BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031L15

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243321.1|  PREDICTED: lipoyl synthase, mitochondrial          229   8e-70   Solanum lycopersicum
ref|XP_006357526.1|  PREDICTED: lipoyl synthase, mitochondrial-like     227   6e-69   Solanum tuberosum [potatoes]
ref|XP_009771704.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    222   6e-67   Nicotiana sylvestris
gb|AHM22930.1|  lipoyl synthase                                         222   6e-67   Nicotiana tabacum [American tobacco]
ref|XP_009621653.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    219   5e-66   Nicotiana tomentosiformis
ref|XP_009778191.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    218   2e-65   Nicotiana sylvestris
ref|XP_011025577.1|  PREDICTED: lipoyl synthase, mitochondrial-like     215   2e-64   Populus euphratica
gb|EYU26119.1|  hypothetical protein MIMGU_mgv1a008134mg                215   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_006380479.1|  hypothetical protein POPTR_0007s06900g             212   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006380478.1|  hypothetical protein POPTR_0007s06900g             211   5e-63   
ref|XP_002517968.1|  lipoic acid synthetase, putative                   210   8e-63   
ref|XP_011021958.1|  PREDICTED: lipoyl synthase, mitochondrial          211   1e-62   Populus euphratica
ref|XP_007043524.1|  Lipoic acid synthase 1 isoform 3                   207   2e-62   
ref|XP_003543350.1|  PREDICTED: lipoyl synthase 2, mitochondrial        209   3e-62   Glycine max [soybeans]
ref|XP_006382932.1|  hypothetical protein POPTR_0005s08840g             209   3e-62   
ref|XP_007043522.1|  Lipoyl synthase, mitochondrial isoform 1           209   3e-62   
ref|XP_007043523.1|  Lipoyl synthase, mitochondrial isoform 2           208   3e-62   
ref|XP_011072065.1|  PREDICTED: lipoyl synthase 2, mitochondrial        209   3e-62   Sesamum indicum [beniseed]
gb|ABK96318.1|  unknown                                                 209   4e-62   Populus trichocarpa x Populus deltoides
ref|XP_004487312.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    209   4e-62   Cicer arietinum [garbanzo]
ref|XP_002306361.1|  lipoic acid synthase family protein                209   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006382933.1|  hypothetical protein POPTR_0005s08840g             208   8e-62   
emb|CDP14732.1|  unnamed protein product                                208   9e-62   Coffea canephora [robusta coffee]
gb|KDP24175.1|  hypothetical protein JCGZ_25832                         207   1e-61   Jatropha curcas
gb|KDO40565.1|  hypothetical protein CISIN_1g017179mg                   206   2e-61   Citrus sinensis [apfelsine]
ref|XP_006447320.1|  hypothetical protein CICLE_v10015632mg             207   2e-61   
ref|XP_003540350.1|  PREDICTED: lipoyl synthase 2, mitochondrial        207   3e-61   Glycine max [soybeans]
gb|KJB79957.1|  hypothetical protein B456_013G074500                    206   4e-61   Gossypium raimondii
ref|XP_006447321.1|  hypothetical protein CICLE_v10015632mg             206   4e-61   Citrus clementina [clementine]
gb|KDO40564.1|  hypothetical protein CISIN_1g017179mg                   206   6e-61   Citrus sinensis [apfelsine]
ref|XP_008455341.1|  PREDICTED: lipoyl synthase 2, mitochondrial        206   7e-61   
ref|XP_009628827.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    200   8e-61   Nicotiana tomentosiformis
gb|KHG07122.1|  Lipoyl synthase, mitochondrial                          206   9e-61   Gossypium arboreum [tree cotton]
gb|KDO40563.1|  hypothetical protein CISIN_1g017179mg                   205   1e-60   Citrus sinensis [apfelsine]
gb|EPS65537.1|  lipoyl synthase, mitochondrial                          204   1e-60   Genlisea aurea
ref|XP_004136815.1|  PREDICTED: lipoyl synthase, mitochondrial-like     204   2e-60   Cucumis sativus [cucumbers]
ref|XP_007149882.1|  hypothetical protein PHAVU_005G106700g             203   7e-60   Phaseolus vulgaris [French bean]
sp|Q3LSN5.1|LIAS2_PEA  RecName: Full=Lipoyl synthase 2, mitochond...    203   8e-60   Pisum sativum [garden pea]
ref|XP_007149469.1|  hypothetical protein PHAVU_005G072800g             203   9e-60   Phaseolus vulgaris [French bean]
sp|Q3LSN4.1|LIAS1_PEA  RecName: Full=Lipoyl synthase 1, mitochond...    203   9e-60   Pisum sativum [garden pea]
ref|XP_010278318.1|  PREDICTED: lipoyl synthase 2, mitochondrial        202   3e-59   Nelumbo nucifera [Indian lotus]
gb|AFK48146.1|  unknown                                                 200   1e-58   Medicago truncatula
gb|KEH39087.1|  lipoyl synthase                                         199   2e-58   Medicago truncatula
sp|B7FM45.1|LIAS_MEDTR  RecName: Full=Lipoyl synthase, mitochondr...    199   2e-58   Medicago truncatula
ref|XP_010035697.1|  PREDICTED: lipoyl synthase 2, mitochondrial        199   2e-58   Eucalyptus grandis [rose gum]
gb|AFK43632.1|  unknown                                                 199   2e-58   Medicago truncatula
ref|XP_008356122.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    198   5e-58   Malus domestica [apple tree]
ref|XP_008341911.1|  PREDICTED: lipoyl synthase, mitochondrial          198   5e-58   
ref|XP_009357081.1|  PREDICTED: lipoyl synthase 2, mitochondrial        198   9e-58   Pyrus x bretschneideri [bai li]
ref|XP_010671528.1|  PREDICTED: lipoyl synthase 2, mitochondrial        197   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004306011.1|  PREDICTED: lipoyl synthase 2, mitochondrial        197   5e-57   Fragaria vesca subsp. vesca
ref|XP_002266132.2|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    196   5e-57   Vitis vinifera
ref|XP_007215533.1|  hypothetical protein PRUPE_ppa007143mg             195   7e-57   Prunus persica
ref|XP_010526527.1|  PREDICTED: lipoyl synthase, mitochondrial          192   1e-55   Tarenaya hassleriana [spider flower]
emb|CDX81984.1|  BnaC08g36170D                                          191   2e-55   
ref|XP_006298130.1|  hypothetical protein CARUB_v10014173mg             189   5e-55   
ref|XP_009117465.1|  PREDICTED: lipoyl synthase, mitochondrial          190   9e-55   Brassica rapa
ref|XP_010467759.1|  PREDICTED: lipoyl synthase, mitochondrial          190   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010488982.1|  PREDICTED: lipoyl synthase, mitochondrial-like     189   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002884228.1|  hypothetical protein ARALYDRAFT_900465             189   1e-54   Arabidopsis lyrata subsp. lyrata
ref|NP_179682.1|  lipoic acid synthase 1                                189   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409024.1|  hypothetical protein EUTSA_v10002016mg             189   1e-54   Eutrema salsugineum [saltwater cress]
gb|KFK40464.1|  hypothetical protein AALP_AA3G376400                    189   1e-54   Arabis alpina [alpine rockcress]
ref|XP_010095809.1|  Lipoyl synthase                                    182   7e-52   
dbj|BAB44157.1|  lipoic acid synthase                                   177   6e-50   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008782125.1|  PREDICTED: lipoyl synthase, mitochondrial          177   9e-50   Phoenix dactylifera
ref|XP_008230240.1|  PREDICTED: lipoyl synthase 2, mitochondrial        172   6e-49   
ref|XP_009398165.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    174   9e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388773.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    174   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926267.1|  PREDICTED: lipoyl synthase, mitochondrial          174   2e-48   Elaeis guineensis
ref|XP_002447950.1|  hypothetical protein SORBIDRAFT_06g018660          172   6e-48   Sorghum bicolor [broomcorn]
dbj|BAJ97232.1|  predicted protein                                      172   8e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07245.1|  predicted protein                                      172   9e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975823.1|  PREDICTED: lipoyl synthase, mitochondrial-like     172   9e-48   Setaria italica
gb|EAY94363.1|  hypothetical protein OsI_16128                          171   1e-47   Oryza sativa Indica Group [Indian rice]
sp|A2XU53.2|LIAS_ORYSI  RecName: Full=Lipoyl synthase, mitochondr...    171   2e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001146235.1|  lipoyl synthase, mitochondrial                     171   2e-47   Zea mays [maize]
ref|NP_001052964.1|  Os04g0455800                                       171   2e-47   
emb|CAH67016.1|  H0523F07.4                                             171   2e-47   Oryza sativa [red rice]
ref|XP_010239981.1|  PREDICTED: lipoyl synthase, mitochondrial          171   3e-47   Brachypodium distachyon [annual false brome]
sp|A9NNH7.1|LIAS_PICSI  RecName: Full=Lipoyl synthase, mitochondr...    165   3e-45   Picea sitchensis
ref|XP_002984787.1|  hypothetical protein SELMODRAFT_121095             163   1e-44   
ref|XP_006841751.1|  hypothetical protein AMTR_s00003p00261780          162   1e-44   
ref|XP_001764819.1|  predicted protein                                  163   2e-44   
ref|XP_002985852.1|  hypothetical protein SELMODRAFT_123090             162   2e-44   
ref|XP_006653475.1|  PREDICTED: lipoyl synthase, mitochondrial-like     157   8e-43   
ref|XP_011396533.1|  Lipoyl synthase, mitochondrial                     154   5e-41   Auxenochlorella protothecoides
gb|KIY92220.1|  lipoic acid synthetase                                  143   1e-39   Monoraphidium neglectum
ref|XP_001418286.1|  predicted protein                                  147   2e-38   Ostreococcus lucimarinus CCE9901
ref|XP_975527.1|  PREDICTED: lipoyl synthase, mitochondrial             146   3e-38   Tribolium castaneum [rust-red flour beetle]
emb|CEF98458.1|  Radical SAM                                            145   5e-38   Ostreococcus tauri
ref|XP_002507881.1|  lipoic acid synthase                               145   8e-38   Micromonas commoda
gb|EMT08295.1|  Lipoyl synthase, mitochondrial                          145   2e-37   
ref|XP_005847137.1|  hypothetical protein CHLNCDRAFT_24051              141   2e-36   Chlorella variabilis
ref|XP_007512984.1|  predicted protein                                  142   3e-36   Bathycoccus prasinos
ref|XP_011311370.1|  PREDICTED: lipoyl synthase, mitochondrial          140   8e-36   Fopius arisanus
ref|XP_006922504.1|  PREDICTED: lipoyl synthase, mitochondrial          139   2e-35   Pteropus alecto
ref|XP_001354122.1|  GA18753                                            139   2e-35   Drosophila pseudoobscura pseudoobscura
ref|XP_002028324.1|  GL11904                                            138   3e-35   
ref|XP_003079989.1|  lipoic acid synthase (ISS)                         142   3e-35   
gb|ACZ26290.1|  putative lipoic acid synthetase                         138   3e-35   Mayetiola destructor
ref|XP_011361042.1|  PREDICTED: lipoyl synthase, mitochondrial is...    138   3e-35   Pteropus vampyrus
gb|ETN62407.1|  lipoic acid synthetase                                  138   6e-35   Anopheles darlingi [American malaria mosquito]
ref|XP_001702321.1|  lipoic acid synthetase                             136   9e-35   Chlamydomonas reinhardtii
ref|XP_006787315.1|  PREDICTED: lipoyl synthase, mitochondrial-like     137   1e-34   Neolamprologus brichardi [lyretail cichlid]
ref|XP_314540.4|  AGAP010568-PA                                         137   1e-34   Anopheles gambiae str. PEST
ref|XP_010866875.1|  PREDICTED: lipoyl synthase, mitochondrial          136   2e-34   Esox lucius
ref|XP_004065786.1|  PREDICTED: lipoyl synthase, mitochondrial          136   2e-34   Oryzias latipes [Japanese rice fish]
ref|XP_002065849.1|  GK17689                                            136   2e-34   Drosophila willistoni
gb|KFB38613.1|  AGAP010568-PA-like protein                              137   2e-34   Anopheles sinensis
