativa Japonica Group]
 gb|ABF94889.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11424.1| Os03g0240700 [Oryza sativa Japonica Group]
 dbj|BAG92702.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74842.1| hypothetical protein OsI_10697 [Oryza sativa Indica Group]
Length=129

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VA EAA+A++LTLP+P+ +R +IV L S+ LQP   I+PFAAFQLLDIY
Sbjct  1    MALQWMILACVVAAEAAVAVMLTLPAPRAVRKQIVGLTSMLLQPFAGILPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT EICTA ER R+EKSI+KAQRN ILCV+ACLLYWCI+RICKYNK+I+ +E
Sbjct  61   WKNEHRLMCTSEICTADERIRFEKSIFKAQRNVILCVSACLLYWCIFRICKYNKDIKALE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  ETEKRLKEE  129



>emb|CDX92160.1| BnaA05g22470D [Brassica napus]
Length=129

 Score =   176 bits (445),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  ++ R+VSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVVLTLPYPMLVKKRVVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++ +E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>ref|XP_009145977.1| PREDICTED: uncharacterized protein LOC103869652 [Brassica rapa]
Length=129

 Score =   176 bits (445),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  ++ R+VSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLVKKRVVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++ +E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>emb|CDX75934.1| BnaC03g40170D [Brassica napus]
Length=129

 Score =   176 bits (445),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMLLKKRIVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ER+RYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++ +E
Sbjct  61   WKNEHRLMCSSEVCTATERNRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>ref|XP_008798490.1| PREDICTED: uncharacterized protein LOC103713366 [Phoenix dactylifera]
 ref|XP_008798495.1| PREDICTED: uncharacterized protein LOC103713366 [Phoenix dactylifera]
 ref|XP_008798502.1| PREDICTED: uncharacterized protein LOC103713366 [Phoenix dactylifera]
Length=129

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL++ VA EAA+A+L+TLPSP+ ++SRIV+L SL LQP   ++PFA FQLLD++
Sbjct  1    MALQWMILSWVVAAEAAVAVLVTLPSPRLIKSRIVALASLLLQPLTGVLPFAGFQLLDLH  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C G++CT  ER RYEKSI+KAQRN ILCV+ACLLYWCIYR+CKY+KEI+ +E
Sbjct  61   WKNEHRLICAGDVCTTDERIRYEKSIFKAQRNVILCVSACLLYWCIYRVCKYHKEIKELE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRLKEQ  129



>gb|KFK36093.1| hypothetical protein AALP_AA4G076500 [Arabis alpina]
Length=129

 Score =   175 bits (444),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA EA I  LLTLP P  L+ R+VSL SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEAVIVSLLTLPYPMLLKKRVVSLFSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL C+ E+CTA ERDRYEKSIYKAQRN +LC  A LLYWCIYRICKYNK+++ ++
Sbjct  61   WKNEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAGAILLYWCIYRICKYNKDLEVLQ  120

Query  403  EVEKRAKDN  429
              EKR K++
Sbjct  121  ATEKRLKED  129



>ref|NP_564527.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAM63043.1| unknown [Arabidopsis thaliana]
 gb|AAO00803.1| expressed protein [Arabidopsis thaliana]
 gb|AAP37799.1| At1g48440 [Arabidopsis thaliana]
 gb|AEE32292.1| protein B-cell receptor-associated 31-like protein [Arabidopsis 
thaliana]
Length=129

 Score =   175 bits (443),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VAVE  I ++LTLP P  L+ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAVEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++R+E
Sbjct  61   WKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLERLE  120

Query  403  EVEKRAKDN  429
              EKR K+ 
Sbjct  121  ATEKRFKEE  129



>ref|XP_009136035.1| PREDICTED: uncharacterized protein LOC103860192 [Brassica rapa]
Length=132

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMLLKKRIVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK++  +E
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLDYLE  120

Query  403  EVEKR  417
            E+EKR
Sbjct  121  ELEKR  125



>ref|XP_006649710.1| PREDICTED: uncharacterized protein LOC102721815 [Oryza brachyantha]
Length=129

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VA EAA+A++LTLP+P+ +R +IV L S+ LQP   I+PFAAFQLLDIY
Sbjct  1    MALQWMILACVVAAEAAVAVMLTLPAPRAVRKQIVGLTSMLLQPFAGILPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT EICTA ER R+EKSI+KAQRN ILCV+ACLLYWCI+RICKYNK+I+ +E
Sbjct  61   WKQEHRLMCTSEICTADERIRFEKSIFKAQRNVILCVSACLLYWCIFRICKYNKDIKALE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  ETEKRLKEE  129



>ref|XP_009414793.1| PREDICTED: uncharacterized protein LOC103995818 [Musa acuminata 
subsp. malaccensis]
Length=129

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+IL   VA+EAA+A+LLTLP+P+ ++SRIV+L SL LQP   I+PFAAFQ LD+ 
Sbjct  1    MGLQWVILAGVVAMEAAVAVLLTLPAPRLVKSRIVALASLLLQPGASILPFAAFQFLDLR  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT E+CT  ER RYEKSI+KAQRN ILCV+ACLLYWCI+RICKY+KEI+ +E
Sbjct  61   WKNEHRLMCTFEVCTTEERTRYEKSIFKAQRNVILCVSACLLYWCIFRICKYHKEIRELE  120

Query  403  EVEKRAKDN  429
            EVEK  KD 
Sbjct  121  EVEKHLKDQ  129



>ref|XP_010936892.1| PREDICTED: uncharacterized protein LOC105056401 [Elaeis guineensis]
 ref|XP_010936893.1| PREDICTED: uncharacterized protein LOC105056401 [Elaeis guineensis]
Length=129

 Score =   172 bits (437),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+IL++ VA EAA A+L+TLP+P+ ++SRIV+L SL LQP   ++PFAAFQLLD++
Sbjct  1    MGLQWMILSWVVAAEAAAAVLVTLPAPRLIKSRIVALASLALQPLGGVIPFAAFQLLDLH  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK+EHRL+C G++CT  ER RYEKSI+KAQRN ILCV+ACLLYWCIYR+CKY+KEI+ +E
Sbjct  61   WKSEHRLICAGDVCTTDERIRYEKSIFKAQRNVILCVSACLLYWCIYRVCKYHKEIKELE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRLKEQ  129



>emb|CDX95822.1| BnaC05g35730D [Brassica napus]
Length=129

 Score =   172 bits (437),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AIA++LTLP P  ++ R+VSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVAIAVILTLPYPMLVKKRVVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMC+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCI+RICKYNK+++ +E
Sbjct  61   WKYEHRLMCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIFRICKYNKDLEHLE  120

Query  403  EVEKRAK  423
            E+EKR K
Sbjct  121  ELEKRCK  127



>ref|XP_004985052.1| PREDICTED: uncharacterized protein LOC101783228 [Setaria italica]
Length=129

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VAVEAA+A L+TLP+P+ +R +IV+L SL LQP   ++PFAAFQLLDIY
Sbjct  1    MALQWMILACVVAVEAAVAALVTLPAPRAVRGQIVALTSLLLQPMASVIPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT EICTA ER R+EKS++KAQRN ILCV+ACLLYWCIYR+ KYNK+I+ +E
Sbjct  61   WKKEHRLMCTSEICTAEERIRFEKSMFKAQRNVILCVSACLLYWCIYRVVKYNKDIKALE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  ETEKRLKEE  129



>emb|CDX77312.1| BnaC08g03570D [Brassica napus]
Length=129

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  ++ R+VSL+SL LQP+  IV FAAF L DIY
Sbjct  1    MALQWLILSYVVAAEVVIAVVLTLPYPMVVKKRVVSLVSLILQPAASIVAFAAFPLCDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A   LYWCIYRICKYNK+++ +E
Sbjct  61   WKNEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGIFLYWCIYRICKYNKDLELLE  120

Query  403  EVEKRAKDN  429
            E EKR KD 
Sbjct  121  EAEKRHKDE  129



>ref|XP_007152652.1| hypothetical protein PHAVU_004G147600g [Phaseolus vulgaris]
 gb|ESW24646.1| hypothetical protein PHAVU_004G147600g [Phaseolus vulgaris]
Length=129

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+AILLTLP+PK LR+R  SL+SL LQP+LFIVPFA F LLDIY
Sbjct  1    MALQWLILTYVVAAEAAVAILLTLPTPKLLRNRFASLVSLILQPALFIVPFAGFHLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT ++CTAAERDRYEKSIYKAQRN ILC+ + LLYW I RICKY K+++ ME
Sbjct  61   WKNEHRLMCTSDVCTAAERDRYEKSIYKAQRNVILCITSILLYWSISRICKYQKDVESME  120

Query  403  EVEKRAKDN  429
            EVEKR K  
Sbjct  121  EVEKRYKSQ  129



>ref|XP_008787911.1| PREDICTED: uncharacterized protein LOC103705820 [Phoenix dactylifera]
Length=129

 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW++L + VAVEAA+A L+TLP+P+ ++SRIV+L+SL LQP   ++PFAAFQLLDI+
Sbjct  1    MALQWMVLAWVVAVEAAVAALVTLPAPRLVKSRIVALVSLLLQPLTAVLPFAAFQLLDIH  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+C G++CT  ER RYEKSI+KAQRN ILCV ACLLYWCIYR CKYNKEI+ +E
Sbjct  61   WKNEHRLICAGDVCTTDERIRYEKSIFKAQRNVILCVLACLLYWCIYRFCKYNKEIKELE  120

Query  403  EVEKRAKDN  429
            EVE R K+ 
Sbjct  121  EVENRLKEQ  129



>ref|XP_006305724.1| hypothetical protein CARUB_v10010483mg [Capsella rubella]
 gb|EOA38622.1| hypothetical protein CARUB_v10010483mg [Capsella rubella]
Length=168

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +1

Query  13   RKLENTEKKTMALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVP  192
            +K  +  + TMALQW+IL+Y VAVE  IA++LTLP P  L+ R+V L+SL LQP+  IV 
Sbjct  30   KKERSRRRTTMALQWLILSYVVAVEVVIALMLTLPYPMLLKKRVVQLVSLILQPAASIVA  89

Query  193  FAAFQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRIC  372
            F+ FQLLDIYWK EHRL C+ E+CTA ERDRYEKS YKAQRN +LC A  LLYWCIYRIC
Sbjct  90   FSGFQLLDIYWKAEHRLSCSSEVCTATERDRYEKSTYKAQRNVVLCAAGILLYWCIYRIC  149

Query  373  KYNKEIQRMEEVEKRAKDN  429
            KYNK+++ +E  EKR K+ 
Sbjct  150  KYNKDLELLEATEKRFKEE  168



>ref|XP_002465577.1| hypothetical protein SORBIDRAFT_01g041440 [Sorghum bicolor]
 gb|EER92575.1| hypothetical protein SORBIDRAFT_01g041440 [Sorghum bicolor]
Length=129

 Score =   170 bits (430),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VAVEAA+A L+TLP P+ +R +IV+L SL LQP   ++PFAAFQLLDIY
Sbjct  1    MALQWMILACVVAVEAAVAALVTLPVPRAVRGQIVALTSLFLQPLSTVIPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT EICTA ER R+EKS++KAQRN ILCV+ACLLYWCIYRI K+NK+I+ +E
Sbjct  61   WKKEHRLMCTAEICTAEERIRFEKSMFKAQRNVILCVSACLLYWCIYRIVKFNKDIKALE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  ETEKRLKEE  129



>ref|XP_009383620.1| PREDICTED: uncharacterized protein LOC103971348 [Musa acuminata 
subsp. malaccensis]
Length=129