ref|XP_007243627.1|  PREDICTED: lipoyl synthase, mitochondrial-like     135   2e-34   
ref|NP_001103871.1|  lipoyl synthase, mitochondrial                     136   2e-34   Danio rerio [leopard danio]
sp|Q6PHG4.1|LIAS_DANRE  RecName: Full=Lipoyl synthase, mitochondr...    136   2e-34   Danio rerio [leopard danio]
gb|EPY49264.1|  lipoic acid synthetase                                  136   2e-34   Schizosaccharomyces cryophilus OY26
ref|XP_010115912.1|  PREDICTED: lipoyl synthase, mitochondrial-like     131   2e-34   Chlamydotis macqueenii
ref|NP_001085534.1|  lipoyl synthase, mitochondrial                     136   2e-34   Xenopus laevis [clawed frog]
ref|XP_010740107.1|  PREDICTED: lipoyl synthase, mitochondrial          132   2e-34   
gb|EDL90063.1|  rCG57017                                                132   2e-34   Rattus norvegicus [brown rat]
gb|KFH64353.1|  lipoic acid synthetase                                  137   2e-34   Mortierella verticillata NRRL 6337
ref|XP_001845830.1|  lipoic acid synthase                               136   3e-34   Culex quinquefasciatus
gb|KDD75330.1|  hypothetical protein H632_c740p1                        135   3e-34   Helicosporidium sp. ATCC 50920
ref|NP_001011234.1|  lipoyl synthase, mitochondrial                     135   3e-34   Xenopus tropicalis [western clawed frog]
ref|XP_006189038.1|  PREDICTED: lipoyl synthase, mitochondrial is...    135   3e-34   Camelus ferus
ref|XP_010978684.1|  PREDICTED: lipoyl synthase, mitochondrial is...    135   3e-34   Camelus dromedarius [camel]
ref|XP_002426395.1|  lipoic acid synthetase, putative                   137   4e-34   Pediculus humanus corporis [human body lice]
ref|XP_004910979.1|  PREDICTED: lipoyl synthase, mitochondrial-like     135   4e-34   Xenopus tropicalis [western clawed frog]
ref|XP_006029302.1|  PREDICTED: lipoyl synthase, mitochondrial          135   4e-34   
gb|KDD75287.1|  hypothetical protein H632_c764p1                        135   4e-34   Helicosporidium sp. ATCC 50920
emb|CDH58810.1|  lipoic acid synthetase precursor                       135   4e-34   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001659989.1|  AAEL009368-PA                                      135   4e-34   Aedes aegypti
gb|KFV02172.1|  hypothetical protein N340_11963                         131   5e-34   Tauraco erythrolophus
ref|XP_004927741.1|  PREDICTED: lipoyl synthase, mitochondrial-like     135   5e-34   Bombyx mori [silk moth]
ref|XP_006759354.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   5e-34   
ref|XP_009984989.1|  PREDICTED: lipoyl synthase, mitochondrial-like     132   5e-34   Tauraco erythrolophus
ref|XP_001957274.1|  GF24134                                            135   5e-34   Drosophila ananassae
gb|KFP47920.1|  hypothetical protein N323_05733                         131   5e-34   Cathartes aura
ref|XP_004514720.1|  PREDICTED: lipoyl synthase 2, chloroplastic-...    135   5e-34   Cicer arietinum [garbanzo]
ref|XP_007426517.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   6e-34   
gb|KFQ68761.1|  hypothetical protein N335_00414                         131   6e-34   Phaethon lepturus
ref|XP_008947334.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   6e-34   Merops nubicus
gb|KFP76616.1|  hypothetical protein N311_03530                         131   6e-34   Apaloderma vittatum
gb|KFQ43558.1|  hypothetical protein N333_12244                         131   6e-34   Nestor notabilis
ref|XP_010776311.1|  PREDICTED: lipoyl synthase, mitochondrial          135   6e-34   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006189037.1|  PREDICTED: lipoyl synthase, mitochondrial is...    135   6e-34   Camelus ferus
ref|XP_008410916.1|  PREDICTED: lipoyl synthase, mitochondrial          135   6e-34   Poecilia reticulata
ref|XP_001605463.2|  PREDICTED: lipoyl synthase, mitochondrial is...    135   6e-34   Nasonia vitripennis
gb|KFO05702.1|  hypothetical protein N312_00096                         131   6e-34   Balearica regulorum gibbericeps
ref|XP_010978683.1|  PREDICTED: lipoyl synthase, mitochondrial is...    135   6e-34   Camelus dromedarius [camel]
ref|XP_008315124.1|  PREDICTED: lipoyl synthase, mitochondrial          135   6e-34   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFU95968.1|  hypothetical protein M959_04245                         134   6e-34   Chaetura pelagica
ref|XP_006220318.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    134   7e-34   Vicugna pacos
ref|XP_010305218.1|  PREDICTED: lipoyl synthase, mitochondrial          131   7e-34   Balearica regulorum gibbericeps
ref|XP_005807826.1|  PREDICTED: lipoyl synthase, mitochondrial-like     135   7e-34   Xiphophorus maculatus
ref|XP_007551988.1|  PREDICTED: lipoyl synthase, mitochondrial          135   7e-34   Poecilia formosa
ref|XP_009068856.1|  PREDICTED: lipoyl synthase, mitochondrial          131   7e-34   Acanthisitta chloris
ref|XP_001984904.1|  GH16746                                            134   7e-34   Drosophila grimshawi
ref|XP_010293387.1|  PREDICTED: lipoyl synthase, mitochondrial          131   7e-34   Phaethon lepturus
ref|XP_009868761.1|  PREDICTED: lipoyl synthase, mitochondrial          131   7e-34   Apaloderma vittatum
ref|XP_003062162.1|  predicted protein                                  133   7e-34   Micromonas pusilla CCMP1545
ref|XP_008546620.1|  PREDICTED: lipoyl synthase, mitochondrial          134   7e-34   Microplitis demolitor
gb|KFV93025.1|  hypothetical protein N327_00292                         130   7e-34   Fulmarus glacialis
gb|KFP94414.1|  hypothetical protein N329_11295                         131   7e-34   Haliaeetus albicilla
ref|XP_003452182.2|  PREDICTED: lipoyl synthase, mitochondrial-like     135   7e-34   
ref|XP_003424380.1|  PREDICTED: lipoyl synthase, mitochondrial is...    134   8e-34   Nasonia vitripennis
ref|XP_009918808.1|  PREDICTED: lipoyl synthase, mitochondrial          131   8e-34   Haliaeetus albicilla
gb|KFQ76339.1|  hypothetical protein N337_00646                         131   8e-34   Phoenicopterus ruber ruber
gb|KFW97292.1|  hypothetical protein N336_07982                         131   8e-34   Phalacrocorax carbo [common cormorant]
ref|XP_010019608.1|  PREDICTED: lipoyl synthase, mitochondrial-like     132   8e-34   Nestor notabilis
gb|KFP69827.1|  hypothetical protein N310_04898                         131   8e-34   Acanthisitta chloris
gb|KFP59442.1|  hypothetical protein N322_11033                         131   8e-34   Cariama cristata
ref|XP_006258548.1|  PREDICTED: lipoyl synthase, mitochondrial          135   8e-34   
gb|EPX74142.1|  lipoic acid synthetase                                  134   8e-34   Schizosaccharomyces octosporus yFS286
emb|CDS10851.1|  Putative Lipoyl synthase, mitochondrial                135   8e-34   Lichtheimia ramosa
gb|KFZ52696.1|  hypothetical protein N338_05233                         130   9e-34   Podiceps cristatus
gb|KFV40153.1|  hypothetical protein N341_10722                         130   9e-34   Tyto alba [Schleiereule]
gb|KFP96037.1|  hypothetical protein N330_00400                         130   9e-34   Leptosomus discolor
ref|XP_009510363.1|  PREDICTED: lipoyl synthase, mitochondrial          131   9e-34   Phalacrocorax carbo [common cormorant]
ref|XP_009701528.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-33   Cariama cristata
ref|XP_009577332.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    130   1e-33   Fulmarus glacialis
ref|XP_006066203.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-33   
ref|NP_001012037.1|  lipoyl synthase, mitochondrial precursor           134   1e-33   Rattus norvegicus [brown rat]
ref|XP_002609221.1|  hypothetical protein BRAFLDRAFT_125969             134   1e-33   Branchiostoma floridae
gb|KFZ46233.1|  hypothetical protein N321_00411                         130   1e-33   Antrostomus carolinensis
gb|KFV41089.1|  hypothetical protein N328_11580                         130   1e-33   Gavia stellata
ref|XP_004564359.1|  PREDICTED: lipoyl synthase, mitochondrial-like     134   1e-33   
ref|XP_005741202.1|  PREDICTED: lipoyl synthase, mitochondrial-like     134   1e-33   
ref|NP_524183.2|  lipoic acid synthase                                  134   1e-33   Drosophila melanogaster
gb|AAL13786.1|  LD24887p                                                134   1e-33   Drosophila melanogaster
ref|XP_009958190.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-33   Leptosomus discolor
gb|EHJ72263.1|  hypothetical protein KGM_05108                          134   1e-33   
gb|KFP25007.1|  hypothetical protein N325_00240                         130   1e-33   Colius striatus
ref|XP_006759353.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-33   Myotis davidii
ref|XP_002040667.1|  GM22215                                            134   1e-33   Drosophila sechellia
ref|XP_009805881.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-33   Gavia stellata
gb|AAI12632.1|  LIAS protein                                            132   1e-33   Bos taurus [bovine]
ref|XP_005897413.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   1e-33   Bos mutus
ref|XP_002086625.1|  GE22745                                            134   1e-33   Drosophila yakuba
ref|XP_010197083.1|  PREDICTED: lipoyl synthase, mitochondrial          130   1e-33   Colius striatus
ref|XP_002095457.1|  GE22400                                            134   1e-33   Drosophila yakuba
ref|XP_007522861.1|  PREDICTED: lipoyl synthase, mitochondrial          134   1e-33   Erinaceus europaeus [common hedgehog]
ref|XP_007670123.1|  PREDICTED: lipoyl synthase, mitochondrial          134   1e-33   
ref|XP_010004454.1|  PREDICTED: lipoyl synthase, mitochondrial          134   1e-33   Chaetura pelagica
ref|XP_005651902.1|  lipoic acid synthetase                             133   1e-33   Coccomyxa subellipsoidea C-169
ref|XP_005897412.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   1e-33   Bos mutus
ref|XP_010161680.1|  PREDICTED: lipoyl synthase, mitochondrial          130   1e-33   
emb|CAF94211.1|  unnamed protein product                                133   1e-33   Tetraodon nigroviridis
gb|KFQ55627.1|  hypothetical protein N334_12474                         130   1e-33   Pelecanus crispus
ref|XP_009489687.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-33   Pelecanus crispus
ref|XP_004522406.1|  PREDICTED: lipoyl synthase, mitochondrial-like     134   1e-33   Ceratitis capitata [medfly]
gb|EDL37740.1|  lipoic acid synthetase, isoform CRA_b                   133   2e-33   Mus musculus [mouse]
gb|KFO99312.1|  hypothetical protein N300_04072                         133   2e-33   Calypte anna
ref|XP_007426516.1|  PREDICTED: lipoyl synthase, mitochondrial is...    134   2e-33   Python bivittatus
ref|XP_007178869.1|  PREDICTED: lipoyl synthase, mitochondrial is...    134   2e-33   Balaenoptera acutorostrata scammoni
gb|KFV92327.1|  hypothetical protein N326_00631                         130   2e-33   Eurypyga helias
ref|XP_007449481.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   2e-33   Lipotes vexillifer [baiji]
ref|XP_001973489.1|  GG13311                                            134   2e-33   Drosophila erecta
dbj|BAC27579.1|  unnamed protein product                                134   2e-33   Mus musculus [mouse]
ref|XP_007178870.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   2e-33   Balaenoptera acutorostrata scammoni
ref|NP_077791.1|  lipoyl synthase, mitochondrial precursor              134   2e-33   Mus musculus [mouse]
ref|XP_011194961.1|  PREDICTED: lipoyl synthase, mitochondrial          134   2e-33   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011137775.1|  PREDICTED: lipoyl synthase, mitochondrial          133   2e-33   Harpegnathos saltator
ref|XP_003221569.2|  PREDICTED: lipoyl synthase, mitochondrial          134   2e-33   Anolis carolinensis [Carolina anole]
gb|EPQ14702.1|  Lipoyl synthase, mitochondrial                          132   2e-33   Myotis brandtii
ref|XP_006066202.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   2e-33   
ref|XP_005666642.1|  PREDICTED: lipoic acid synthetase isoform X3       132   2e-33   
ref|XP_006088562.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   2e-33   
ref|XP_008138449.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   2e-33   
ref|XP_004681401.1|  PREDICTED: lipoyl synthase, mitochondrial          133   2e-33   Condylura cristata
ref|XP_005897411.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   2e-33   Bos mutus
ref|XP_008490116.1|  PREDICTED: lipoyl synthase, mitochondrial          133   2e-33   Calypte anna
ref|XP_007113946.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   2e-33   
ref|XP_005359324.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   2e-33   
gb|EFB17888.1|  hypothetical protein PANDA_014664                       132   2e-33   Ailuropoda melanoleuca
ref|XP_008276634.1|  PREDICTED: lipoyl synthase, mitochondrial          134   2e-33   Stegastes partitus
ref|XP_005608877.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   2e-33   
ref|XP_003773359.1|  PREDICTED: lipoyl synthase, mitochondrial          133   2e-33   Sarcophilus harrisii
ref|XP_001374049.1|  PREDICTED: lipoyl synthase, mitochondrial          133   2e-33   Monodelphis domestica
ref|NP_001017944.1|  lipoyl synthase, mitochondrial precursor           133   2e-33   Bos taurus [bovine]
ref|XP_007066486.1|  PREDICTED: lipoyl synthase, mitochondrial          134   3e-33   
ref|XP_008925719.1|  PREDICTED: lipoyl synthase, mitochondrial          133   3e-33   
ref|XP_004419045.1|  PREDICTED: lipoyl synthase, mitochondrial          133   3e-33   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFW83864.1|  hypothetical protein N305_05087                         132   3e-33   Manacus vitellinus
gb|KFV64353.1|  hypothetical protein N307_06684                         132   3e-33   Picoides pubescens
gb|EMP29566.1|  Lipoyl synthase                                         133   3e-33   Chelonia mydas [green seaturtle]
gb|KFQ94486.1|  hypothetical protein Y956_08279                         132   3e-33   Nipponia nippon
ref|XP_004332277.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    133   3e-33   
ref|XP_004266292.1|  PREDICTED: lipoyl synthase, mitochondrial          133   3e-33   Orcinus orca [Orca]
ref|NP_001230391.1|  lipoic acid synthetase                             133   3e-33   Sus scrofa [pigs]
ref|XP_007113945.1|  PREDICTED: lipoyl synthase, mitochondrial is...    133   3e-33   Physeter catodon
ref|XP_005666640.1|  PREDICTED: lipoic acid synthetase isoform X1       133   3e-33   
ref|XP_005877506.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    133   3e-33   
ref|XP_005191392.1|  PREDICTED: lipoyl synthase, mitochondrial          133   3e-33   Musca domestica
gb|AEX88628.1|  lipoic acid synthetase                                  132   3e-33   Sus scrofa [pigs]
ref|XP_007449480.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   3e-33   Lipotes vexillifer [baiji]
ref|XP_006066201.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Bubalus bubalis [domestic water buffalo]
ref|XP_006088561.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Myotis lucifugus
ref|XP_002189456.1|  PREDICTED: lipoyl synthase, mitochondrial          133   4e-33   Taeniopygia guttata
gb|KFO80379.1|  hypothetical protein N303_08395                         132   4e-33   Cuculus canorus
gb|KGL93190.1|  hypothetical protein N301_01854                         132   4e-33   Charadrius vociferus
gb|KFO83458.1|  hypothetical protein N320_10229                         129   4e-33   Buceros rhinoceros silvestris
ref|XP_009564868.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   Cuculus canorus
gb|EMC82961.1|  Lipoyl synthase, mitochondrial                          132   4e-33   
ref|XP_010133152.1|  PREDICTED: lipoyl synthase, mitochondrial-like     129   4e-33   Buceros rhinoceros silvestris
gb|EGW14108.1|  Lipoyl synthase, mitochondrial                          132   4e-33   Cricetulus griseus [Chinese hamsters]
ref|XP_008138448.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Eptesicus fuscus
ref|XP_002925215.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Ailuropoda melanoleuca
gb|ELK33600.1|  Lipoyl synthase, mitochondrial                          132   4e-33   Myotis davidii
ref|XP_010708614.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   Meleagris gallopavo [common turkey]
ref|XP_009460123.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   Nipponia nippon
ref|XP_006895466.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004475564.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   
gb|KFR11447.1|  hypothetical protein N306_13424                         132   4e-33   Opisthocomus hoazin [hoatzin]
gb|KFW73063.1|  hypothetical protein AS28_12364                         132   4e-33   Pygoscelis adeliae
ref|XP_005359323.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Microtus ochrogaster [prairie voles]
gb|KFM08116.1|  hypothetical protein AS27_09519                         132   4e-33   Aptenodytes forsteri
ref|XP_011205668.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   Bactrocera dorsalis [papaya fruit fly]
ref|XP_001498146.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Equus caballus [domestic horse]
ref|XP_002843031.1|  lipoyl synthase                                    133   4e-33   Microsporum canis CBS 113480
ref|XP_006873279.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   4e-33   Chrysochloris asiatica
ref|XP_009836562.1|  lipoyl synthase, mitochondrial                     132   4e-33   
ref|XP_005415685.1|  PREDICTED: lipoyl synthase, mitochondrial          132   4e-33   
ref|XP_011256526.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_009330740.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_002709320.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   5e-33   
ref|XP_005666641.1|  PREDICTED: lipoic acid synthetase isoform X2       133   5e-33   
ref|XP_004703221.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_005392041.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   5e-33   
ref|XP_003515359.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   5e-33   
gb|KFP18031.1|  hypothetical protein Z169_05668                         132   5e-33   
ref|XP_007612769.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   5e-33   
gb|KEH41395.1|  lipoyl synthase                                         132   5e-33   
ref|XP_005149243.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_009278445.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_005435425.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
ref|XP_005243299.1|  PREDICTED: lipoyl synthase, mitochondrial          132   5e-33   
gb|EFX79130.1|  hypothetical protein DAPPUDRAFT_304936                  132   5e-33   
ref|XP_009967446.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   5e-33   
ref|XP_010147483.1|  PREDICTED: lipoyl synthase, mitochondrial          129   6e-33   
ref|XP_005045440.1|  PREDICTED: lipoyl synthase, mitochondrial          133   6e-33   
ref|XP_002008396.1|  GI13471                                            132   6e-33   
gb|EPS67544.1|  lipoyl synthase, chloroplastic                          132   6e-33   
ref|XP_423226.3|  PREDICTED: lipoyl synthase, mitochondrial isofo...    132   6e-33   
ref|XP_009671746.1|  PREDICTED: lipoyl synthase, mitochondrial          132   6e-33   
ref|XP_004384724.1|  PREDICTED: lipoyl synthase, mitochondrial          132   6e-33   
gb|KFV80466.1|  hypothetical protein N308_07734                         131   6e-33   
ref|XP_009933856.1|  PREDICTED: lipoyl synthase, mitochondrial          132   6e-33   
ref|XP_005501430.1|  PREDICTED: lipoyl synthase, mitochondrial          132   6e-33   
gb|EYU30245.1|  hypothetical protein MIMGU_mgv1a008511mg                132   7e-33   
ref|XP_003411445.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   7e-33   
ref|XP_005030883.1|  PREDICTED: lipoyl synthase, mitochondrial          132   7e-33   
ref|XP_006873278.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   7e-33   
ref|XP_009883302.1|  PREDICTED: lipoyl synthase, mitochondrial          132   7e-33   
gb|EIE77277.1|  hypothetical protein RO3G_01981                         132   7e-33   
ref|XP_009894883.1|  PREDICTED: lipoyl synthase, mitochondrial          132   7e-33   
ref|XP_007390373.1|  hypothetical protein PHACADRAFT_110818             132   7e-33   
ref|XP_008168191.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   7e-33   
ref|XP_008831463.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   7e-33   
gb|EOA93366.1|  Lipoyl synthase, mitochondrial                          131   8e-33   
gb|EMD41746.1|  hypothetical protein CERSUDRAFT_110322                  132   8e-33   
ref|XP_009639591.1|  PREDICTED: lipoyl synthase, mitochondrial          132   8e-33   
ref|XP_005392039.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   8e-33   
ref|XP_004608076.1|  PREDICTED: lipoyl synthase, mitochondrial          132   8e-33   
ref|XP_005319980.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   9e-33   
ref|XP_009785514.1|  PREDICTED: lipoyl synthase, chloroplastic          132   9e-33   
emb|CAX73348.1|  Lipoic acid synthase                                   132   9e-33   
ref|XP_006974666.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   9e-33   
ref|XP_005490601.1|  PREDICTED: lipoyl synthase, mitochondrial          132   1e-32   
ref|XP_002814729.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|NP_919433.1|  lipoyl synthase, mitochondrial isoform 2 precursor    130   1e-32   
ref|XP_001141481.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|XP_004009825.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|NP_001265519.1|  lipoyl synthase, mitochondrial isoform 3 pre...    130   1e-32   
ref|XP_004936173.1|  PREDICTED: lipoyl synthase, mitochondrial is...    132   1e-32   
ref|XP_005961065.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|XP_005554758.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|XP_005961064.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
gb|EHB16208.1|  Lipoyl synthase, mitochondrial                          131   1e-32   
ref|XP_005392040.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-32   
ref|XP_005286416.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-32   
ref|XP_005618675.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
ref|XP_008831461.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-32   
ref|XP_004905775.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-32   
ref|XP_003471593.1|  PREDICTED: lipoyl synthase, mitochondrial          131   1e-32   
ref|XP_003237738.1|  lipoic acid synthetase                             132   1e-32   
ref|XP_005681578.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   1e-32   
gb|EMG48388.1|  Lipoic acid synthetase, mitochondrial                   131   1e-32   
ref|XP_005319979.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   1e-32   
ref|XP_003172984.1|  lipoyl synthase                                    131   2e-32   
ref|XP_008831462.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   2e-32   
ref|XP_004091701.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
ref|XP_003258641.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
gb|EGE00781.1|  lipoic acid synthetase                                  131   2e-32   
ref|XP_008699635.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   2e-32   
ref|XP_010572846.1|  PREDICTED: lipoyl synthase, mitochondrial          131   2e-32   
ref|XP_004579208.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
ref|XP_006616173.1|  PREDICTED: lipoyl synthase, mitochondrial-li...    130   2e-32   
ref|XP_003014712.1|  hypothetical protein ARB_07274                     131   2e-32   
ref|XP_008015804.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_011498517.1|  PREDICTED: uncharacterized protein LOC105362728    134   2e-32   