 Score =   167 bits (424),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW+IL   VA EAA+A LL LP+P+ ++SRIV+L SL LQP   I+PFAAFQLLD++
Sbjct  1    MGLQWVILGAVVAAEAAVAALLILPAPRVIKSRIVALASLFLQPGAGILPFAAFQLLDLH  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT ++CT  ER RYEKSI+KAQRN ILCV ACLLYWCI+RICKY+KEI+ +E
Sbjct  61   WKNEHRLMCTSDVCTIEERTRYEKSIFKAQRNIILCVLACLLYWCIFRICKYHKEIRELE  120

Query  403  EVEKRAKDN  429
            EVEKR KD 
Sbjct  121  EVEKRLKDQ  129



>ref|XP_010500370.1| PREDICTED: uncharacterized protein LOC104777761 [Camelina sativa]
Length=130

 Score =   167 bits (423),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  I ++LTLP P  ++ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAAEVVITLVLTLPYPMLIKKRVVQLVSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICK+NK+++ +E
Sbjct  61   WKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKFNKDLELLE  120

Query  403  -EVEKRAKDN  429
             E +KR+K+ 
Sbjct  121  AEAKKRSKEE  130



>ref|NP_001130825.1| uncharacterized protein LOC100191929 precursor [Zea mays]
 ref|XP_008673772.1| PREDICTED: uncharacterized protein LOC100191929 isoform X1 [Zea 
mays]
 gb|ACF79191.1| unknown [Zea mays]
 gb|ACG31063.1| erwinia induced protein 2 [Zea mays]
 gb|ACG44789.1| erwinia induced protein 2 [Zea mays]
 gb|ACN31068.1| unknown [Zea mays]
 tpg|DAA44320.1| TPA: erwinia induced protein 2 isoform 1 [Zea mays]
 tpg|DAA44321.1| TPA: erwinia induced protein 2 isoform 2 [Zea mays]
Length=129

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VAVEAA+A L+TLP P+ +R +IV+L SL LQP   ++PFAAFQ+LD+Y
Sbjct  1    MALQWMILACVVAVEAAVAALVTLPVPRAVRGQIVALTSLFLQPLSSVIPFAAFQILDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRLMCT EICTA ER R+EKS++KAQRN ILCV+ACLLYWCIYRI K NK+I+ +E
Sbjct  61   WKKEHRLMCTSEICTAEERIRFEKSMFKAQRNVILCVSACLLYWCIYRIVKLNKDIKALE  120

Query  403  EVEKRAKDN  429
            E EKR K+ 
Sbjct  121  ETEKRLKEE  129



>gb|ABK21211.1| unknown [Picea sitchensis]
 gb|ABK24315.1| unknown [Picea sitchensis]
Length=129

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW++L Y V  EA  A+LLT P P+ L++R+V+ +S  LQP++ IVPFA FQLLDIY
Sbjct  1    MALQWVMLGYVVVGEALAALLLTFPWPRMLKTRLVATLSSLLQPAMGIVPFAIFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRLMCT + CT+ ERDRYE+SIYKAQRN +L V+ACLLYW I+RICKY  EIQ +E
Sbjct  61   WKNEHRLMCTSDACTSVERDRYERSIYKAQRNAVLSVSACLLYWIIFRICKYYNEIQNLE  120

Query  403  EVEKRAKDN  429
            E  KR K+ 
Sbjct  121  EQIKRWKET  129



>dbj|BAJ93962.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01614.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89949.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02663.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99502.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=129

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW++LT  V  EAA+A L+TLP+P+ +R++IV L S+ LQP   ++PFAAFQLLDIY
Sbjct  1    MGLQWMLLTCVVGAEAAVAALVTLPAPRAVRAQIVGLTSMLLQPLAGVLPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+CTGE+CT+ ER R+EKSI+K+QRN ILCV+  +LYW IYRICK+NK+I+ +E
Sbjct  61   WKNEHRLICTGEMCTSEERVRFEKSIFKSQRNVILCVSVFILYWSIYRICKFNKDIKALE  120

Query  403  EVEKRAKDN  429
            EVEKR K+ 
Sbjct  121  EVEKRIKEE  129



>ref|XP_010461666.1| PREDICTED: uncharacterized protein LOC104742361 [Camelina sativa]
 ref|XP_010479267.1| PREDICTED: uncharacterized protein LOC104758145 [Camelina sativa]
Length=130

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  I ++LTLP P  ++ R+V L+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVITLMLTLPYPMLIKKRVVQLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EHRL C+ E+CTA ERDR EKSIYKAQRN +LC A  LLYWCIYRICK+NK+++ +E
Sbjct  61   WKAEHRLSCSSEVCTATERDRSEKSIYKAQRNVVLCAAGILLYWCIYRICKFNKDLELLE  120

Query  403  -EVEKRAKDN  429
             E +KR+K+ 
Sbjct  121  AEAKKRSKEE  130



>ref|XP_002285098.1| PREDICTED: uncharacterized protein LOC100259425 [Vitis vinifera]
 emb|CBI26798.3| unnamed protein product [Vitis vinifera]
Length=129

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW++L Y VA EAAIA+++TLPSPK ++SRIVSL+SL L P   ++PFAAFQLLDIY
Sbjct  1    MGLQWMVLGYVVAAEAAIALVITLPSPKLVKSRIVSLVSLLLSPLAGVIPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WKNEHRL+CT E CTA ERDRYEKSIYKAQRN +LC AACLLYW I  ICKY K+IQ +E
Sbjct  61   WKNEHRLICTSETCTAGERDRYEKSIYKAQRNALLCGAACLLYWSICAICKYYKKIQSLE  120

Query  403  EVEKRAKDN  429
            EVEK+ KD 
Sbjct  121  EVEKKYKDQ  129



>gb|EMT11703.1| hypothetical protein F775_29923 [Aegilops tauschii]
Length=136

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 7/136 (5%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW++LT  V  EAA+A LLTLP+P+ +R++IV L S+ LQP   ++PFAAFQLLDIY
Sbjct  1    MGLQWMLLTCVVGAEAAVAALLTLPAPRAVRAQIVGLTSMLLQPMAAVLPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEK-------SIYKAQRNGILCVAACLLYWCIYRICKYN  381
            WKNEHRL+CTGE+CT+ ER R+EK       SI+K+QRN ILCV+  +LYW IYRICK+N
Sbjct  61   WKNEHRLICTGEMCTSEERVRFEKSGFLPFGSIFKSQRNVILCVSVFILYWSIYRICKFN  120

Query  382  KEIQRMEEVEKRAKDN  429
            K+I+ +EEVEKR K+ 
Sbjct  121  KDIKALEEVEKRIKEE  136



>gb|EEE58670.1| hypothetical protein OsJ_10088 [Oryza sativa Japonica Group]
Length=90

 Score =   143 bits (360),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  LTLQPSLFIVPFAAFQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAA  339
            + LQP    +PF AFQLLDIYWKNEHRLMCT EICTA ER R+EKSI+KAQRN ILCV+A
Sbjct  1    MLLQPFAGKIPFGAFQLLDIYWKNEHRLMCTSEICTADERIRFEKSIFKAQRNVILCVSA  60

Query  340  CLLYWCIYRICKYNKEIQRMEEVEKRAKD  426
            CLLYWCI+RICKYNK+I+ +EE EKR K+
Sbjct  61   CLLYWCIFRICKYNKDIKALEETEKRLKE  89



>ref|XP_006406691.1| hypothetical protein EUTSA_v10021758mg [Eutrema salsugineum]
 gb|ESQ48144.1| hypothetical protein EUTSA_v10021758mg [Eutrema salsugineum]
Length=103

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E AI I+LTLP P  L+ RIVSLISL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVAIVIILTLPYPMLLKKRIVSLISLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLY  351
            WKNEHRLMC+ E+CTA ERDRYEKSIYKAQRN ++C A  LLY
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSIYKAQRNVVMCAAGILLY  103



>gb|EMS52490.1| hypothetical protein TRIUR3_23930 [Triticum urartu]
Length=90

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  160  LTLQPSLFIVPFAAFQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAA  339
            + LQP   ++PFAAFQLLDIYWKNEHRL+CTGE+CT+ ER R+EKSI+K+QRN ILCV+ 
Sbjct  1    MLLQPFAAVLPFAAFQLLDIYWKNEHRLICTGEMCTSEERVRFEKSIFKSQRNVILCVSV  60

Query  340  CLLYWCIYRICKYNKEIQRMEEVEKRAKD  426
             +LYW IYRICK+NK+I+ +EEVEKR KD
Sbjct  61   FILYWSIYRICKFNKDIKALEEVEKRIKD  89



>ref|XP_003558389.1| PREDICTED: uncharacterized protein LOC100825757 [Brachypodium 
distachyon]
Length=129

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL   VA EAA+A LLTLP+P+ +R +IV L S+ LQP   ++PFA FQLLDIY
Sbjct  1    MALQWMILACVVAAEAAVAALLTLPAPRAVRGQIVGLTSMFLQPFAGVLPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK EHRLMCT E+CTA ER  +EK+I+KAQRN ILCV+  LLYW IYRICK NK+I+ +
Sbjct  61   WKKEHRLMCTTEVCTAEERVHFEKAIFKAQRNVILCVSVFLLYWSIYRICKINKDIKAL  119



>gb|KJB39221.1| hypothetical protein B456_007G002900 [Gossypium raimondii]
 gb|KJB39223.1| hypothetical protein B456_007G002900 [Gossypium raimondii]
Length=93

 Score =   130 bits (327),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLTLPSPK L++R+VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYMVAAEAALALLLTLPSPKLLKNRLVSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQ  312
            WKNEHRLMCT EICTAAERDRYEKS++   
Sbjct  61   WKNEHRLMCTSEICTAAERDRYEKSVHPTH  90



>gb|KJB30252.1| hypothetical protein B456_005G134500 [Gossypium raimondii]
Length=97

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A+LLT PSPK L++R VSLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAALALLLTFPSPKLLKNRFVSLISLILQPTLFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSI  300
            WKNEHRLMCT +ICTAAERDRYEKS+
Sbjct  61   WKNEHRLMCTSDICTAAERDRYEKSL  86



>gb|KEH26740.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=99

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA+EAA+AILLTLPSPK LR+R+ SLISL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAIEAAVAILLTLPSPKLLRNRLTSLISLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKS  297
            WK EHRLMCT ++CTAAERDRYEK+
Sbjct  61   WKAEHRLMCTSDVCTAAERDRYEKT  85



>ref|XP_010091755.1| hypothetical protein L484_019343 [Morus notabilis]
 gb|EXB45118.1| hypothetical protein L484_019343 [Morus notabilis]
Length=111

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VAVEAA+AILLTLPSPK L++R VSL+SL LQPS FI+PFA FQLLD+Y
Sbjct  1    MALQWMILTYVVAVEAALAILLTLPSPKLLKNRFVSLVSLILQPSFFIIPFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSI  300
            WK+EHRLMC+ EICTA ERDRYEKSI
Sbjct  61   WKSEHRLMCSSEICTATERDRYEKSI  86



>ref|XP_006441339.1| hypothetical protein CICLE_v100228441mg, partial [Citrus clementina]
 gb|ESR54579.1| hypothetical protein CICLE_v100228441mg, partial [Citrus clementina]
Length=85

 Score =   123 bits (309),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL YAVA EAAIAILLT+PSPK L++R+VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWLILAYAVAAEAAIAILLTIPSPKLLKNRLVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKS  297
            WK+EHRLMCT EICTAAERDRYEKS
Sbjct  61   WKSEHRLMCTSEICTAAERDRYEKS  85



>gb|KDO46494.1| hypothetical protein CISIN_1g033003mg [Citrus sinensis]
Length=120

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL YAVA EAAIAILLT+PSPK L++R+VSL+SL LQP+LFIVPFA FQLLDIY
Sbjct  1    MALQWLILAYAVAAEAAIAILLTIPSPKLLKNRLVSLVSLILQPALFIVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKS  297
            WK+EHRLMCT EICTAAERDRYEKS
Sbjct  61   WKSEHRLMCTSEICTAAERDRYEKS  85



>gb|KEH27880.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=93

 Score =   122 bits (307),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  211  LDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEI  390
             DIYWK EHRLMCT ++CTAAERDRYEK+ YKAQRN ILC++ACLLYW IYRICK+ K+I
Sbjct  21   FDIYWKAEHRLMCTSDVCTAAERDRYEKTTYKAQRNVILCISACLLYWSIYRICKFQKDI  80

Query  391  QRMEEVEKRAK  423
            Q MEEVEKR K
Sbjct  81   QSMEEVEKRIK  91



>ref|XP_010042814.1| PREDICTED: uncharacterized protein LOC104432003 [Eucalyptus grandis]
Length=119

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+ILTY VA EAA+A LLTLPSPK L++ +VS +SL LQP+LF+VPFA FQLLDIY
Sbjct  1    MALQWMILTYVVAAEAAVAFLLTLPSPKFLKNHLVSFVSLVLQPALFVVPFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYK  306
            WK+EHRL CT +ICTAAERDRYEK++ +
Sbjct  61   WKSEHRLSCTSDICTAAERDRYEKAVSR  88



>emb|CDX75929.1| BnaC03g40120D [Brassica napus]
Length=93

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VA E  IA++LTLP P  L+ RIVSL+SL LQP+  IV FA FQLLD+Y
Sbjct  1    MALQWLILSYVVAAEVVIAVILTLPYPMLLKKRIVSLVSLILQPAASIVAFAGFQLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSI  300
            WKNEHRLMC+ E+CTA ERDRYEKS+
Sbjct  61   WKNEHRLMCSSEVCTATERDRYEKSV  86



>gb|AAF79693.1|AC020889_1 T1N15.5 [Arabidopsis thaliana]
Length=90

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW+IL+Y VAVE  I ++LTLP P  L+ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct  1    MALQWLILSYVVAVEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSI  300
            WK EHRL C+ E+CTA ERDRYEKS+
Sbjct  61   WKAEHRLSCSSEVCTATERDRYEKSV  86



>dbj|BAJ90058.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M LQW++LT  V  EAA+A L+TLP+P+ +R++IV L S+ LQP   ++PFAAFQLLDIY
Sbjct  1    MGLQWMLLTCVVGAEAAVAALVTLPAPRAVRAQIVGLTSMLLQPLAGVLPFAAFQLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYK  306
            WKNEHRL+CTGE+CT+ ER R+EKS+ +
Sbjct  61   WKNEHRLICTGEMCTSEERVRFEKSVSE  88



>ref|XP_004297447.1| PREDICTED: uncharacterized protein LOC101298116 [Fragaria vesca 
subsp. vesca]
Length=131

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAVMVLLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E+R  C G+ CT +E  R++KSI K+QRN +L  AA + YW +Y +      I+++ 
Sbjct  61   WKYENRPNCDGDSCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYTVTHLVVRIEQLN  120

Query  403  EVEKRAKDN  429
            +  +R K N
Sbjct  121  QRVERLKKN  129



>ref|XP_010492659.1| PREDICTED: uncharacterized protein LOC104770010 [Camelina sativa]
Length=129

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y + K    I+++ 
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTKLVVRIEQLN  120

Query  403  EVEKRAKDN  429
            +  +R K N
Sbjct  121  QRVERLKSN  129



>ref|XP_002282972.1| PREDICTED: uncharacterized protein LOC100264712 [Vitis vinifera]
Length=131

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSP-KPLRSRIVSLISLTLQPSLFIVPFAAFQLLDI  219
            MAL+W++L YA   EA + +LLTLP P  PLR  ++S+    L+P L +VPF  F L+DI
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPQPINPLRKGLISVTKALLKPFLSVVPFCLFLLMDI  60

Query  220  YWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            YWK E R  C+   C+ ++  R++KS+ K+QRN  L  AA L YW +Y + K    + R+
Sbjct  61   YWKYETRPTCSSHHCSPSDHLRHQKSMMKSQRNATLIAAALLFYWLLYSVTKL---VDRI  117

Query  400  EEVEKRAK  423
            +E+++R +
Sbjct  118  DELDRRVQ  125



>ref|XP_010420425.1| PREDICTED: uncharacterized protein LOC104706006 [Camelina sativa]
 ref|XP_010453901.1| PREDICTED: uncharacterized protein LOC104735751 [Camelina sativa]
Length=129

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKDN  429
            +  +R K+N
Sbjct  121  QRVERLKNN  129



>ref|XP_010558658.1| PREDICTED: uncharacterized protein LOC104827222 [Tarenaya hassleriana]
Length=130

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE C+  E  R++KSI K+QRN IL  AA L YW +Y +      I+++ 
Sbjct  61   WKYEMRPSCDGESCSPTELLRHQKSIMKSQRNAILIAAALLFYWILYSVTHLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>ref|XP_007160414.1| hypothetical protein PHAVU_002G319800g [Phaseolus vulgaris]
 gb|ESW32408.1| hypothetical protein PHAVU_002G319800g [Phaseolus vulgaris]
Length=130

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTIPGLDALRKGLIAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE CT +E  R++KSI K+QRN +L  +A L YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEGESCTPSEHLRHQKSIMKSQRNALLIASALLFYWLLYSVTNLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRLERLKN  128



>ref|XP_008221450.1| PREDICTED: uncharacterized protein LOC103321430 [Prunus mume]
Length=130

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA + YW +Y +      I+ + 
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYTVTHLVIRIEHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_010412946.1| PREDICTED: uncharacterized protein LOC104699324 [Camelina sativa]
Length=131

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W IL YA A+EA + ILLT+P    LR  +  +    L+P L I+PF  F L+DIY
Sbjct  1    MALEWTILAYATALEAIMVILLTMPGLNFLRKGLAVVTRYLLKPLLAIIPFCVFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R+ C G+ CTA+E  RY+KSI+K+QRN +L   A   YW +Y +     +I+++ 
Sbjct  61   WKYETRISCDGDSCTASELLRYQKSIFKSQRNFLLIALALGFYWILYSVSNMVSKIEKLN  120

Query  403  EVEKRAKDN  429
            +   R + N
Sbjct  121  QRVHRLRRN  129



>ref|XP_009351534.1| PREDICTED: uncharacterized protein LOC103943064 [Pyrus x bretschneideri]
Length=130

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTIPGLDGLRKGLVTVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYTVTHLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_007226115.1| hypothetical protein PRUPE_ppa013297mg [Prunus persica]
 gb|EMJ27314.1| hypothetical protein PRUPE_ppa013297mg [Prunus persica]
Length=130

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+ + 
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIASALIFYWLLYTVTHLVIRIEHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>gb|AAM67218.1| unknown [Arabidopsis thaliana]
Length=130

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_010110603.1| hypothetical protein L484_003991 [Morus notabilis]
 gb|EXC26994.1| hypothetical protein L484_003991 [Morus notabilis]
Length=130

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLSSLRKGLVAVTKNLLKPFLSIVPFCIFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  E CT +E  R++KSI K+QRN +L  AA + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCEAESCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYSVTHLVIRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|NP_197221.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_006286604.1| hypothetical protein CARUB_v10002249mg [Capsella rubella]
 dbj|BAB10506.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36316.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45077.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98633.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92394.1| uncharacterized protein AT5G17190 [Arabidopsis thaliana]
 gb|EOA19502.1| hypothetical protein CARUB_v10002249mg [Capsella rubella]
Length=130

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_001751217.1| predicted protein [Physcomitrella patens]
 gb|EDQ83534.1| predicted protein [Physcomitrella patens]
Length=130

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W  L    AVEA I +LLT+P    +R  ++S+  + LQP L +VP A F  L+IY
Sbjct  1    MALEWAALGVVTAVEALILLLLTMPGLGGMRRGLISVSRMALQPLLAVVPLALFLALEIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK EH   CTG  C   ERDR  KS+ K+QRN IL   A LLYW +YR+      + +ME
Sbjct  61   WKFEHMPECTGPRCGPMERDRASKSLMKSQRNAILVAGALLLYWTLYRVTAM---MVKME  117

Query  403  EVEKRAKD  426
            ++  + K+
Sbjct  118  QLSTQLKN  125



>ref|XP_006400249.1| hypothetical protein EUTSA_v10015011mg [Eutrema salsugineum]
 gb|ESQ41702.1| hypothetical protein EUTSA_v10015011mg [Eutrema salsugineum]
Length=130

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLIAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_001776047.1| predicted protein [Physcomitrella patens]
 gb|EDQ59092.1| predicted protein [Physcomitrella patens]
Length=129

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MALQW +L     VEAA+ +LL+ P P  L  +++  +   LQP L +VPFA FQLL++Y
Sbjct  1    MALQWYLLGAIAVVEAAVLLLLSAPLPPRLSKQVLEFVKRILQPGLAVVPFALFQLLEVY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E+R+ C+ + C+  ERDR++++++K+ RN +L ++A   YW ++RI K  +++ + E
Sbjct  61   WKYENRINCSKQECSPFERDRFQRTLFKSHRNALLAISAAFFYWLLFRIAKMQQDLLQAE  120

Query  403  EVEKRAKD  426
               K AK+
Sbjct  121  NRVKLAKE  128



>ref|XP_009126167.1| PREDICTED: uncharacterized protein LOC103851086 [Brassica rapa]
 emb|CDY02730.1| BnaC02g07050D [Brassica napus]
Length=130

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLIAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEI----  390
            WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I    
Sbjct  61   WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN  120

Query  391  QRMEEVEKR  417
            QR+E + KR
Sbjct  121  QRVERLRKR  129



>gb|EYU45788.1| hypothetical protein MIMGU_mgv1a016220mg [Erythranthe guttata]
Length=130

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + + LTLP   P+R  ++S+    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMLLFLTLPGLDPIRKGLISVTRSLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK +H   C  E CT +E  R++KSI K+QRN +L  +A + YW +Y +     +I  + 
Sbjct  61   WKYDHLPHCESESCTPSEHLRHQKSIMKSQRNALLIASALVFYWLLYSVTALVVKIDVLN  120

Query  403  E-VEK-RAKD  426
            + +EK +A+D
Sbjct  121  KRIEKLKAQD  130



>ref|XP_009602433.1| PREDICTED: uncharacterized protein LOC104097557 [Nicotiana tomentosiformis]
Length=131

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A E  + ILLTLP   PLR  ++S+    L+P L +VPF  F LLDIY
Sbjct  1    MALEWVVLGYAAAAEVVMVILLTLPGTYPLRKGLISVTRNLLKPFLSVVPFCVFLLLDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E CT  E  R++KS+ K+QRN +L  AA + YW +Y + +    + R+
Sbjct  61   WKYETRPSCKSAESCTPTELMRHQKSVVKSQRNALLIAAALMFYWLLYSVTRL---VTRV  117

Query  400  EEVEKRAKD  426
            E + +R + 
Sbjct  118  EMLNQRVEK  126



>ref|XP_006448186.1| hypothetical protein CICLE_v10018373mg [Citrus clementina]
 ref|XP_006469233.1| PREDICTED: uncharacterized protein LOC102624552 [Citrus sinensis]
 gb|ESR61426.1| hypothetical protein CICLE_v10018373mg [Citrus clementina]
Length=130