ref|XP_006616172.1|  PREDICTED: lipoyl synthase, mitochondrial-li...    130   2e-32   
ref|XP_005554757.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_003898642.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|NP_001248031.1|  lipoyl synthase, mitochondrial                     130   2e-32   
ref|XP_009238159.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_005286415.1|  PREDICTED: lipoyl synthase, mitochondrial is...    131   2e-32   
ref|XP_009162710.1|  hypothetical protein T265_00618                    131   2e-32   
ref|XP_010382782.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_526552.2|  PREDICTED: lipoyl synthase, mitochondrial isofo...    130   2e-32   
ref|XP_010623415.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_002814728.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_004396213.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
ref|XP_006349804.1|  PREDICTED: lipoyl synthase 1, chloroplastic-...    130   2e-32   
gb|EHH53622.1|  Lipoyl synthase, mitochondrial                          130   2e-32   
ref|NP_006850.2|  lipoyl synthase, mitochondrial isoform 1 precursor    130   2e-32   
ref|XP_006129607.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
gb|ADQ32257.1|  lipoic acid synthetase                                  130   2e-32   
gb|AAH23635.1|  Lipoic acid synthetase                                  130   2e-32   
ref|XP_004009824.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_005961063.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_006680624.1|  hypothetical protein BATDEDRAFT_13027              130   2e-32   
ref|XP_536255.1|  PREDICTED: lipoyl synthase, mitochondrial isofo...    130   2e-32   
ref|XP_003023808.1|  hypothetical protein TRV_02005                     131   2e-32   
ref|XP_007142845.1|  hypothetical protein PHAVU_007G021800g             130   2e-32   
ref|XP_004665545.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   2e-32   
ref|XP_005681577.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   2e-32   
ref|XP_003695502.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   2e-32   
ref|XP_006571537.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
gb|EIE87647.1|  hypothetical protein RO3G_12358                         131   2e-32   
gb|KDO77038.1|  hypothetical protein CISIN_1g018731mg                   127   2e-32   
gb|ETO13620.1|  hypothetical protein RFI_23748                          131   2e-32   
ref|XP_004814045.1|  PREDICTED: lipoyl synthase, mitochondrial          130   2e-32   
ref|XP_004642696.1|  PREDICTED: lipoyl synthase, mitochondrial          130   3e-32   
ref|XP_009099697.1|  PREDICTED: lipoyl synthase, mitochondrial          131   3e-32   
ref|XP_010217486.1|  PREDICTED: lipoyl synthase, mitochondrial          129   3e-32   
gb|KFK25210.1|  hypothetical protein AALP_AA8G081400                    130   3e-32   
ref|XP_003555873.1|  PREDICTED: lipoyl synthase, chloroplastic          130   3e-32   
sp|C4PZQ3.1|LIAS_SCHMA  RecName: Full=Lipoyl synthase, mitochondr...    130   3e-32   
ref|XP_003258640.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   3e-32   
ref|XP_009204948.1|  PREDICTED: lipoyl synthase, mitochondrial is...    130   3e-32   
gb|KGL80416.1|  hypothetical protein N309_03875                         129   3e-32   
ref|XP_003972216.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   3e-32   
gb|EZA50935.1|  Lipoyl synthase, mitochondrial                          130   3e-32   
gb|EFA84129.1|  lipoic acid synthetase precursor                        130   3e-32   
ref|XP_006814380.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   3e-32   
ref|XP_003489933.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   3e-32   
ref|XP_003392941.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   3e-32   
emb|CDY44775.1|  BnaC02g01120D                                          130   4e-32   
ref|XP_003703828.1|  PREDICTED: lipoyl synthase, mitochondrial-like     130   4e-32   
ref|XP_011270386.1|  hypothetical protein CAOG_08756                    131   4e-32   
ref|XP_004252893.1|  PREDICTED: lipoyl synthase, chloroplastic          130   4e-32   
ref|XP_004764071.1|  PREDICTED: lipoyl synthase, mitochondrial          130   4e-32   
emb|CCG83378.1|  Lipoyl synthase,mitochondrial                          130   4e-32   
ref|XP_011344204.1|  PREDICTED: lipoyl synthase, mitochondrial          130   4e-32   
ref|XP_009603790.1|  PREDICTED: lipoyl synthase, chloroplastic {E...    130   4e-32   
ref|XP_009125732.1|  PREDICTED: lipoyl synthase, chloroplastic-like     130   4e-32   
ref|XP_868868.1|  hypothetical protein AN9486.2                         130   4e-32   
ref|XP_010495114.1|  PREDICTED: lipoyl synthase, chloroplastic-like     129   4e-32   
ref|XP_006448492.1|  hypothetical protein CICLE_v10015778mg             129   4e-32   
gb|KFQ24904.1|  hypothetical protein N332_11630                         126   5e-32   
ref|XP_003724473.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    130   5e-32   
emb|CDY40747.1|  BnaAnng06100D                                          130   5e-32   
ref|XP_007379076.1|  Lipoyl synthase                                    130   5e-32   
ref|XP_010188131.1|  PREDICTED: lipoyl synthase, mitochondrial-like     127   5e-32   
emb|CEJ01213.1|  Putative Lipoyl synthase, mitochondrial                126   6e-32   
ref|XP_002745951.1|  PREDICTED: lipoyl synthase, mitochondrial is...    129   6e-32   
ref|XP_002518326.1|  lipoic acid synthetase, putative                   129   7e-32   
ref|XP_011115165.1|  hypothetical protein H072_9607                     130   7e-32   
ref|XP_006468685.1|  PREDICTED: lipoyl synthase, chloroplastic-like     129   7e-32   
dbj|GAD92235.1|  lipoic acid synthetase precursor                       130   7e-32   
ref|XP_003927573.1|  PREDICTED: lipoyl synthase, mitochondrial          129   7e-32   
ref|XP_008873914.1|  lipoyl synthase, mitochondrial                     129   7e-32   
ref|XP_005518086.1|  PREDICTED: lipoyl synthase, mitochondrial          129   7e-32   
ref|XP_003985482.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    129   8e-32   
ref|XP_007098937.1|  PREDICTED: lipoyl synthase, mitochondrial is...    129   8e-32   
ref|XP_006096060.1|  PREDICTED: lipoyl synthase, mitochondrial-like     129   8e-32   
gb|ESA06017.1|  hypothetical protein GLOINDRAFT_99456                   129   8e-32   
gb|KDO77037.1|  hypothetical protein CISIN_1g018731mg                   128   8e-32   
ref|XP_008445908.1|  PREDICTED: lipoyl synthase, chloroplastic          129   8e-32   
gb|EXX53006.1|  putative lipoate synthase                               129   9e-32   
ref|XP_009027550.1|  hypothetical protein HELRODRAFT_185116             129   1e-31   
ref|XP_006399334.1|  hypothetical protein EUTSA_v10013747mg             129   1e-31   
ref|XP_009541237.1|  hypothetical protein HETIRDRAFT_306330             129   1e-31   
sp|B6K4J2.1|LIPA_SCHJY  RecName: Full=Lipoyl synthase, mitochondr...    129   1e-31   
ref|XP_002174692.2|  lipoic acid synthetase                             129   1e-31   
ref|XP_002553125.1|  KLTH0D09548p                                       128   1e-31   
ref|XP_007887310.1|  PREDICTED: lipoyl synthase, mitochondrial          128   1e-31   
gb|EPB85254.1|  lipoyl synthase, mitochondrial                          128   1e-31   
gb|KJA29253.1|  hypothetical protein HYPSUDRAFT_176029                  129   1e-31   
gb|KFO32866.1|  Lipoyl synthase, mitochondrial                          130   1e-31   
ref|XP_007297714.1|  lipoic acid synthase                               129   1e-31   
ref|XP_003958377.1|  hypothetical protein KAFR_0G02080                  128   2e-31   
emb|CEP64109.1|  LALA0S10e02476g1_1                                     128   2e-31   
gb|KFP35645.1|  hypothetical protein N324_00260                         121   2e-31   
dbj|GAN00642.1|  lipoyl synthase, mitochondrial                         129   2e-31   
ref|XP_011122308.1|  hypothetical protein AOL_s00079g131                129   2e-31   
ref|XP_004147097.1|  PREDICTED: lipoyl synthase, chloroplastic-like     128   2e-31   
ref|XP_002490556.1|  Protein involved in biosynthesis of the coen...    129   2e-31   
ref|XP_007043178.1|  Radical SAM superfamily protein isoform 3          126   2e-31   
dbj|BAH72214.1|  ACYPI001804                                            124   2e-31   
dbj|GAA57273.1|  lipoic acid synthetase                                 129   2e-31   
emb|CEP10066.1|  hypothetical protein                                   128   2e-31   
dbj|GAM18868.1|  hypothetical protein SAMD00019534_020430               128   2e-31   
ref|XP_006011272.1|  PREDICTED: lipoyl synthase, mitochondrial is...    127   3e-31   
gb|KEP54071.1|  lipoic acid synthase                                    127   3e-31   
gb|KDR85116.1|  hypothetical protein GALMADRAFT_233744                  127   3e-31   
ref|XP_010687262.1|  PREDICTED: lipoyl synthase, chloroplastic is...    127   4e-31   
gb|EHK18901.1|  hypothetical protein TRIVIDRAFT_43662                   127   4e-31   
gb|KFV02235.1|  hypothetical protein N339_00148                         124   4e-31   
gb|KGB39838.1|  Lipoyl synthase, mitochondrial                          127   4e-31   
ref|XP_002562872.1|  Pc20g03200                                         127   4e-31   
ref|XP_006732375.1|  PREDICTED: lipoyl synthase, mitochondrial is...    127   4e-31   
gb|KIV81194.1|  lipoyl synthase, mitochondrial                          127   4e-31   
gb|EUC61059.1|  lipoic acid synthase                                    127   4e-31   
ref|XP_001270674.1|  lipoic acid synthetase precursor                   127   4e-31   
gb|KDQ19921.1|  hypothetical protein BOTBODRAFT_125423                  127   4e-31   
ref|XP_008067977.1|  PREDICTED: lipoyl synthase, mitochondrial is...    126   4e-31   
ref|XP_006011271.1|  PREDICTED: lipoyl synthase, mitochondrial is...    127   4e-31   
dbj|GAM87085.1|  hypothetical protein ANO11243_051060                   127   4e-31   
ref|XP_003008156.1|  lipoyl synthase                                    126   5e-31   
ref|XP_010083398.1|  PREDICTED: lipoyl synthase, mitochondrial-like     124   5e-31   
ref|XP_009389735.1|  PREDICTED: uncharacterized protein LOC103976253    131   5e-31   
gb|KIM48084.1|  hypothetical protein M413DRAFT_439793                   127   5e-31   
sp|A5DGI1.2|LIPA_PICGU  RecName: Full=Lipoyl synthase, mitochondr...    127   5e-31   
ref|XP_001828830.1|  lipoic acid synthase                               127   5e-31   
gb|AGO14086.1|  AaceriAGR231Cp                                          127   5e-31   
ref|XP_007043176.1|  Radical SAM superfamily protein isoform 1          127   5e-31   
emb|CEG65421.1|  Putative Lipoic acid synthetase                        127   6e-31   
emb|CEG65422.1|  Putative Lipoic acid synthetase                        126   6e-31   
gb|EKV19150.1|  Lipoyl synthase, mitochondrial                          127   6e-31   
gb|KIW16314.1|  lipoyl synthase, mitochondrial                          127   6e-31   
ref|XP_010684601.1|  PREDICTED: lipoyl synthase, chloroplastic-like     126   6e-31   
gb|EME38626.1|  hypothetical protein DOTSEDRAFT_75404                   127   6e-31   
ref|XP_006011270.1|  PREDICTED: lipoyl synthase, mitochondrial is...    127   6e-31   
gb|KIW45500.1|  lipoyl synthase, mitochondrial                          127   6e-31   
ref|XP_002154113.2|  PREDICTED: lipoyl synthase, mitochondrial-li...    126   6e-31   
ref|XP_001484653.1|  conserved hypothetical protein                     127   6e-31   
emb|CDJ05351.1|  lipoyl synthase, mitochondrial                         127   6e-31   
ref|XP_008067976.1|  PREDICTED: lipoyl synthase, mitochondrial is...    126   7e-31   
ref|NP_986897.1|  AGR231Cp                                              126   7e-31   
ref|XP_009060732.1|  hypothetical protein LOTGIDRAFT_150656             126   7e-31   