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ++LTLP    +R  +V++    L+P L +VPF  F LLDIY
Sbjct  1    MALEWVVLGYAAAAEAVMVLMLTLPGLDGIRRGLVAVTRNLLKPFLSVVPFCLFLLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ C+  E  R++KSI K+QRN +L  +A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEGDSCSPTEHLRHQKSIMKSQRNALLIASALVFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>ref|XP_002525982.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36406.1| conserved hypothetical protein [Ricinus communis]
Length=130

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRRGLIAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L   A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPTCEGDSCTPSEHLRHQKSIMKSQRNALLIATALVFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>ref|XP_004236939.1| PREDICTED: uncharacterized protein LOC101267398 [Solanum lycopersicum]
Length=131

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 82/130 (63%), Gaps = 1/130 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W+IL YA A EA + +LLTLP   PLRS ++S+    L+P L +VPF  F LLDIY
Sbjct  1    MALEWVILGYAAAAEAVMVLLLTLPGTYPLRSGLLSVTRNLLKPFLSVVPFCLFLLLDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E CT  E  R++KS+ K+QRN +L  +A + YW +Y + +    ++ +
Sbjct  61   WKYETRPKCKSAESCTPTELMRHQKSMVKSQRNALLIASALMFYWLLYSVTRLVTRVELL  120

Query  400  EEVEKRAKDN  429
             +  ++ K+ 
Sbjct  121  NQRVEKLKNQ  130



>emb|CDY28742.1| BnaCnng06280D [Brassica napus]
Length=130

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMIVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN IL  AA + YW ++ +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNAILIAAALVFYWILFSVTHLVVKIEQLS  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_009130340.1| PREDICTED: uncharacterized protein LOC103855136 [Brassica rapa]
 emb|CDY43146.1| BnaA05g32400D [Brassica napus]
Length=130

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMIVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN IL  AA + YW ++ +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNAILIAAALVFYWILFSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_006408334.1| hypothetical protein EUTSA_v10021756mg [Eutrema salsugineum]
 gb|ESQ49787.1| hypothetical protein EUTSA_v10021756mg [Eutrema salsugineum]
Length=130

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTSLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>gb|ACJ85899.1| unknown [Medicago truncatula]
Length=130

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 80/130 (62%), Gaps = 7/130 (5%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTIPGLDALRKGLVAVTKNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICKYN  381
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA   YW +Y       RI   N
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALPFYWLLYSVTNLVVRIDLLN  120

Query  382  KEIQRMEEVE  411
            + ++R++  E
Sbjct  121  QRLERLKRTE  130



>ref|XP_006355070.1| PREDICTED: uncharacterized protein LOC102581892 [Solanum tuberosum]
Length=131

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 1/130 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W+IL YA A EA + ILLTLP   PLR  ++S+    L+P L +VPF  F LLDIY
Sbjct  1    MALEWVILGYAAAAEAVMVILLTLPGTYPLRKGLISVTRNLLKPFLSVVPFCLFLLLDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E CT  E  R++KSI K+QRN +L  +A + YW +Y + +    ++ +
Sbjct  61   WKYETRPRCKSAESCTPTELMRHQKSIVKSQRNALLIASALMFYWLLYSVTRLVTRVELL  120

Query  400  EEVEKRAKDN  429
             +  ++ K+ 
Sbjct  121  NQRVEKLKNQ  130



>ref|XP_011021790.1| PREDICTED: uncharacterized protein LOC105123770 [Populus euphratica]
Length=130

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRKGLIAVTRNLLKPFMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE CT  E  R++KSI K+QRN +L   A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEGESCTPTEHLRHQKSIMKSQRNALLIGVALVFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_004167650.1| PREDICTED: uncharacterized protein LOC101231117 [Cucumis sativus]
 gb|KGN52359.1| hypothetical protein Csa_5G628640 [Cucumis sativus]
Length=130

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCIFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA + YW +Y +     +++++ 
Sbjct  61   WKYETRPTCESDSCTPSEYLRHQKSIMKSQRNALLIAAALVFYWLLYSVTHLVVKVEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_002284875.1| PREDICTED: uncharacterized protein LOC100252692 [Vitis vinifera]
 emb|CBI26845.3| unnamed protein product [Vitis vinifera]
Length=130

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTLPGLDALRKGLIAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  E CT  E  R++KSI K+QRN +L  AA + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCESESCTPTEHLRHQKSIMKSQRNVLLIAAALIFYWLLYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRLERLKN  128



>emb|CDP01640.1| unnamed protein product [Coffea canephora]
Length=131

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 80/126 (63%), Gaps = 4/126 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++S+    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTVPGFDPLRKGLLSVTRSLLRPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E CT +E  R++KSI K+QRN +L  AA + YW +Y +      + R+
Sbjct  61   WKYETRPTCESAESCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYSVTGL---VVRI  117

Query  400  EEVEKR  417
            E++ KR
Sbjct  118  EQLNKR  123



>ref|XP_010463764.1| PREDICTED: uncharacterized protein LOC104744405 [Camelina sativa]
Length=130

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +      I+ + 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVRIEHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERIKN  128



>ref|XP_002882276.1| hypothetical protein ARALYDRAFT_477563 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010507048.1| PREDICTED: uncharacterized protein LOC104783592 [Camelina sativa]
 ref|XP_010485652.1| PREDICTED: uncharacterized protein LOC104763942 [Camelina sativa]
 gb|EFH58535.1| hypothetical protein ARALYDRAFT_477563 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +      I+ + 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVRIEHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>ref|XP_007045246.1| Integral to membrane, endoplasmic reticulum [Theobroma cacao]
 gb|EOY01078.1| Integral to membrane, endoplasmic reticulum [Theobroma cacao]
Length=130

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRKGLIAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ C+ +E  R++KSI K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETSPHCEGDSCSPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYSVTNLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_011085846.1| PREDICTED: uncharacterized protein LOC105167724 [Sesamum indicum]
Length=130

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 81/127 (64%), Gaps = 7/127 (6%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTVPGLDPLRKGLITVTRSLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICKYN  381
            WK E+R  C  + C+ +E  R++KSI K+QRN +L  +A + YW +Y       +I + N
Sbjct  61   WKYENRPSCESDSCSPSEHLRHQKSIMKSQRNALLIASALVFYWLLYSVTGLVVKIDQLN  120

Query  382  KEIQRME  402
            K I++++
Sbjct  121  KRIEKLK  127



>ref|XP_002871753.1| hypothetical protein ARALYDRAFT_488581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48012.1| hypothetical protein ARALYDRAFT_488581 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  + CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct  61   WKYETRPSCDSDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>gb|ACG47575.1| hypothetical protein [Zea mays]
Length=62

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  244  MCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRMEEVEKRAK  423
            MCT EICTA ER R+EKS++KAQRN ILCV+ACLLYWCIYRI K NK+I+ +EE EKR K
Sbjct  1    MCTSEICTAEERIRFEKSMFKAQRNVILCVSACLLYWCIYRIVKLNKDIKALEETEKRLK  60

Query  424  D  426
            +
Sbjct  61   E  61



>ref|NP_566195.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF26109.1|AC012328_12 unknown protein [Arabidopsis thaliana]
 gb|AAL38833.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20356.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67150.1| unknown [Arabidopsis thaliana]
 gb|AEE73908.1| uncharacterized protein AT3G03160 [Arabidopsis thaliana]
Length=130

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     +I+ + 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVKIEHLN  120

Query  403  EVEKRAKD  426
            +  +R ++
Sbjct  121  QRIERLRN  128



>emb|CDX85472.1| BnaA02g03410D [Brassica napus]
Length=273

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +1

Query  25   NTEKKTMALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAF  204
            N +   MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L I+PF  F
Sbjct  138  NRKPSPMALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLIAVTRNLLKPFLSIIPFCLF  197

Query  205  QLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNK  384
             L+DIYWK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +     
Sbjct  198  LLMDIYWKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVV  257

Query  385  EI----QRMEEVEKR  417
             I    QR+E + KR
Sbjct  258  RIEQLNQRVERLRKR  272



>ref|XP_002311526.1| hypothetical protein POPTR_0008s13310g [Populus trichocarpa]
 gb|ABK93938.1| unknown [Populus trichocarpa]
 gb|EEE88893.1| hypothetical protein POPTR_0008s13310g [Populus trichocarpa]
Length=130

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRKGLLAVTRNLLKPFMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE C+  E  R++KSI K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEGESCSPTEHLRHQKSIMKSQRNALLIGAALIFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKDN  429
            +  +R K  
Sbjct  121  QRVERLKSK  129



>ref|XP_004250171.1| PREDICTED: uncharacterized protein LOC101253957 [Solanum lycopersicum]
 ref|XP_006364613.1| PREDICTED: uncharacterized protein LOC102578292 [Solanum tuberosum]
Length=130

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++S+    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTVPGLNPLRKGLISVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  E C+ +E  R++KSI K+QRN +L   A + YW +Y +     +++++ 
Sbjct  61   WKYETRPTCESESCSPSEYLRHQKSIMKSQRNALLIACALVFYWLLYSVTGLVVKVEQLN  120

Query  403  E-VEK-RAKD  426
            + VEK +A D
Sbjct  121  KRVEKMKASD  130



>gb|KFK37757.1| hypothetical protein AALP_AA3G026000 [Arabis alpina]
Length=130

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMIVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW ++ +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILFSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>emb|CDX92034.1| BnaC03g33360D [Brassica napus]
Length=130

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V +    L+P L IVP   F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDGLRKGLVGVTRNLLKPFLSIVPLCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     EI+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTHLVVEIEQLN  120

Query  403  EVEKRAK  423
            +  +R K
Sbjct  121  QRIERLK  127



>gb|ACN39834.1| unknown [Picea sitchensis]
 gb|ACN41194.1| unknown [Picea sitchensis]
Length=130

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + + LT+P    LR  +V +    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLFLTMPGLDRLRKGLVVVTRNALKPMLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM-  399
            WK E    C G +C+ +E  R++KS+ K+QRN +L  +A LLYW ++ +      I+RM 
Sbjct  61   WKYETSPSCEGHMCSPSEHLRHQKSVMKSQRNFMLIASALLLYWLLFCVTNMVMRIERMN  120

Query  400  EEVEK  414
            E++EK
Sbjct  121  EQIEK  125



>ref|XP_002315860.1| hypothetical protein POPTR_0010s11830g [Populus trichocarpa]
 gb|ABK94090.1| unknown [Populus trichocarpa]
 gb|EEF02031.1| hypothetical protein POPTR_0010s11830g [Populus trichocarpa]
Length=130

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  + ++    L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRKGLSAVTRNLLKPFMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE CT  E  R++KSI K+QRN +L   A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEGESCTPTEHLRHQKSIMKSQRNALLIGVALVFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_010509009.1| PREDICTED: uncharacterized protein LOC104785488 [Camelina sativa]
Length=131

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W IL YA A EA + ILLT+P P  LR  +  +    L+  L I+PF  F L+DIY
Sbjct  1    MALEWTILAYATAAEAIMVILLTMPGPNFLRKGLAVVTRRLLKLLLAIIPFCVFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R+ C G+ CT +E   Y+KSI+K+QRN +L   A   YW +YR+     +I+++ 
Sbjct  61   WKYETRISCDGDSCTVSELLHYQKSIFKSQRNFLLIALALGFYWILYRVSSMVFKIEKLN  120