>ref|XP_004243321.1| PREDICTED: lipoyl synthase, mitochondrial [Solanum lycopersicum]
Length=380

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 134/172 (78%), Gaps = 15/172 (9%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            MN RF SL  RSLKS RH               +       SS+  +  +  QYPQTLEG
Sbjct  1    MNSRFTSLVSRSLKSNRH---------------HYLLPQLFSSSTATPASPPQYPQTLEG  45

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RLAAESPTL  F  LQSDNEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKLRE
Sbjct  46   LRHRLAAESPTLSDFTRLQSDNEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKLRE  105

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  106  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-like [Solanum tuberosum]
Length=380

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 133/172 (77%), Gaps = 15/172 (9%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            MN RF SL  RSLKS RH               +       SS+  +  +  QYPQTLEG
Sbjct  1    MNSRFTSLVSRSLKSNRH---------------HYLLPQLFSSSTATPASPPQYPQTLEG  45

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RLAAESPTL  F  LQSD EYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKLRE
Sbjct  46   LRHRLAAESPTLSDFTRLQSDKEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKLRE  105

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  106  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>ref|XP_009771704.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana sylvestris]
Length=385

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 135/172 (78%), Gaps = 10/172 (6%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            MN RF SL FRSLKS ++          HHH  +       S +  +  +  QY QTLEG
Sbjct  1    MNSRFTSLVFRSLKSRQN----------HHHHHHYLLPQFFSYSIATPASPPQYAQTLEG  50

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RLAAESPTL  FI LQSD EYSVEVGTKKKPLPKPKWMKEAIPGGEKYT IKKKLRE
Sbjct  51   LRHRLAAESPTLSDFIRLQSDKEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTHIKKKLRE  110

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  111  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  162



>gb|AHM22930.1| lipoyl synthase [Nicotiana tabacum]
Length=385

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 135/172 (78%), Gaps = 10/172 (6%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            MN RF SL FRSLKS ++          HHH  +       S +  +  +  QY QTLEG
Sbjct  1    MNSRFTSLVFRSLKSRQN----------HHHHHHYLLPQFFSYSIATPASPPQYAQTLEG  50

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RLAAESPTL  FI LQSD EYSVEVGTKKKPLPKPKWMKEAIPGGEKYT IKKKLRE
Sbjct  51   LRHRLAAESPTLSDFIRLQSDKEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTHIKKKLRE  110

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  111  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  162



>ref|XP_009621653.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128} 
[Nicotiana tomentosiformis]
Length=383

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 134/172 (78%), Gaps = 12/172 (7%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            MN RF SL FRSLKS RH           +H  +       SS+  +  +  QY QTLEG
Sbjct  1    MNSRFTSLVFRSLKS-RH-----------NHHHHYILPQFFSSSIATPASPPQYAQTLEG  48

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RLAAES TL  FI LQSD EYSVEVGTKKKPLPKPKWMKEAIPGGEKYT IKKKLRE
Sbjct  49   LRHRLAAESLTLSDFIRLQSDKEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTHIKKKLRE  108

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  109  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  160



>ref|XP_009778191.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana sylvestris]
Length=384

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 131/173 (76%), Gaps = 13/173 (8%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYP-QTLE  253
            MN RF +L FRSLKS+                 +         +  +   T   P QTLE
Sbjct  1    MNSRFTTLIFRSLKSSHR------------THHHHHFLLPQFFSSSAPTPTSTSPSQTLE  48

Query  254  GLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLR  433
            GLR RLAAESPTLG FI LQS+NEYSVEVGTKKKPLPKPKWMKEAIPGGEKYT IKKKLR
Sbjct  49   GLRHRLAAESPTLGDFIRLQSENEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTHIKKKLR  108

Query  434  ELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            ELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  109  ELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  161



>ref|XP_011025577.1| PREDICTED: lipoyl synthase, mitochondrial-like [Populus euphratica]
Length=385

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 128/175 (73%), Gaps = 22/175 (13%)
 Frame = +2

Query  77   MNYRFASLAFRSLKST----RHCGsptsllplhhhslypqsfsssssappsspATHQYPQ  244
            M  RF SLA R+LKST    ++C   +                             Q+P+
Sbjct  1    MQSRFTSLAIRTLKSTTTKAKNCNFSSFTTESSTKQHP------------------QFPE  42

Query  245  TLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            TL GLR+RLAAESP LG FI LQS+N YSVEVGTKKKPLPKP WM+EAIPGGEKY QIKK
Sbjct  43   TLAGLRARLAAESPALGDFIDLQSNNTYSVEVGTKKKPLPKPTWMREAIPGGEKYVQIKK  102

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  103  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>gb|EYU26119.1| hypothetical protein MIMGU_mgv1a008134mg [Erythranthe guttata]
Length=383

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  227  THQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEK  406
            +  YP TL+GLR RLAAESPTLG F+ LQSD  YSVEVGTKKKPLPKPKWMKE+IPGGEK
Sbjct  38   SQNYPPTLDGLRRRLAAESPTLGEFVQLQSDQSYSVEVGTKKKPLPKPKWMKESIPGGEK  97

Query  407  YTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS  586
            YTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS
Sbjct  98   YTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS  157

Query  587  RT  592
            RT
Sbjct  158  RT  159



>ref|XP_006380479.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
 gb|ERP58276.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
Length=385

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 129/175 (74%), Gaps = 22/175 (13%)
 Frame = +2

Query  77   MNYRFASLAFRSLKST----RHCGsptsllplhhhslypqsfsssssappsspATHQYPQ  244
            M  RF SLA R+LKST    ++C   +S                            Q+P+
Sbjct  1    MQSRFTSLATRTLKSTTTKAKNCNFSSSTTESSTKQHP------------------QFPE  42

Query  245  TLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            TL GLR+RL+AESP LG FI LQS+N YSVEVGTKKK LPKPKWM+EAIPGGEKY QIKK
Sbjct  43   TLAGLRARLSAESPALGDFIDLQSNNTYSVEVGTKKKSLPKPKWMREAIPGGEKYVQIKK  102

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  103  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_006380478.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
 gb|ERP58275.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
Length=354

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 129/175 (74%), Gaps = 22/175 (13%)
 Frame = +2

Query  77   MNYRFASLAFRSLKST----RHCGsptsllplhhhslypqsfsssssappsspATHQYPQ  244
            M  RF SLA R+LKST    ++C   +S                            Q+P+
Sbjct  1    MQSRFTSLATRTLKSTTTKAKNCNFSSSTTESSTKQHP------------------QFPE  42

Query  245  TLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            TL GLR+RL+AESP LG FI LQS+N YSVEVGTKKK LPKPKWM+EAIPGGEKY QIKK
Sbjct  43   TLAGLRARLSAESPALGDFIDLQSNNTYSVEVGTKKKSLPKPKWMREAIPGGEKYVQIKK  102

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  103  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_002517968.1| lipoic acid synthetase, putative [Ricinus communis]
 sp|B9RW49.1|LIAS_RICCO RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Ricinus communis]
 gb|EEF44486.1| lipoic acid synthetase, putative [Ricinus communis]
Length=348

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+PQTL GLR+RLAAESP+L  F  LQS+N YSVEVGTKKKPLPKPKWM+EAIPGG+KY 
Sbjct  31   QFPQTLAGLRARLAAESPSLSEFSDLQSNNSYSVEVGTKKKPLPKPKWMREAIPGGDKYV  90

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  91   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  150



>ref|XP_011021958.1| PREDICTED: lipoyl synthase, mitochondrial [Populus euphratica]
Length=385

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 129/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            M  RF SLA R+LKST               +       SSS+   S+    Q+ QTL G
Sbjct  1    MQSRFTSLATRTLKST--------------TTKAKNRTFSSSTVESSTKQPPQFSQTLAG  46

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR+RLA ESPTL  FI LQS+N YSVEVGTKKKPLPKP WM+EAIPGGEKY QIKKKLRE
Sbjct  47   LRTRLAVESPTLSDFIHLQSNNTYSVEVGTKKKPLPKPTWMREAIPGGEKYVQIKKKLRE  106

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  107  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_007043524.1| Lipoic acid synthase 1 isoform 3 [Theobroma cacao]
 gb|EOX99355.1| Lipoic acid synthase 1 isoform 3 [Theobroma cacao]
Length=298

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESP L  FIGLQ+DN+YSVEVGTKKKPLPKPKWM+E++PGGEKY 
Sbjct  34   DFPPTLAGLRARLAAESPALTDFIGLQNDNQYSVEVGTKKKPLPKPKWMRESVPGGEKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  94   QIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  153



>ref|XP_003543350.1| PREDICTED: lipoyl synthase 2, mitochondrial [Glycine max]
Length=378

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            A  Q PQTL GLR+RLA ESP+L  F+ L+SD+ YSVEVGTKKKPLPKPKWMKEA+PGGE
Sbjct  32   APSQLPQTLAGLRARLAEESPSLSDFVALKSDSAYSVEVGTKKKPLPKPKWMKEAVPGGE  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>ref|XP_006382932.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
 gb|ERP60729.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
Length=349

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+ QTL GLR+RLA ESPTL  FI LQS+N YSVEVGTKKKPLPKPKWM+EAIPGGEKY 
Sbjct  39   QFSQTLAGLRARLAVESPTLSDFIHLQSNNTYSVEVGTKKKPLPKPKWMREAIPGGEKYV  98

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  99   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao]
 gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao]
Length=376

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESP L  FIGLQ+DN+YSVEVGTKKKPLPKPKWM+E++PGGEKY 
Sbjct  34   DFPPTLAGLRARLAAESPALTDFIGLQNDNQYSVEVGTKKKPLPKPKWMRESVPGGEKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  94   QIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  153



>ref|XP_007043523.1| Lipoyl synthase, mitochondrial isoform 2 [Theobroma cacao]
 gb|EOX99354.1| Lipoyl synthase, mitochondrial isoform 2 [Theobroma cacao]
Length=344