Query  403  EVEKRAKDN  429
            +   R + +
Sbjct  121  QRVHRLRRD  129



>ref|XP_006298811.1| hypothetical protein CARUB_v10014915mg [Capsella rubella]
 gb|EOA31709.1| hypothetical protein CARUB_v10014915mg [Capsella rubella]
Length=130

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +      I+ + 
Sbjct  61   WKYETMPSCEGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVRIEHLN  120

Query  403  EVEKRAKD  426
            +  +R ++
Sbjct  121  QRIERLRN  128



>gb|ABK24135.1| unknown [Picea sitchensis]
 gb|ACN40887.1| unknown [Picea sitchensis]
 gb|ACN41168.1| unknown [Picea sitchensis]
Length=130

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 78/125 (62%), Gaps = 1/125 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + + LT+P    LR  +V +    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLFLTMPGLDRLRKGLVVVTRNALKPMLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM-  399
            WK E    C G +C+ +E  R++KS+ K+QRN +L  +A LLYW ++ +      I+RM 
Sbjct  61   WKYETTPSCEGHMCSPSEHLRHQKSVMKSQRNFMLITSALLLYWLLFCVTNMVMRIERMN  120

Query  400  EEVEK  414
            E++EK
Sbjct  121  EQIEK  125



>ref|XP_008350989.1| PREDICTED: uncharacterized protein LOC103414375 [Malus domestica]
Length=155

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTIPGLDGLRKGLVTVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICK  375
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA + YW +Y + K
Sbjct  61   WKYETRPSCHGDSCTPSEHLRHQKSIMKSQRNALLIAAALIFYWLLYTVGK  111



>ref|XP_006295715.1| hypothetical protein CARUB_v10024834mg [Capsella rubella]
 gb|EOA28613.1| hypothetical protein CARUB_v10024834mg [Capsella rubella]
Length=127

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W ILTYA + EA + ILLT+P    LR  +  +    L+P L I+PF  F L+DIY
Sbjct  1    MALEWAILTYATSAEAIMIILLTMPGLDFLRKGLTVVTRNVLKPLLSIIPFCLFLLIDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            +K E R  C G+ CTA E  R++KSI K+QRN +L V+A + YW    IC     + R+E
Sbjct  61   FKYETRPSCDGDSCTATELLRHQKSILKSQRNALLIVSALVFYWI---ICNVLNMVVRIE  117

Query  403  EVEKRAKDN  429
            ++ +R + N
Sbjct  118  KLNQRLRRN  126



>ref|XP_010505627.1| PREDICTED: uncharacterized protein LOC104782403 [Camelina sativa]
Length=131

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W IL  A AVEA + ILLT+P    LR  +  +    L+P L I+PF  F L+DIY
Sbjct  1    MALEWTILANATAVEAIMVILLTMPGLGFLRKGLAVVTRCLLKPLLAIIPFCVFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R+ C G+ CTA+E  RY+KSI+K+QRN +L   A   YW +Y +     +I+ + 
Sbjct  61   WKYETRISCDGDSCTASELLRYQKSIFKSQRNFLLIALALGFYWILYSVSNMAFKIEELN  120

Query  403  EVEKRAKDN  429
            +   R + N
Sbjct  121  QRVHRLRRN  129



>ref|XP_011070337.1| PREDICTED: uncharacterized protein LOC105156019 [Sesamum indicum]
Length=132

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSP-KPLRSRIVSLISLTLQPSLFIVPFAAFQLLDI  219
            MAL+W+IL+Y  A EA + +LLTLP    PLR  ++S+I   L+P L ++PF  F +LDI
Sbjct  1    MALEWVILSYVTAAEATMVLLLTLPPGLNPLRKGVISVIRNLLRPFLSVLPFCLFLVLDI  60

Query  220  YWKNEHRLMCTG-EICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQR  396
            YWK E R  C   + CT  E  R++KS+ K+QRN +L  AA + YW ++ + +   E ++
Sbjct  61   YWKYETRPRCNSPDSCTPTELVRHQKSVLKSQRNALLIAAAVMFYWLLFAVTRLAVEEEQ  120

Query  397  MEEVEKRAKDN  429
            + E  +R K++
Sbjct  121  LTERVQRLKNS  131



>gb|ADB93071.1| conserved hypothetical protein [Jatropha curcas]
 gb|KDP38103.1| hypothetical protein JCGZ_04746 [Jatropha curcas]
Length=130

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRRGLIAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  + CT +E  R++KSI K+QRN +L   A + YW +Y +     +I+++ 
Sbjct  61   WKYETRPSCEADSCTPSEHLRHQKSIMKSQRNALLIATALVFYWLLYSVTNLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>ref|XP_002966221.1| hypothetical protein SELMODRAFT_407584 [Selaginella moellendorffii]
 ref|XP_002982290.1| hypothetical protein SELMODRAFT_233969 [Selaginella moellendorffii]
 gb|EFJ16535.1| hypothetical protein SELMODRAFT_233969 [Selaginella moellendorffii]
 gb|EFJ32248.1| hypothetical protein SELMODRAFT_407584 [Selaginella moellendorffii]
Length=135

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W  L   VA E  + +  T P        IV+++   LQP L IVPFA F LLD+Y
Sbjct  1    MALEWGALALVVAAEGILLLFATFPGSHKFVKGIVAVLRSALQPLLSIVPFALFLLLDLY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E+   C G  CT  ER+ + KS  K+QRN +L +AA  LYW +YR+      I  ++
Sbjct  61   WKYENHPRCEGPSCTIVEREHHAKSQMKSQRNLLLVIAALFLYWVLYRVTAMLVRIDHLQ  120

Query  403  EVEKRAKDN  429
               K  KD 
Sbjct  121  RKTKIQKDG  129



>ref|NP_001275181.1| Erwinia induced protein 2 [Solanum tuberosum]
 gb|AAO32066.1| Erwinia induced protein 2 [Solanum tuberosum]
Length=131

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L+YA   EA + +LLT+P   PLR  ++++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLSYAAGAEAIMLLLLTIPGLDPLRKGLIAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E C  +E  R++KSI K+QRN +L  +A   YW +Y +     +++++
Sbjct  61   WKYETRPTCESAESCPPSEHLRHQKSIMKSQRNALLIASALFFYWLLYSVTGLVVKVEQL  120

Query  400  EE-VEK-RAKD  426
             + VEK +A+D
Sbjct  121  NKRVEKLKAQD  131



>emb|CDX74224.1| BnaA03g28230D [Brassica napus]
Length=130

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V +    L+P L IVP   F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVGVTRNLLKPFLSIVPLCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K 
Sbjct  121  QRIERLKS  128



>ref|XP_009134722.1| PREDICTED: uncharacterized protein LOC103858996 [Brassica rapa]
Length=130

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L IVP   F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTMPGLDGLRKGLVAVTRNLLKPFLSIVPLCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K 
Sbjct  121  QRIERLKS  128



>ref|XP_011023985.1| PREDICTED: uncharacterized protein LOC105125293 [Populus euphratica]
Length=134

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTIPGLDGLRKGLLAVTRNLLKPFMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E    C GE C+  E  R++KSI K+QRN +L  AA + YW +Y +     +I+++ 
Sbjct  61   WKYETMPTCEGESCSPTEHLRHQKSIMKSQRNALLIGAALIFYWLLYSVTHLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K 
Sbjct  121  QRVERLKS  128



>ref|XP_010268861.1| PREDICTED: uncharacterized protein LOC104605674 [Nelumbo nucifera]
Length=130

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + +LLTLP  + LR  + ++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYVAGAEAIMLVLLTLPGLERLRKGLTAVTRNLLKPFLAVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI----CKYNKEI  390
            WK E R  C G  CT +E  R++KSI K+QRN +L  +A + YW ++ +     + ++  
Sbjct  61   WKYETRPTCEGAACTPSEHLRHQKSIMKSQRNALLIASALVFYWLLFSVTHLLVRLDQLN  120

Query  391  QRMEEVEKR  417
            QR+E+++ +
Sbjct  121  QRLEKLKNQ  129



>ref|XP_004142369.1| PREDICTED: uncharacterized protein LOC101213354 [Cucumis sativus]
Length=136

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 80/135 (59%), Gaps = 10/135 (7%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCIFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----------IC  372
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA + YW +Y           + 
Sbjct  61   WKYETRPTCESDSCTPSEYLRHQKSIMKSQRNALLIAAALVFYWLLYSVTHLVVNTHLVV  120

Query  373  KYNKEIQRMEEVEKR  417
            K  +  QR+E ++ R
Sbjct  121  KVEQLNQRVERLKNR  135



>ref|XP_009796285.1| PREDICTED: uncharacterized protein LOC104242869 [Nicotiana sylvestris]
Length=131

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLTLP    +R  ++S+    L+P L +VPF  F LLDIY
Sbjct  1    MALEWVVLGYAAAAEAVMVILLTLPGAYAVRKGLISVTRNLLKPFLSVVPFCVFLLLDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E CT  E  R++KS+ K+QRN +L  AA + YW +Y + +    ++ +
Sbjct  61   WKYETRPRCKSAESCTPTELMRHQKSVMKSQRNALLIAAALMFYWLLYSVTRLVTRVEML  120

Query  400  EE-VEK  414
             + VEK
Sbjct  121  NQRVEK  126



>ref|XP_001751735.1| predicted protein [Physcomitrella patens]
 gb|EDQ83170.1| predicted protein [Physcomitrella patens]
Length=144

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 87/144 (60%), Gaps = 15/144 (10%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLD--  216
            MALQW +L    AVEAA+ +LLT P P+ L  +++  +   LQP L +VPFA FQLLD  
Sbjct  1    MALQWYLLGVVAAVEAAVLLLLTAPLPRGLSKQVLEFVKRILQPGLAVVPFALFQLLDHE  60

Query  217  -------------IYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWC  357
                         +YWK E+R+ C+ + C+  ERDR+ +S+YK+ RN +L ++A L YW 
Sbjct  61   LVFDLDFDGVIAEVYWKYENRINCSKQECSPFERDRFTRSLYKSHRNALLALSAALFYWL  120

Query  358  IYRICKYNKEIQRMEEVEKRAKDN  429
            ++RI K  +++ + EE  K  K+ 
Sbjct  121  LFRIAKMQQDVLQAEERVKMPKEE  144



>ref|XP_010271322.1| PREDICTED: uncharacterized protein LOC104607383 [Nelumbo nucifera]
Length=197

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (61%), Gaps = 3/128 (2%)
 Frame = +1

Query  34   KKTMALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLL  213
            K  MAL+W++L YA A EA + +LLTLP    LR  ++ +    L+P L ++PF  F L+
Sbjct  64   KPEMALEWVVLGYAAAAEAIMLLLLTLPGIDRLRKGLIPVTQNLLKPFLAVIPFCLFLLM  123

Query  214  DIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQ  393
            DIYWK E R  C G+ CT  E  R++KS  K+QRN +L  AA + YW +Y I      + 
Sbjct  124  DIYWKYETRPACEGQSCTPTEHFRHQKSNMKSQRNALLIAAALVFYWLLYSITHL---VL  180

Query  394  RMEEVEKR  417
            R++++ +R
Sbjct  181  RLDQLHQR  188



>ref|XP_010549811.1| PREDICTED: uncharacterized protein LOC104820873 [Tarenaya hassleriana]
Length=130

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTLPGLDGLRRGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE CT +E  R++KSI K+QRN +L  AA L YW +Y +      I+++ 
Sbjct  61   WKYETRPSCDGESCTPSEHLRHQKSIMKSQRNALLIAAALLFYWILYSVTHLVVRIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRIERLKN  128



>emb|CDX69398.1| BnaA10g17470D [Brassica napus]
Length=130

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L IVPF  F L++IY
Sbjct  1    MALKWVVLGYAAAAEAIMVILLTMPGLDGLRRGLIAVARKLLKPFLAIVPFCFFLLVEIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK   R  C G+ CT ++  R++KSI K+QRN +L  +A   YW +Y +      I+++ 
Sbjct  61   WKYHTRPSCYGDACTPSDHLRHQKSIVKSQRNALLIASALTFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            + + R ++
Sbjct  121  QRDDRLRN  128



>ref|XP_009617070.1| PREDICTED: uncharacterized protein LOC104109462 [Nicotiana tomentosiformis]
Length=131

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLDPLRKGLITVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E C+ +E  R++KSI K+QRN +L   A + YW +Y +     +++++
Sbjct  61   WKYETRPSCESHESCSPSEHLRHQKSIMKSQRNALLIACAIVFYWLLYSVTGLVVKVEQL  120

Query  400  EE-VEK-RAKD  426
             + VEK +A+D
Sbjct  121  NKRVEKLKAQD  131



>ref|XP_002981183.1| hypothetical protein SELMODRAFT_444756 [Selaginella moellendorffii]
 gb|EFJ17884.1| hypothetical protein SELMODRAFT_444756 [Selaginella moellendorffii]
Length=128

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W  L   VA E+ + + LT P P   RS I+ + S  L+P L ++PFA F LLD+Y
Sbjct  1    MALEWAGLMIVVAAESLLLLFLTFPWPAKFRSSIIGVSSSILRPLLAVLPFAGFLLLDVY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRIC-------KYN  381
             K E+R+ C    CTA +R+ Y KS+ K+QRNGIL V A LLYW  YR+        K N
Sbjct  61   MKYENRIQCQAGSCTAMDREHYAKSVMKSQRNGILGVFAILLYWFSYRVTHILVDLEKTN  120

Query  382  KEI  390
            K+I
Sbjct  121  KQI  123



>ref|XP_010525038.1| PREDICTED: uncharacterized protein LOC104802914 [Tarenaya hassleriana]
Length=130

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVVLLTLPGLDGLRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C GE CT  E  R++KSI K+QRN +L  AA L YW +Y +      I ++ 
Sbjct  61   WKYETRPSCDGESCTPTENLRHQKSIMKSQRNALLIAAALLFYWILYSVTHLVVRIDQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRLERLKN  128



>ref|XP_009121411.1| PREDICTED: uncharacterized protein LOC103846267 [Brassica rapa]
Length=130

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L IVPF  F L++IY
Sbjct  1    MALKWVVLGYAAAAEAIMVILLTMPGLDGLRRGLIAVARKLLKPFLAIVPFCFFLLVEIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK   R  C G+ CT ++  R++KSI K+QRN +L  +A   YW +Y +      I+++ 
Sbjct  61   WKYHTRPSCYGDSCTPSDHLRHQKSIVKSQRNALLIASALTFYWILYSVTNLVVRIEQLN  120

Query  403  EVEKRAKD  426
            + + R ++
Sbjct  121  QRDDRLRN  128



>ref|XP_009631997.1| PREDICTED: uncharacterized protein LOC104121659 [Nicotiana tomentosiformis]
Length=131

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++S+    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLDPLRQGLISVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E C+ +E  R++KSI K+QRN +L   A   YW +Y +      + ++
Sbjct  61   WKYETRPTCESPESCSPSEHLRHQKSIMKSQRNALLIACAITFYWLLYAVTGL---VVKV  117

Query  400  EEVEKRAK  423
            E++ KR +
Sbjct  118  EQLNKRVE  125



>ref|XP_009765334.1| PREDICTED: uncharacterized protein LOC104216893 [Nicotiana sylvestris]
Length=131

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++S+    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLDPLRKGLISVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E C+ +E  R++KSI K+QRN +L   A   YW +Y +      + ++
Sbjct  61   WKYETRPTCESPESCSPSEHLRHQKSIMKSQRNALLIACAITFYWLLYAVTGL---VVKV  117

Query  400  EEVEKRAK  423
            E++ KR +
Sbjct  118  EQLNKRVE  125



>ref|XP_002982660.1| hypothetical protein SELMODRAFT_445222 [Selaginella moellendorffii]
 gb|EFJ16413.1| hypothetical protein SELMODRAFT_445222 [Selaginella moellendorffii]
Length=128

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W  L   VA E+ + + LT P P   RS I+ + S  L+P L ++PFA F LLD+Y
Sbjct  1    MALEWAGLMIVVAAESLLLLFLTFPWPAKFRSSIIGVSSSILRPLLAVLPFAGFLLLDVY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQR  396
             K E+R+ C    CTA +R+ Y KS+ K+QRNGIL V A LLYW  YR+     ++++
Sbjct  61   MKYENRIQCQAGSCTAMDREHYAKSVMKSQRNGILGVFAILLYWFSYRVTHILVDLEK  118



>ref|XP_010044222.1| PREDICTED: uncharacterized protein LOC104433237 [Eucalyptus grandis]
 gb|KCW86270.1| hypothetical protein EUGRSUZ_B02953 [Eucalyptus grandis]
Length=131

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMVLLLTLPGLDGLRRGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEI-CTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  +  CT +E  R++KS+ K+QRN +L  AA + YW +Y +      I+++
Sbjct  61   WKYETRPSCEHDASCTPSEHLRHQKSVMKSQRNALLIAAALVFYWLLYSVTHLVVRIEQL  120

Query  400  EEVEKRAK  423
             +  +R K
Sbjct  121  SQRLERLK  128



>ref|XP_003630917.1| hypothetical protein MTR_8g104980 [Medicago truncatula]
 gb|ACJ84203.1| unknown [Medicago truncatula]
 gb|AET05393.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK45171.1| unknown [Medicago truncatula]
Length=130

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + +LLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVLLLTIPGLDALRKGLVAVTKNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICKYN  381
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA L YW +Y       RI   N
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTNLVVRIDLLN  120

Query  382  KEIQRMEEVE  411
            + ++R++  E
Sbjct  121  QRLERLKRTE  130



>gb|KJB84366.1| hypothetical protein B456_N021300 [Gossypium raimondii]
Length=202

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  28   TEKKTMALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQ  207
            + K  MAL+W++L YA   EA + +LLTLP    LR  ++++    L+P L +VPF  F 
Sbjct  68   SPKLKMALEWVVLGYAAGAEAIMVLLLTLPGLDGLRKGLIAVTRGLLKPFLSVVPFCLFL  127

Query  208  LLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKE  387
            L+DIYWK E R  C G+ CT +E  R++KSI K+QRN +L  AA L YW +Y +     +
Sbjct  128  LMDIYWKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTGLVVK  187

Query  388  IQRMEEVEKRAKD  426
            ++++ +  +R K+
Sbjct  188  VEQLNQRLERLKN  200



>ref|XP_009409247.1| PREDICTED: uncharacterized protein LOC103991491 [Musa acuminata 
subsp. malaccensis]
Length=131

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 80/129 (62%), Gaps = 5/129 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + + LTLP    LR  +++++   L+P L +VPF  F L DIY
Sbjct  1    MALEWVVLGYTAGAEAIMLLFLTLPGLGGLRRGLLTVVRGALKPLLSVVPFCLFLLADIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRIC----KYNKE  387
            WK E R  C  E  CT +E  RYEKSI K+QRN IL  +A LLYW ++ +     + +++
Sbjct  61   WKYEMRPTCEQEHACTPSEHLRYEKSIMKSQRNAILIASALLLYWLLFSVTSLLGRIDQQ  120

Query  388  IQRMEEVEK  414
             QR+E +++
Sbjct  121  NQRIENLKR  129



>ref|XP_004503366.1| PREDICTED: uncharacterized protein LOC101497967 [Cicer arietinum]
Length=130

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTIPGLDALRKGLIAVTKNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT  E  R++KSI K+QRN +L  AA L YW +Y +     +I  + 
Sbjct  61   WKYETRPSCEGDSCTPTEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTNLVVKIDHLN  120

Query  403  EVEKRAK  423
            +  +R K
Sbjct  121  QRLERLK  127



>ref|XP_001760859.1| predicted protein [Physcomitrella patens]
 gb|EDQ74248.1| predicted protein [Physcomitrella patens]
Length=130

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W  L    A EA I +LLT+P    +R  ++S+    L+P L +VP A F  L+IY
Sbjct  1    MALEWAALGAVTAAEALILLLLTMPGLTGIRKGLISVARSALRPLLAVVPLALFLALEIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK +H   C G  C   +RDR  KS+ K+QRN IL   A LLYW +YR+      ++++ 
Sbjct  61   WKFDHMPECKGPQCDPLQRDRAAKSLMKSQRNAILVGGALLLYWVLYRVTAMMVRMEQLS  120

Query  403  EVEKRAKDN  429
               K+ K +
Sbjct  121  TQLKKMKSS  129



>ref|XP_006826907.1| hypothetical protein AMTR_s00010p00157310 [Amborella trichopoda]
 gb|ERM94144.1| hypothetical protein AMTR_s00010p00157310 [Amborella trichopoda]
Length=130

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDRLRKGLIAVTRNALKPLLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G  CT  E  R++KSI K+QRN +L  AA + YW ++ + +   +++++ 
Sbjct  61   WKYETRPSCEGAACTPTEHLRHQKSIMKSQRNALLIAAALIFYWLLFSVTQLVVKLEQLS  120

Query  403  EVEKRAKDN  429
            +  ++ K+ 
Sbjct  121  QRVEKLKNQ  129



>ref|XP_003530733.1| PREDICTED: uncharacterized protein LOC100785159 [Glycine max]
Length=130

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y  A EA + ILLT+P  + LR  ++++    L+P L +VPF  F  +DIY
Sbjct  1    MALEWVVLGYVAAAEAIMVILLTIPGLEALRKGLIAVTRNLLKPFLSVVPFCLFLFMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA L YW +Y +      I  + 
Sbjct  61   WKYETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTNLVVRIDHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRLERLKN  128



>gb|KHN16564.1| hypothetical protein glysoja_002661 [Glycine soja]
Length=130

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y  A EA + ILLT+P  + LR  ++++    L+P L +VPF  F  +DIY
Sbjct  1    MALEWVVLGYVAAAEAIMVILLTIPGLEALRKGLIAVTRNLLKPFLSVVPFCLFLFMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C G+ CT +E  R++KSI K+QRN +L  AA L YW +Y +      I  + 
Sbjct  61   WKFETRPSCEGDSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTNLVVRIDHLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRLERLKN  128



>ref|XP_011099907.1| PREDICTED: uncharacterized protein LOC105178193 [Sesamum indicum]
Length=130

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +L+T+P   PLR  ++S+I   L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAVMLLLMTVPGLDPLRKGLISVIRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  E C+ +E  R++KSI K+QRN +L  +A + YW +Y +      + ++E
Sbjct  61   WKYETRPSCESESCSPSEHLRHQKSIIKSQRNALLIASALIFYWLLYSVTGL---VVKIE  117

Query  403  EVEKR  417
            ++ KR
Sbjct  118  QLTKR  122



>ref|XP_003525249.1| PREDICTED: uncharacterized protein LOC100808632 isoform 1 [Glycine 
max]
Length=130

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 78/128 (61%), Gaps = 7/128 (5%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTIPGLDALRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICKYN  381
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA L YW +Y       RI   N
Sbjct  61   WKYETRPSCEADSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLYSVTNLVVRIDNLN  120

Query  382  KEIQRMEE  405
            + +QR + 
Sbjct  121  QRLQRFKN  128



>ref|XP_009403367.1| PREDICTED: uncharacterized protein LOC103986938 [Musa acuminata 
subsp. malaccensis]
Length=130