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESP L  FIGLQ+DN+YSVEVGTKKKPLPKPKWM+E++PGGEKY 
Sbjct  34   DFPPTLAGLRARLAAESPALTDFIGLQNDNQYSVEVGTKKKPLPKPKWMRESVPGGEKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  94   QIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  153



>ref|XP_011072065.1| PREDICTED: lipoyl synthase 2, mitochondrial [Sesamum indicum]
Length=382

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  230  HQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKY  409
              YP TL+GLR RLAAESPTL  FI LQSD+ YSVEVGTKKKPLPKPKWMKE+IPGGEKY
Sbjct  39   QNYPPTLDGLRRRLAAESPTLAHFIKLQSDHSYSVEVGTKKKPLPKPKWMKESIPGGEKY  98

Query  410  TQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            TQIK+KLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  99   TQIKRKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  158



>gb|ABK96318.1| unknown [Populus trichocarpa x Populus deltoides]
Length=385

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 129/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            M  RF SLA R+LKST               +       SSS+   S+    Q+ QTL G
Sbjct  1    MQSRFTSLATRTLKST--------------TTKAKNRTFSSSTVESSTKQPPQFSQTLAG  46

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR+RLA ESPTL  FI LQS+N YSVEVGTKKKPLPKPKWM+EAIPGGEKY  IKKKLRE
Sbjct  47   LRARLAVESPTLSDFIHLQSNNTYSVEVGTKKKPLPKPKWMREAIPGGEKYVHIKKKLRE  106

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  107  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Cicer arietinum]
Length=380

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQ L GLR+RLA ESP+L  FI L+SDN YSVEVGTKKKPLPKPKWMKE+IPGGEKY 
Sbjct  33   EFPQNLAGLRARLAVESPSLSDFISLKSDNAYSVEVGTKKKPLPKPKWMKESIPGGEKYV  92

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  93   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  152



>ref|XP_002306361.1| lipoic acid synthase family protein [Populus trichocarpa]
 sp|B9H5L9.1|LIAS_POPTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Populus trichocarpa]
 gb|EEE93357.1| lipoic acid synthase family protein [Populus trichocarpa]
Length=385

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+ QTL GLR+RLA ESPTL  FI LQS+N YSVEVGTKKKPLPKPKWM+EAIPGGEKY 
Sbjct  39   QFSQTLAGLRARLAVESPTLSDFIHLQSNNTYSVEVGTKKKPLPKPKWMREAIPGGEKYV  98

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  99   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_006382933.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
 gb|ERP60730.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
Length=372

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+ QTL GLR+RLA ESPTL  FI LQS+N YSVEVGTKKKPLPKPKWM+EAIPGGEKY 
Sbjct  39   QFSQTLAGLRARLAVESPTLSDFIHLQSNNTYSVEVGTKKKPLPKPKWMREAIPGGEKYV  98

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  99   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>emb|CDP14732.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +2

Query  236  YPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQ  415
            + +TLEGLR RLA ESPTL  FI LQS+NEYSVEVGTKKKPLPKPKWMKE+IPGGEKYT 
Sbjct  34   FARTLEGLRQRLAEESPTLADFIKLQSENEYSVEVGTKKKPLPKPKWMKESIPGGEKYTH  93

Query  416  IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  151



>gb|KDP24175.1| hypothetical protein JCGZ_25832 [Jatropha curcas]
Length=377

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+PQTL GLR+RLAAESP L  F  LQS + YSVEVGTKKKPLPKPKWMKEAIPGGEKY 
Sbjct  31   QFPQTLAGLRARLAAESPDLSEFNDLQSHDWYSVEVGTKKKPLPKPKWMKEAIPGGEKYV  90

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  91   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  150



>gb|KDO40565.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=334

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR+RLA+ESP L  FI LQS++ YSVEVGTKKKPLPKPKWMKE+IPGG+KY 
Sbjct  34   KFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
 gb|ESR60560.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
Length=363

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR+RLA+ESP L  FI LQS++ YSVEVGTKKKPLPKPKWMKE+IPGG+KY 
Sbjct  34   KFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_003540350.1| PREDICTED: lipoyl synthase 2, mitochondrial [Glycine max]
Length=382

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+PQTL GLR+RLA ESP+L  F+ L+S++ YSVEVGTKKKPLPKPKWMKEA+PGGEKY 
Sbjct  35   QFPQTLAGLRARLAEESPSLSDFLALKSESAYSVEVGTKKKPLPKPKWMKEAVPGGEKYV  94

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  95   QIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  154



>gb|KJB79957.1| hypothetical protein B456_013G074500 [Gossypium raimondii]
Length=377

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESPTL  F+GLQ++N YSVEVGTKKKPLPKPKWM+E+IPGGEKY 
Sbjct  35   DFPPTLAGLRARLAAESPTLSDFVGLQTNNLYSVEVGTKKKPLPKPKWMRESIPGGEKYV  94

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIK KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  95   QIKAKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  154



>ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
 ref|XP_006491631.1| PREDICTED: lipoyl synthase, mitochondrial-like [Citrus sinensis]
 gb|ESR60561.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
Length=376

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR+RLA+ESP L  FI LQS++ YSVEVGTKKKPLPKPKWMKE+IPGG+KY 
Sbjct  34   KFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>gb|KDO40564.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=376

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR+RLA+ESP L  FI LQS++ YSVEVGTKKKPLPKPKWMKE+IPGG+KY 
Sbjct  34   KFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_008455341.1| PREDICTED: lipoyl synthase 2, mitochondrial [Cucumis melo]
Length=381

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+P+TL GLR RLAAESP+L  F+ LQS + YSVEVGTKKKPLPKPKWMKE++PGGEKY 
Sbjct  34   QFPRTLAGLRERLAAESPSLSDFVDLQSSDSYSVEVGTKKKPLPKPKWMKESVPGGEKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_009628827.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128}-like 
[Nicotiana tomentosiformis]
Length=207

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 128/165 (78%), Gaps = 13/165 (8%)
 Frame = +2

Query  74   KMNYRFASLAFRSLKS-TRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTL  250
            KMN RF +L FRSLKS  RH      LLP    S  P   S+S             P TL
Sbjct  55   KMNSRFTTLFFRSLKSGHRHSHHHYFLLPQFFSSSAPTPTSTSP------------PLTL  102

Query  251  EGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKL  430
            EGLR RLAAESPTLG FI LQS+NEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKL
Sbjct  103  EGLRHRLAAESPTLGDFIRLQSENEYSVEVGTKKKPLPKPKWMKEAIPGGEKYTQIKKKL  162

Query  431  RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR  565
            RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR
Sbjct  163  RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR  207



>gb|KHG07122.1| Lipoyl synthase, mitochondrial [Gossypium arboreum]
Length=377

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESPTL  F GLQ++N YSVEVGTKKKPLPKPKWM+E+IPGGEKY 
Sbjct  35   DFPPTLAGLRARLAAESPTLSDFFGLQTNNLYSVEVGTKKKPLPKPKWMRESIPGGEKYV  94

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIK KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  95   QIKAKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  154



>gb|KDO40563.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=375

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR+RLA+ESP L  FI LQS++ YSVEVGTKKKPLPKPKWMKE+IPGG+KY 
Sbjct  34   KFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>gb|EPS65537.1| lipoyl synthase, mitochondrial, partial [Genlisea aurea]
Length=340

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  236  YPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQ  415
            YPQTL GLR R+A E PTL  F+ LQSD  YSVEVGTKK PLPKPKWMKE+IPGGEKYT+
Sbjct  1    YPQTLNGLRRRIADELPTLADFVKLQSDQVYSVEVGTKKNPLPKPKWMKESIPGGEKYTR  60

Query  416  IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            IKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  61   IKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  119



>ref|XP_004136815.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus]
 ref|XP_004155481.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus]
 gb|KGN43590.1| hypothetical protein Csa_7G047260 [Cucumis sativus]
Length=381

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q+P+TL GLR RLAAESP L  F+ LQS + YSVEVGTKKKPLPKPKWM+E++PGGEKY 
Sbjct  34   QFPRTLAGLRERLAAESPILSDFVDLQSSDSYSVEVGTKKKPLPKPKWMRESVPGGEKYV  93

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  94   QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_007149882.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris]
 gb|ESW21876.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris]
Length=381

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            A  Q+ QTL GLR RLA ESP+L  FI ++S++ YSV+VGTKKKPLPKPKWMKEA+PGGE
Sbjct  31   APSQFSQTLAGLRERLAEESPSLSDFIAMKSESAYSVDVGTKKKPLPKPKWMKEAVPGGE  90

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  91   KYVQIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  150

Query  584  SRT  592
            SRT
Sbjct  151  SRT  153



>sp|Q3LSN5.1|LIAS2_PEA RecName: Full=Lipoyl synthase 2, mitochondrial; AltName: Full=Lipoate 
synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoic 
acid synthase 2; Flags: Precursor [Pisum sativum]
 gb|ABA29155.1| putative lipoic acid synthase [Pisum sativum]
Length=376

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            A  +  Q L  LR+RLA ESP+L  FI L+SDN YSVEVGTKKKPLPKPKWMKE+IPGGE
Sbjct  32   APSELQQNLAALRARLAMESPSLSDFISLKSDNAYSVEVGTKKKPLPKPKWMKESIPGGE  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>ref|XP_007149469.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris]
 gb|ESW21463.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris]
Length=377

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            A  Q PQTL GLR+RL  ESP+L  FI L+S++ YSVEVGTKKKP+PKP+WMKEA+PGGE
Sbjct  31   APSQIPQTLAGLRARLEEESPSLSDFISLRSESAYSVEVGTKKKPIPKPRWMKEAVPGGE  90

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  91   KYVQIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  150

Query  584  SRT  592
            SRT
Sbjct  151  SRT  153



>sp|Q3LSN4.1|LIAS1_PEA RecName: Full=Lipoyl synthase 1, mitochondrial; AltName: Full=Lipoate 
synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoic 
acid synthase 1; Flags: Precursor [Pisum sativum]
 gb|ABA29156.1| putative lipoic acid synthase [Pisum sativum]
Length=376

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            A  +  Q L  LR+RLA ESP+L  FI L+SDN YSVEVGTKKKPLPKPKWMKE+IPGGE
Sbjct  32   APSELQQNLAALRARLAMESPSLSDFISLKSDNAYSVEVGTKKKPLPKPKWMKESIPGGE  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>ref|XP_010278318.1| PREDICTED: lipoyl synthase 2, mitochondrial [Nelumbo nucifera]
Length=409

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            ++PQTL GLR RLA ESP+L  FI LQ ++EYSVEVGTKK PLPKPKWMKE+IPGG KY 
Sbjct  62   EFPQTLAGLRERLAVESPSLSDFIHLQENDEYSVEVGTKKNPLPKPKWMKESIPGGSKYA  121

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            +IKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  122  KIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  181



>gb|AFK48146.1| unknown [Medicago truncatula]
Length=378

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ++ ++PQ L  LR+RLA ESP+L  FI L+S+N YSVEVGTKK PLPKPKWMKE+IPGG 
Sbjct  32   SSSEFPQNLTELRARLARESPSLSDFISLKSNNAYSVEVGTKKNPLPKPKWMKESIPGGW  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPN+GECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNMGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>gb|KEH39087.1| lipoyl synthase [Medicago truncatula]
Length=378

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ++ ++PQ L  LR+RLA ESP+L  FI L+S+N YSVEVGTKK PLPKPKWMKE+IPGG 
Sbjct  32   SSSEFPQNLTELRARLARESPSLSDFISLKSNNAYSVEVGTKKNPLPKPKWMKESIPGGW  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPN+GECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNMGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>sp|B7FM45.1|LIAS_MEDTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Medicago truncatula]
 gb|ACJ85828.1| unknown [Medicago truncatula]
Length=378