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 7/130 (5%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + + LTLP    LR  +V++I   L+P L +VPF  F L DIY
Sbjct  1    MALEWVVLGYTAGAEAIMLLFLTLPGLDGLRRGLVTVIRSALKPLLSVVPFCLFLLADIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICKYN  381
            WK E R  C  E C+ +E  R++KSI K+QRN +L  +A LLYW ++       RI + N
Sbjct  61   WKYETRPTCEQESCSPSEHVRHQKSIMKSQRNALLIASALLLYWLLFSVTSLVVRIDQLN  120

Query  382  KEIQRMEEVE  411
            + I++++  E
Sbjct  121  QRIEKLKRSE  130



>ref|XP_010681925.1| PREDICTED: uncharacterized protein LOC104896829 [Beta vulgaris 
subsp. vulgaris]
Length=131

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 4/131 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLTLP    LR  ++++    L+P L IVPF  F LLDIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTLPGLDGLRKGLIAVTRNLLKPFLSIVPFCLFLLLDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEI----  390
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA L YW +Y +     +I    
Sbjct  61   WKYETRPSCEADSCTPSEYLRHQKSIMKSQRNALLIAAALLFYWILYSVTALVVKIELLN  120

Query  391  QRMEEVEKRAK  423
            QR+E  + R  
Sbjct  121  QRLERFKTRTD  131



>ref|XP_009794975.1| PREDICTED: uncharacterized protein LOC104241739 [Nicotiana sylvestris]
Length=131

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    LR  ++++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLALLRKGLITVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C + E C+ +E  R++KSI K+QRN +L   A + YW +Y +     +++++
Sbjct  61   WKYETRPSCESHESCSPSEYLRHQKSIMKSQRNALLIACAIVFYWLLYSVTGLVVKVEQL  120

Query  400  EE-VEK-RAKD  426
             + VEK +A+D
Sbjct  121  NKRVEKLKAQD  131



>gb|EPS60480.1| erwinia induced protein 2 [Genlisea aurea]
Length=130

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 82/129 (64%), Gaps = 4/129 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P    +R  ++S+I   L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLDAIRRGLISVIGSLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEI----  390
            WK E R +C  + C+ +E  R++KS+ K++RN +L  AA L YW +Y +     +I    
Sbjct  61   WKYETRPVCASDSCSPSEHLRHQKSVMKSERNALLIAAALLFYWLLYSVTGLVVKIDVLS  120

Query  391  QRMEEVEKR  417
            +R+E+++ R
Sbjct  121  KRIEKLKAR  129



>gb|KJB15367.1| hypothetical protein B456_002G173500 [Gossypium raimondii]
Length=130

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + +LLT+P    LR  ++++    L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYTAGAEAIMLLLLTVPGLDGLRKGLIAVTRNLLKPFMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA +LYW +Y +     +I+++ 
Sbjct  61   WKYETRPTCDADSCTPSEYLRHQKSIMKSQRNALLIAAALILYWLLYSVTNLVVKIEQLN  120

Query  403  EVEKRAKD  426
            +  +R K+
Sbjct  121  QRVERLKN  128



>ref|XP_009402128.1| PREDICTED: uncharacterized protein LOC103985995 [Musa acuminata 
subsp. malaccensis]
Length=123

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 0/123 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + + LTLP    LR  +V+++   L+P L +VPF  F + DIY
Sbjct  1    MALEWVVLAYVAGAEAIMLLFLTLPGLDRLRRGLVAVVRSALKPLLSVVPFCLFLIADIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME  402
            WK E R  C  E CT +E  R++KSI K+QRN +L  +A LLYW ++ +      I++++
Sbjct  61   WKYEMRPFCEQEACTPSEHLRHQKSIIKSQRNALLIASALLLYWLLFSVSGLVLRIEKLK  120

Query  403  EVE  411
              E
Sbjct  121  RSE  123



>ref|XP_008803900.1| PREDICTED: uncharacterized protein LOC103717341 [Phoenix dactylifera]
Length=131

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 4/128 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + + LTLP    LR  +V+++   L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLFLTLPGLDALRRGMVAVVRSALKPLLSLVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  E  CT AE  R++KSI K+QRN +L  AA LLYW ++ +      I R+
Sbjct  61   WKYETRPTCDQEHACTPAEHLRHQKSIMKSQRNALLIAAALLLYWFLFSVTNL---IVRL  117

Query  400  EEVEKRAK  423
            +++ +R +
Sbjct  118  DQLNQRVE  125



>gb|KHN21577.1| hypothetical protein glysoja_023429 [Glycine soja]
Length=116

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA A EA + ILLT+P    LR  +V++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAAAEAIMVILLTIPGLDALRKGLVAVTRNLLKPFLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY  363
            WK E R  C  + CT +E  R++KSI K+QRN +L  AA L YW +Y
Sbjct  61   WKYETRPSCEADSCTPSEHLRHQKSIMKSQRNALLIAAALLFYWLLY  107



>gb|EYU40721.1| hypothetical protein MIMGU_mgv1a018086mg [Erythranthe guttata]
Length=132

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = +1

Query  43   MALQWIILTYavav-eaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDI  219
            MAL+W++L+Y  A     + +L   P+  PLR  ++S+    L+P L +VPF  F LLDI
Sbjct  1    MALEWVVLSYVAAAEATMVLLLTLPPTLNPLRKGVISVTRNLLKPFLSVVPFCLFLLLDI  60

Query  220  YWKNEHRLMCTGEI-CTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQR  396
            YWK E R  C   + CT +E  R++KS  K+QRNG+L  AA +LYW ++ + +   + +R
Sbjct  61   YWKYETRPSCKSSVSCTPSELMRHQKSAIKSQRNGLLIAAALMLYWMLFAVTRLAVQEER  120

Query  397  MEE  405
            + E
Sbjct  121  LSE  123



>gb|EPS58202.1| erwinia induced protein 2, partial [Genlisea aurea]
Length=134

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L+YA A EA + +LLT+P    +R  ++S+    L+P L +VPF+ F L+DIY
Sbjct  3    MALEWVVLSYAAAAEAIMLLLLTVPGLDAIRKGLISVTRSLLKPFLSVVPFSLFLLMDIY  62

Query  223  WKNEHR--LMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIY-------RICK  375
            WK E R       + C+ AE  R++KS+ K+QRN +L  +A + YW +Y       +I  
Sbjct  63   WKYETRPSCESDSDSCSPAEHLRHQKSVMKSQRNALLIASALVFYWLLYSVTGLVVKIDV  122

Query  376  YNKEIQRME  402
             NK I++++
Sbjct  123  LNKRIEKLK  131



>gb|EYU34496.1| hypothetical protein MIMGU_mgv1a020406mg [Erythranthe guttata]
Length=132

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = +1

Query  43   MALQWIILTYavav-eaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDI  219
            MAL+W++L+Y  A     + +L   P+  PLR  ++S+    L+P L +VPF  F LLDI
Sbjct  1    MALEWVVLSYVAAAEATMVLLLTLPPTLNPLRKGVISVTRNLLKPFLSVVPFCLFLLLDI  60

Query  220  YWKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQR  396
            YWK E R  C + E CT +E  R++KS  K+QRNG+L  AA +LYW ++ + +   + ++
Sbjct  61   YWKYETRPSCKSSESCTPSELMRHQKSAIKSQRNGLLIAAALMLYWMLFAVTRLAVQEEQ  120

Query  397  MEE  405
            + E
Sbjct  121  LSE  123



>ref|XP_008775931.1| PREDICTED: uncharacterized protein LOC103696169 [Phoenix dactylifera]
Length=130

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L Y    EA + + LTLP    LR  +V+++   L+P L ++PF  F L+DIY
Sbjct  1    MALEWVVLGYVAGAEAIMLLFLTLPGLDSLRRGMVAVVRNALKPLLSVLPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGI  324
            WK E R MC  E  CT AE  RYEKSI  +QRN I
Sbjct  61   WKYETRPMCAKEHACTPAEHLRYEKSIMTSQRNVI  95



>ref|XP_004236688.1| PREDICTED: uncharacterized protein LOC101267983 [Solanum lycopersicum]
Length=131

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLT+P   PLR  ++++    L+P L IVPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTIPGLDPLRKGLIAVTRNLLKPFLSIVPFCLFLLMDIY  60

Query  223  WKNEHR-LMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R    + E C+ +E  R++KSI K+QRN +L  +A + YW +Y +     +++++
Sbjct  61   WKYETRPTCESSESCSPSEYLRHQKSIMKSQRNALLIASALVFYWLLYSVTGLVVKVEQL  120

Query  400  EE-VEK-RAKD  426
             + VEK +A+D
Sbjct  121  NKRVEKLKAQD  131



>ref|XP_010932577.1| PREDICTED: uncharacterized protein LOC105053193 [Elaeis guineensis]
Length=131

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + + LTLP    LR  IV+++   L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLFLTLPGLDGLRRGIVAVVRSALKPLLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRN  318
            WK E R  C  E  CT AE  R++KSI K+QRN
Sbjct  61   WKYETRPTCDQEHACTPAEHLRHQKSIMKSQRN  93



>dbj|BAK03279.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS47497.1| hypothetical protein TRIUR3_09875 [Triticum urartu]
 gb|EMT21851.1| hypothetical protein F775_06343 [Aegilops tauschii]
Length=132

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDALRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----ICKYNKE  387
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++     + K +  
Sbjct  61   WKYEMRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTSLVVKLDHL  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>ref|XP_003570694.1| PREDICTED: uncharacterized protein LOC100846819 [Brachypodium 
distachyon]
Length=132

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDALRRGMISVVRGALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----ICKYNKE  387
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++     + + ++ 
Sbjct  61   WKYETRPTCGDEHACTPSEHLRHQKSIIKSQRNALLIGAALLLYWILFSVTSLVVRLDQL  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>gb|ACG27993.1| erwinia induced protein 2 [Zea mays]
Length=132

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  +VS++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAVMLLLLTLPGLDGLRRGMVSVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRIC----KYNKE  387
            WK E R  C  E  CT +E  R++KS+ K+QRN +L  AA LLYW ++ +     + ++ 
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHQKSVMKSQRNALLIAAALLLYWILFSVTQLVVRLDQM  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>gb|ACG24688.1| erwinia induced protein 2 [Zea mays]
 gb|ACR37617.1| unknown [Zea mays]
 gb|AFW73296.1| erwinia induced protein 2 [Zea mays]
Length=132

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 3/132 (2%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++ + +    +++M
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTQLVVRLEQM  120

Query  400  EE-VEK-RAKDN  429
            ++ V+K R +D+
Sbjct  121  QQRVDKLRKRDD  132



>ref|NP_001148963.1| LOC100282583 [Zea mays]
 gb|ACG33658.1| erwinia induced protein 2 [Zea mays]
 gb|AFW63834.1| erwinia induced protein 2 [Zea mays]
Length=132

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  +VS++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAVMLLLLTLPGLDGLRRGMVSVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----ICKYNKE  387
            WK E R  C  E  CT +E  R+ KS+ K+QRN +L  AA LLYW ++     + + ++ 
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHHKSVMKSQRNALLIAAALLLYWILFSVTQLVVRLDQM  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>ref|XP_004953840.1| PREDICTED: uncharacterized protein LOC101771529 [Setaria italica]
Length=132

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  +VS++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAVMLLLLTLPGLDGLRRGMVSVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----ICKYNKE  387
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++     + +  + 
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTSLVVRLQQL  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>ref|XP_002454325.1| hypothetical protein SORBIDRAFT_04g028710 [Sorghum bicolor]
 gb|EES07301.1| hypothetical protein SORBIDRAFT_04g028710 [Sorghum bicolor]
Length=132