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ++ ++PQ L  LR+RLA ESP+L  FI L+S+N YSVEVGTKK PLPKPKWMKE+IPGG 
Sbjct  32   SSSEFPQNLTELRARLARESPSLSDFISLKSNNAYSVEVGTKKNPLPKPKWMKESIPGGW  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPN+GECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNMGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>ref|XP_010035697.1| PREDICTED: lipoyl synthase 2, mitochondrial [Eucalyptus grandis]
 gb|KCW47138.1| hypothetical protein EUGRSUZ_K00943 [Eucalyptus grandis]
Length=384

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +2

Query  245  TLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            TL GLR+RLAAESP+L  F+GL++ + YSVEVGTKKKPLPKPKWM E+IPGGEKY QIKK
Sbjct  41   TLAGLRARLAAESPSLSDFVGLKTSDSYSVEVGTKKKPLPKPKWMTESIPGGEKYVQIKK  100

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  101  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  156



>gb|AFK43632.1| unknown [Medicago truncatula]
Length=378

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ++ ++PQ L  LR+RLA ESP+L  FI L+S+N YSVEVGTKK PLPKPKWMKE+IPGG 
Sbjct  32   SSSEFPQNLTELRARLARESPSLSDFISLKSNNAYSVEVGTKKNPLPKPKWMKESIPGGW  91

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KY QIKKKLRELKLHTVCEEAKCPN+GECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  92   KYVQIKKKLRELKLHTVCEEAKCPNMGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  151

Query  584  SRT  592
            SRT
Sbjct  152  SRT  154



>ref|XP_008356122.1| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase 2, mitochondrial-like 
[Malus domestica]
Length=380

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 129/171 (75%), Gaps = 19/171 (11%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            M  RF +LA R +KST                      SS+ + P ++ ++ Q+PQTL G
Sbjct  1    MQTRFTALAARIVKST-----------------ARSFSSSTQTPPSTATSSSQFPQTLAG  43

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR+RLAAESP L  F+  + +  YSVEVGTKK PLPKPKWMKE+IPGG+KYTQIKKKLRE
Sbjct  44   LRARLAAESPILTDFV--EGEGPYSVEVGTKKNPLPKPKWMKESIPGGQKYTQIKKKLRE  101

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  102  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  152



>ref|XP_008341911.1| PREDICTED: lipoyl synthase, mitochondrial [Malus domestica]
Length=381

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 130/171 (76%), Gaps = 18/171 (11%)
 Frame = +2

Query  77   MNYRFASLAFRSLKSTRHCGsptsllplhhhslypqsfsssssappsspATHQYPQTLEG  256
            M  RF +LA R+LKST                    S SS+ + P ++  + Q+PQTL G
Sbjct  1    MQTRFTALAARTLKST----------------ARSFSSSSTQTPPLTAATSSQFPQTLAG  44

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR+RLAA+SP L  F+  + +  YSVEVGTKK PLPKPKWMKE+IPGG+KYTQIKKKLRE
Sbjct  45   LRARLAADSPVLTDFV--EREGPYSVEVGTKKNPLPKPKWMKESIPGGQKYTQIKKKLRE  102

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  103  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  153



>ref|XP_009357081.1| PREDICTED: lipoyl synthase 2, mitochondrial [Pyrus x bretschneideri]
Length=383

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 2/122 (2%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ++ Q+PQTL GLR+RLAAESP L  F+  + +  YSVEVGTKK PLPKPKWMKE+IPGG+
Sbjct  36   SSSQFPQTLAGLRARLAAESPILTDFV--EGEGPYSVEVGTKKNPLPKPKWMKESIPGGQ  93

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  94   KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  153

Query  584  SR  589
            SR
Sbjct  154  SR  155



>ref|XP_010671528.1| PREDICTED: lipoyl synthase 2, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIK  421
            QTLE LR RL+ ESP LG FI LQ +++YSVEVGTKK PLPKPKWMKE+IPGG+KYT+IK
Sbjct  42   QTLESLRQRLSKESPNLGDFIRLQRNDDYSVEVGTKKNPLPKPKWMKESIPGGDKYTKIK  101

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            KKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  102  KKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  157



>ref|XP_004306011.1| PREDICTED: lipoyl synthase 2, mitochondrial [Fragaria vesca subsp. 
vesca]
Length=453

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 2/120 (2%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
             +P TL GLR+RLAAESP+L  F+G   +  YSVEVGTKKKPLPKPKWMKE+IPGGEKYT
Sbjct  109  DFPPTLAGLRARLAAESPSLTEFVG--GEGPYSVEVGTKKKPLPKPKWMKESIPGGEKYT  166

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  167  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  226



>ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial 
[Vitis vinifera]
 sp|A5CB81.1|LIAS_VITVI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Vitis vinifera]
 emb|CAN73265.1| hypothetical protein VITISV_021769 [Vitis vinifera]
Length=393

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  239  PQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQI  418
            PQTL  LR RLA ESP+L  F+ LQ+ ++YSVEVGTKKKPL KPKWMKE+IPGG KYTQI
Sbjct  43   PQTLASLRHRLAVESPSLSDFVRLQTSDDYSVEVGTKKKPLSKPKWMKESIPGGAKYTQI  102

Query  419  KKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            KKKLR+L LHTVCEEA+CPN+GECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  KKKLRQLNLHTVCEEARCPNMGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  160



>ref|XP_007215533.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica]
 gb|EMJ16732.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica]
Length=380

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 2/119 (2%)
 Frame = +2

Query  236  YPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQ  415
            +PQTL GLR+RLAAESP L  F+  + +  YSVEVGTKK PLPKPKWMKE+IPGG+KYTQ
Sbjct  37   FPQTLAGLRARLAAESPVLTDFV--EGEGPYSVEVGTKKNPLPKPKWMKESIPGGQKYTQ  94

Query  416  IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS+T
Sbjct  95   IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSKT  153



>ref|XP_010526527.1| PREDICTED: lipoyl synthase, mitochondrial [Tarenaya hassleriana]
Length=375

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 3/123 (2%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            ATH +P++LE LR+RLAAESP+L  FI  +    YSVEVG+KKKPLPKPKWMKE+IPGGE
Sbjct  32   ATH-FPKSLEALRARLAAESPSLTDFI--RGGETYSVEVGSKKKPLPKPKWMKESIPGGE  88

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            +Y QIKKKLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  89   RYVQIKKKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  148

Query  584  SRT  592
            SRT
Sbjct  149  SRT  151



>emb|CDX81984.1| BnaC08g36170D [Brassica napus]
Length=374

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 109/123 (89%), Gaps = 3/123 (2%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            AT Q P+TLE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE
Sbjct  32   ATTQSPRTLESLRARLADESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGE  88

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  583
            +Y QIKKKLR+L LHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT
Sbjct  89   RYVQIKKKLRDLNLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKT  148

Query  584  SRT  592
            SRT
Sbjct  149  SRT  151



>ref|XP_006298130.1| hypothetical protein CARUB_v10014173mg [Capsella rubella]
 gb|EOA31028.1| hypothetical protein CARUB_v10014173mg [Capsella rubella]
Length=326

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  32   QSPKSLEALRARLANESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGERYV  88

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  89   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  148



>ref|XP_009117465.1| PREDICTED: lipoyl synthase, mitochondrial [Brassica rapa]
 emb|CDY13855.1| BnaA09g43570D [Brassica napus]
Length=374

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 108/122 (89%), Gaps = 3/122 (2%)
 Frame = +2

Query  227  THQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEK  406
            T Q P+TLE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+
Sbjct  33   TTQSPRTLESLRARLADESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGER  89

Query  407  YTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS  586
            Y QIKKKLR+L LHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS
Sbjct  90   YVQIKKKLRDLNLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS  149

Query  587  RT  592
            RT
Sbjct  150  RT  151



>ref|XP_010467759.1| PREDICTED: lipoyl synthase, mitochondrial [Camelina sativa]
Length=372

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  29   QSPKSLEALRARLANESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGERYV  85

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  86   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  145



>ref|XP_010488982.1| PREDICTED: lipoyl synthase, mitochondrial-like [Camelina sativa]
Length=372

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  29   QSPKSLEALRARLANESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGERYV  85

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  86   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  145



>ref|XP_002884228.1| hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60487.1| hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  32   QSPKSLEALRARLANESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGERYV  88

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  89   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  148



>ref|NP_179682.1| lipoic acid synthase 1 [Arabidopsis thaliana]
 sp|Q9ZWT1.1|LIAS_ARATH RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11577.1|AF424583_1 At2g20860/F5H14.17 [Arabidopsis thaliana]
 dbj|BAA34701.1| Lipoic acid synthase [Arabidopsis thaliana]
 gb|AAD20909.1| lipoic acid synthase (LIP1) [Arabidopsis thaliana]
 gb|AAK59647.1| putative lipoic acid synthase LIP1 [Arabidopsis thaliana]
 gb|AAL15183.1| putative lipoic acid synthase LIP1 [Arabidopsis thaliana]
 gb|AEC07088.1| lipoic acid synthase 1 [Arabidopsis thaliana]
Length=374

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  32   QSPKSLEALRARLANESPSLTDFI---HGDTYSVEVGTKKKPLPKPKWMKESIPGGERYV  88

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  89   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  148



>ref|XP_006409024.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
 gb|ESQ50477.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
Length=373

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA +SP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGGE+Y 
Sbjct  32   QSPRSLEALRARLADDSPSLTDFI---HGDSYSVEVGTKKKPLPKPKWMKESIPGGERYV  88

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  89   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  148



>gb|KFK40464.1| hypothetical protein AALP_AA3G376400 [Arabis alpina]
Length=373

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 108/120 (90%), Gaps = 3/120 (3%)
 Frame = +2

Query  233  QYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYT  412
            Q P++LE LR+RLA ESP+L  FI     + YSVEVGTKKKPLPKPKWMKE+IPGG++Y 
Sbjct  31   QSPRSLEALRARLANESPSLTDFI---HGDSYSVEVGTKKKPLPKPKWMKESIPGGDRYV  87

Query  413  QIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            QIKKKLR+LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  88   QIKKKLRDLKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  147



>ref|XP_010095809.1| Lipoyl synthase [Morus notabilis]
 gb|EXB62277.1| Lipoyl synthase [Morus notabilis]
Length=384

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = +2

Query  227  THQYPQTLEGLRSRLAAESPTLGSFIG-LQSDNEYSVEVGTkkkplpkpkWMKEAIPGGE  403
            + ++PQTL GLR+RLAAESP+L +FI  L+S++ YSVEVGTKK PLPKPKWMKEAIPGG+
Sbjct  38   SSEFPQTLAGLRARLAAESPSLSNFISDLKSNSPYSVEVGTKKNPLPKPKWMKEAIPGGQ  97

Query  404  KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR  565
            KY QIKKKLREL LHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCR
Sbjct  98   KYVQIKKKLRELNLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCR  151



>dbj|BAB44157.1| lipoic acid synthase [Bruguiera gymnorhiza]
Length=375

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 2/105 (2%)
 Frame = +2

Query  278  ESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRELKLHTVC  457
            ESP+LG F+ LQS   YSVEVG KKKP+PKPKWM+EAIPGG+KY  IKKKLRELKLHTVC
Sbjct  44   ESPSLGDFMNLQSG--YSVEVGNKKKPMPKPKWMREAIPGGDKYVHIKKKLRELKLHTVC  101