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++ + +    + R+
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTQL---VVRL  117

Query  400  EEVEKR  417
            E++++R
Sbjct  118  EQMQQR  123



>ref|NP_001048043.1| Os02g0734900 [Oryza sativa Japonica Group]
 dbj|BAD15889.1| Erwinia induced protein 2 [Oryza sativa Japonica Group]
 dbj|BAF09957.1| Os02g0734900 [Oryza sativa Japonica Group]
 dbj|BAG86934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=132

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI----CKYNKE  387
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++ I     + ++ 
Sbjct  61   WKYETRPTCDDEHHCTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSITSLVVRLDQL  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>ref|NP_001150948.1| LOC100284581 [Zea mays]
 gb|ACG41052.1| erwinia induced protein 2 [Zea mays]
Length=132

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++ + +    + R+
Sbjct  61   WKYETRPTCDDEHACTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTQL---VVRL  117

Query  400  EEVEKR  417
            E++++R
Sbjct  118  EQMQQR  123



>ref|XP_010911288.1| PREDICTED: uncharacterized protein LOC105037303 [Elaeis guineensis]
Length=131

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + + LT+P    LR  IV++    L+P L +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLFLTVPGLGSLRRGIVAVARNALRPLLSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRN  318
            WK E R  C  +  CT AE  R+EKSI K+QRN
Sbjct  61   WKYETRPTCDKQHACTPAEYLRHEKSIIKSQRN  93



>ref|XP_006647852.1| PREDICTED: uncharacterized protein LOC102713443 [Oryza brachyantha]
 gb|EAY87431.1| hypothetical protein OsI_08839 [Oryza sativa Indica Group]
Length=132

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W++L YA   EA + +LLTLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct  1    MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY  60

Query  223  WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYR----ICKYNKE  387
            WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++     + + ++ 
Sbjct  61   WKYETRPTCDDEHHCTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSVTSLVVRLDQL  120

Query  388  IQRMEEVEKR  417
             QR+++++KR
Sbjct  121  QQRVDKLKKR  130



>ref|XP_006441338.1| hypothetical protein CICLE_v100228442mg, partial [Citrus clementina]
 gb|ESR54578.1| hypothetical protein CICLE_v100228442mg, partial [Citrus clementina]
Length=44

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  298  IYKAQRNGILCVAACLLYWCIYRICKYNKEIQRMEEVEKRAKDN  429
            IYKAQRN ILC AACLLYW I+RICKY K++QR+EEVEKR K+ 
Sbjct  1    IYKAQRNVILCAAACLLYWSIFRICKYYKDVQRLEEVEKRYKEE  44



>gb|AFG54011.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54012.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54013.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54015.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54016.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54017.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
Length=81

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +CT  + DR+ KS+Y+ QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSDCQGPLCTEVDVDRHHKSVYRRQRDVMLAVGAVVLYWLLFRV  57



>ref|XP_006606844.1| PREDICTED: uncharacterized protein LOC102662870 [Glycine max]
Length=83

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = +1

Query  178  LFIVPFAAFQLLDIYWKNEHRLMCTGEICTAAERDRYEK--SIYKAQRNGILCVAACLLY  351
            L  + F  +  +D+YWKNEHRLMCT E+CTAAERDRYEK  SI+   ++G++      + 
Sbjct  13   LVFLNFDLWLFVDLYWKNEHRLMCTSEVCTAAERDRYEKSVSIFYGCQDGLIGEFIFCIV  72

Query  352  WCIYRICKY  378
             C +R+C Y
Sbjct  73   NCGHRVCLY  81



>ref|XP_006374207.1| hypothetical protein POPTR_0015s04930g [Populus trichocarpa]
 gb|ERP52004.1| hypothetical protein POPTR_0015s04930g [Populus trichocarpa]
Length=131

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 77/130 (59%), Gaps = 1/130 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL+W+ + YA   EA + +LLTLP   PLR+ ++S+    L+P   I+P   F ++DIY
Sbjct  1    MALEWVAVAYAAGAEAMMLLLLTLPGLNPLRNGLLSVTKTLLKPFFSILPICLFLVMDIY  60

Query  223  WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E    C T   C+ +E  R++KS  K+QRN +L  AA + YW +Y + K    ++++
Sbjct  61   WKYETMPSCKTLNSCSPSENMRHQKSTIKSQRNALLIAAALVFYWLLYSVTKLIDRVEQL  120

Query  400  EEVEKRAKDN  429
            +   KR+  N
Sbjct  121  QFQIKRSTKN  130



>ref|XP_010068693.1| PREDICTED: uncharacterized protein LOC104455630 [Eucalyptus grandis]
 gb|KCW64506.1| hypothetical protein EUGRSUZ_G02113 [Eucalyptus grandis]
Length=149

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 67/129 (52%), Gaps = 1/129 (1%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            MAL W++L    A+EA + ++L  P    L   + S     L+P L +VP   F LLDI+
Sbjct  1    MALVWVMLGNLAAMEAVMLLVLPAPGLDVLHRVLSSFTRGLLKPLLSVVPLCLFLLLDIH  60

Query  223  WKNEHRLMCTGEI-CTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM  399
            WK E R  C  E  C    R R +KS+ K+QRN  L   A   YW +Y +     +I+++
Sbjct  61   WKYETRPSCELESWCPPTVRLRDQKSVLKSQRNAFLIGTALAFYWLLYSVAHMVVKIEQL  120

Query  400  EEVEKRAKD  426
             ++  R KD
Sbjct  121  NQLLARLKD  129



>gb|AFG54003.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54004.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54005.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54010.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
Length=81

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +CT    DR+ KS+Y+ QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSECQGPLCTEVNVDRHHKSVYRRQRDVMLAVGAVVLYWLLFRV  57



>gb|AEW08869.1| hypothetical protein CL2046Contig1_03, partial [Pinus radiata]
Length=81

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +CT    DR+ KS+Y+ QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSDCQGPLCTEVNVDRHHKSVYRRQRDVMLAVGAVVLYWLLFRV  57



>gb|AFG54008.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
Length=81

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +CT  + DR+ KS+Y  QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSDCQGPLCTEVDVDRHHKSVYMRQRDVMLAVGAVVLYWLLFRV  57



>gb|AFG54002.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54007.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54009.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
 gb|AFG54014.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
Length=81

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +CT  + +R+ KS+Y+ QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSECQGPLCTEVDVNRHHKSVYRRQRDVMLAVGAVVLYWLLFRV  57



>emb|CDY31795.1| BnaC01g27510D [Brassica napus]
Length=237

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  298  IYKAQRNGILCVAACLLYWCIYRICKYNKEIQRMEEVEKRAK  423
            IYKAQRN +LC A  LLYWCI+ ICKYNK+++ +EE+EKR K
Sbjct  194  IYKAQRNVVLCAAGILLYWCIHHICKYNKDLEHLEELEKRYK  235



>ref|XP_011035561.1| PREDICTED: uncharacterized protein LOC105133318 [Populus euphratica]
Length=131

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 58/101 (57%), Gaps = 2/101 (2%)
 Frame = +1

Query  133  RSRIVSLISLTLQPSLFIVPFAAFQLLDIYWKNEHRLMC-TGEICTAAERDRYEKSIYKA  309
            R+ ++S+    L+P   I+P   F ++DIYWK E    C T   C+ +E  R++KS  K+
Sbjct  31   RNGLLSVTKTLLKPFFSILPICLFLVMDIYWKYETMPSCKTLNSCSPSENMRHQKSTIKS  90

Query  310  QRNGILCVAACLLYWCIYRICKYNKEIQRME-EVEKRAKDN  429
            QRN +L  AA + YW +Y + K    + +++ +++K  K+ 
Sbjct  91   QRNALLIAAALVFYWLLYSVTKLIDRVGQLQFQIKKSTKNG  131



>gb|AFG54006.1| hypothetical protein CL2046Contig1_03, partial [Pinus taeda]
Length=81

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  202  FQLLDIYWKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI  369
            F L+DIYWK EH   C G +C   + +R+ KS+Y+ QR+ +L V A +LYW ++R+
Sbjct  2    FLLMDIYWKYEHSSECQGPLCAEVDVNRHHKSVYRRQRDVMLAVGAVVLYWLLFRV  57



>gb|AFK49283.1| unknown [Medicago truncatula]
Length=148

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  345  EACCHTKDAIPLSLVDRFLIAVSLGGSADLTGAH*AVLILPIDIKKLESGEGYDEKRRLK  166
            +AC +T+  + LS V  FLIA+SL  S ++ G H  +L LP+ IKKL+  +G +EKRRLK
Sbjct  74   KACRNTQYHVSLSFVCSFLIAISLSSSTNVRGTHQPMLSLPVYIKKLKPSKGNNEKRRLK  133

Query  165  G*RYERDDPRSERL  124
              R +R     ++L
Sbjct  134  NKRNQRSQTVPQKL  147



>gb|AAT45002.1| unknown [Xerophyta humilis]
Length=140

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (57%), Gaps = 13/137 (9%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSP----KPLRSRIVSLISLTLQPSLFIVPFAAFQL  210
            MAL+  ++    A EAA  ++LT+P+       LR  + +     L+P + +VPF  F +
Sbjct  1    MALEXXVIGSIXAAEAAFLLILTVPAAWGLSGGLRRALTNAARSALRPLMAVVPFCLFLI  60

Query  211  LDIYWKNEHRLMC-TGE----ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICK  375
            LDIYWK E R  C +G+    +C+ A+  R++KS  K+QRN +L  +A LLYW I+ I K
Sbjct  61   LDIYWKYETRPNCGSGKDGTIVCSPADHLRFQKSALKSQRNALLVASALLLYWFIFAITK  120

Query  376  YNKEI----QRMEEVEK  414
                I    QR+E ++K
Sbjct  121  MLARIDLLAQRVENLKK  137



>gb|EAZ24531.1| hypothetical protein OsJ_08292 [Oryza sativa Japonica Group]
Length=87

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = +1

Query  184  IVPFAAFQLLDIYWKNEHRLMCTGEI-CTAAERDRYEKSIYKAQRNGILCVAACLLYWCI  360
            +VPF  F L+DIYWK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW +
Sbjct  3    VVPFCLFLLMDIYWKYETRPTCDDEHHCTPSEHLRHQKSIMKSQRNALLIAAALLLYWIL  62

Query  361  YRI----CKYNKEIQRMEEVEKR  417
            + I     + ++  QR+++++KR
Sbjct  63   FSITSLVVRLDQLQQRVDKLKKR  85



>ref|XP_010910937.1| PREDICTED: uncharacterized protein LOC105036913 [Elaeis guineensis]
Length=131

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 71/129 (55%), Gaps = 15/129 (12%)
 Frame = +1

Query  43   MALQWIILTYavaveaaiaillTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY  222
            M L W++L YAVA EA + +LLT+P  + LR  +V+ +  TL+P L ++P   F ++ +Y
Sbjct  1    MELGWVLLGYAVAAEAVMLLLLTIPGLESLRVGLVTAVRGTLKPLLLLLPLCLFLMVQVY  60

Query  223  WK--------NEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKY  378
            W+        +EH        CT ++  ++EKS+ ++  N IL   A LLYW ++ I   
Sbjct  61   WQCVCWPAVASEHG-------CTHSDNLQHEKSLVESNLNAILIATAFLLYWLLFSITNL  113

Query  379  NKEIQRMEE  405
               + ++ +
Sbjct  114  LVRVHQLGQ  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750