Query  458  EEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            EEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  102  EEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  146



>ref|XP_008782125.1| PREDICTED: lipoyl synthase, mitochondrial [Phoenix dactylifera]
Length=389

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 100/117 (85%), Gaps = 7/117 (6%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIK  421
            +TL  LR RLAA+SP+L  F+       YSVEVGTKK+PLPKPKWMKE IPGG KY  IK
Sbjct  51   RTLSDLRRRLAADSPSLSDFV-------YSVEVGTKKQPLPKPKWMKETIPGGAKYAAIK  103

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
             KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  104  AKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  160



>ref|XP_008230240.1| PREDICTED: lipoyl synthase 2, mitochondrial [Prunus mume]
Length=299

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = +2

Query  377  MKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTR  556
            MKE+IPGG+KYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTR
Sbjct  1    MKESIPGGQKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTR  60

Query  557  GCRFCNVKTSRTPPPPDPNE  616
            GCRFCNVKTS+TPPPPDPNE
Sbjct  61   GCRFCNVKTSKTPPPPDPNE  80



>ref|XP_009398165.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128}-like 
[Musa acuminata subsp. malaccensis]
Length=382

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 98/117 (84%), Gaps = 7/117 (6%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIK  421
            +TL  LR RLA E+P L  F+       YSVEVGTKK+PLPKPKWMKE IPGG KY  IK
Sbjct  44   RTLADLRRRLAEEAPALADFV-------YSVEVGTKKRPLPKPKWMKETIPGGAKYAAIK  96

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
             KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  97   AKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  153



>ref|XP_009388773.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128}-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 96/117 (82%), Gaps = 7/117 (6%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIK  421
            +TL  LR RLA ESP    F+       YSVEVGTKK+ LPKPKWMKE IPGG KY  IK
Sbjct  47   RTLADLRRRLAEESPAFSDFV-------YSVEVGTKKRSLPKPKWMKETIPGGAKYAAIK  99

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
             KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  100  SKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  156



>ref|XP_010926267.1| PREDICTED: lipoyl synthase, mitochondrial [Elaeis guineensis]
Length=395

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 98/116 (84%), Gaps = 7/116 (6%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIK  421
            +TL  L+ RLA ESP+L  F+       YSVEVGTKKKPLPKPKWMKE IPGG KY  IK
Sbjct  57   RTLADLQRRLAVESPSLSDFV-------YSVEVGTKKKPLPKPKWMKETIPGGAKYAAIK  109

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
             KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR
Sbjct  110  AKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  165



>ref|XP_002447950.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor]
 sp|C5Y9R0.1|LIAS_SORBI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Sorghum bicolor]
 gb|EES12278.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor]
Length=386

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 98/118 (83%), Gaps = 7/118 (6%)
 Frame = +2

Query  239  PQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQI  418
            P  L  LR RL A++P+LG F        YSVEVGT+++PLPKPKWMKE +PGG KY  I
Sbjct  48   PGRLAELRRRLQADAPSLGDF-------AYSVEVGTRQRPLPKPKWMKETVPGGAKYAAI  100

Query  419  KKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            K KLRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  101  KAKLRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  158



>dbj|BAJ97232.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  +R RL AE+P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  50   LAEMRRRLQAETPSLGDF-------AYSVEVGTRKKPLPKPKWMKETIPGGAKYAAIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>dbj|BAK07245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  +R RL AE+P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  82   LAEMRRRLQAETPSLGDF-------AYSVEVGTRKKPLPKPKWMKETIPGGAKYAAIKAK  134

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  135  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  189



>ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-like [Setaria italica]
Length=385

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  LR+RL A++P+LG F        YSVEVGT+K+PLPKPKWMKE +PGG KY  IK K
Sbjct  50   LAELRARLQADAPSLGDFT-------YSVEVGTRKRPLPKPKWMKETVPGGAKYAAIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>gb|EAY94363.1| hypothetical protein OsI_16128 [Oryza sativa Indica Group]
Length=360

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  LR RL A++P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  50   LAELRQRLQADAPSLGDFT-------YSVEVGTRKKPLPKPKWMKETIPGGAKYAGIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Oryza sativa Indica Group]
Length=382

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  LR RL A++P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  50   LAELRQRLQADAPSLGDFT-------YSVEVGTRKKPLPKPKWMKETIPGGAKYAGIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>ref|NP_001146235.1| lipoyl synthase, mitochondrial [Zea mays]
 sp|B8A031.1|LIAS_MAIZE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Zea mays]
 gb|ACL53530.1| unknown [Zea mays]
 gb|ACN25811.1| unknown [Zea mays]
 gb|ACR36873.1| unknown [Zea mays]
 tpg|DAA37504.1| TPA: hypothetical protein ZEAMMB73_507372 [Zea mays]
Length=383

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  LR RL A++P+LG F        YSVEVGT+++PLPKPKWMKE +PGG KY  IK K
Sbjct  48   LAELRRRLQADAPSLGDFT-------YSVEVGTRQRPLPKPKWMKETVPGGAKYAAIKAK  100

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  101  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  155



>ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group]
 sp|Q7XRF1.2|LIAS_ORYSJ RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE02573.2| OSJNBa0006M15.16 [Oryza sativa Japonica Group]
 dbj|BAF14878.1| Os04g0455800 [Oryza sativa Japonica Group]
 gb|EAZ30943.1| hypothetical protein OsJ_15022 [Oryza sativa Japonica Group]
 dbj|BAH00110.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 97/115 (84%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  LR RL A++P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  50   LAELRQRLQADAPSLGDFT-------YSVEVGTRKKPLPKPKWMKETIPGGAKYAGIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group]
Length=382

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 96/112 (86%), Gaps = 7/112 (6%)
 Frame = +2

Query  257  LRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRE  436
            LR RL A++P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK KLRE
Sbjct  53   LRKRLQADAPSLGDFT-------YSVEVGTRKKPLPKPKWMKETIPGGAKYAGIKAKLRE  105

Query  437  LKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  106  LKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>ref|XP_010239981.1| PREDICTED: lipoyl synthase, mitochondrial [Brachypodium distachyon]
Length=386

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 96/115 (83%), Gaps = 7/115 (6%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  +R RL A+ P+LG F        YSVEVGT+KKPLPKPKWMKE IPGG KY  IK K
Sbjct  50   LAEMRRRLQADGPSLGDF-------AYSVEVGTRKKPLPKPKWMKETIPGGAKYAAIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  157



>sp|A9NNH7.1|LIAS_PICSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Picea sitchensis]
 gb|ABK22188.1| unknown [Picea sitchensis]
Length=386

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNE-YSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            L  LR RLA   PTL  F+      E YSV+VGTKK PLPKPKWMK A+PGG+KYT IK 
Sbjct  45   LSALRERLANGGPTLSDFLTRNLGEEPYSVDVGTKKNPLPKPKWMKAAVPGGDKYTAIKA  104

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            KLRE+ LHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFC VKTSR
Sbjct  105  KLREMNLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCAVKTSR  159



>ref|XP_002984787.1| hypothetical protein SELMODRAFT_121095 [Selaginella moellendorffii]
 gb|EFJ14037.1| hypothetical protein SELMODRAFT_121095 [Selaginella moellendorffii]
Length=357

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNE-YSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            L   R RLA+++P L  F+   S  E YSV VGT++ P  KP WMK  IPGGEKYT+IK 
Sbjct  18   LAAFRERLASDAPELKDFVSQGSGVEGYSVAVGTREDPRRKPDWMKRIIPGGEKYTRIKS  77

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            +LRELKL+TVCEEAKCPN+GECWSGG+TGTATATIMILGDTCTRGCRFC VKTSR
Sbjct  78   QLRELKLNTVCEEAKCPNIGECWSGGDTGTATATIMILGDTCTRGCRFCAVKTSR  132



>ref|XP_006841751.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda]
 gb|ERN03426.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda]
Length=324

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  QSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGEC  490
            +S   YSVEVGTKKKPLPKPKWMKE++PGGEKYT+IK KLRELKLHTVCEEA+CPNL EC
Sbjct  3    RSGGAYSVEVGTKKKPLPKPKWMKESVPGGEKYTKIKGKLRELKLHTVCEEARCPNLAEC  62

Query  491  WSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  592
            WSGGETGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  63   WSGGETGTATATIMILGDTCTRGCRFCNVKTSRT  96



>ref|XP_001764819.1| predicted protein [Physcomitrella patens]
 gb|EDQ70518.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  245  TLEGLRSRLAAESPTLGSFIGLQSDNE--YSVEVGTkkkplpkpkWMKEAIPGGEKYTQI  418
            TL  LR RLA   P+LG FI   S     YSVEVGTKK P PKP+WMK  +PGG+KY  I
Sbjct  52   TLTALRERLAKGGPSLGDFITHSSTTPEGYSVEVGTKKNPKPKPEWMKMVVPGGDKYASI  111

Query  419  KKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            K KLRELKL+TVCEEA+CPN+GECW+GGETGTATATIMILGDTCTRGCRFC VKTSR
Sbjct  112  KSKLRELKLNTVCEEARCPNIGECWTGGETGTATATIMILGDTCTRGCRFCAVKTSR  168



>ref|XP_002985852.1| hypothetical protein SELMODRAFT_123090 [Selaginella moellendorffii]
 gb|EFJ13029.1| hypothetical protein SELMODRAFT_123090 [Selaginella moellendorffii]
Length=357

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNE-YSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKK  424
            L   R RLA+++P L  F+   S  E YSV VGT++ P  KP WMK  IPGGEKYT+IK 
Sbjct  18   LAAFRERLASDAPELKDFVSEGSGVEGYSVAVGTREDPRRKPDWMKRIIPGGEKYTRIKS  77

Query  425  KLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSR  589
            +LRELKL+TVCEEAKCPN+GECWSGG+TGTATATIMILGDTCTRGCRFC VKTSR
Sbjct  78   QLRELKLNTVCEEAKCPNIGECWSGGDTGTATATIMILGDTCTRGCRFCAVKTSR  132



>ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Oryza 
brachyantha]
Length=319

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  326  YSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGE  505
            YSVEVGT+KKPLPKPKWMKE IPGG KY  IK KLRELKLHTVCEEA+CPNLGECWSGGE
Sbjct  3    YSVEVGTRKKPLPKPKWMKETIPGGAKYAGIKAKLRELKLHTVCEEARCPNLGECWSGGE  62

Query  506  TGTATATIMILGDTCTRGCRFCNVKTSRT  592
            TGTATATIMILGDTCTRGCRFCNVKTSRT
Sbjct  63   TGTATATIMILGDTCTRGCRFCNVKTSRT  91



>ref|XP_011396533.1| Lipoyl synthase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM23659.1| Lipoyl synthase, mitochondrial [Auxenochlorella protothecoides]
Length=385

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            +E LR RLA E P L +F+       YSV     K+   KP W+K  +PGG KYT IK K
Sbjct  47   VEALRKRLA-EGPDLDTFVQGPDLTGYSVHAPAPKERARKPDWLKREVPGGAKYTAIKAK  105

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPD  607
            LRELKL TVCEEA+CPN+GECW G +  TATATIM++GDTCTRGCRFC VKTSR PPP D
Sbjct  106  LRELKLATVCEEARCPNIGECWGGADGHTATATIMLMGDTCTRGCRFCAVKTSRAPPPLD  165

Query  608  PNE  616
            P+E
Sbjct  166  PDE  168



>gb|KIY92220.1| lipoic acid synthetase [Monoraphidium neglectum]
Length=118

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 87/112 (78%), Gaps = 2/112 (2%)
 Frame = +2

Query  257  LRSRLAAES-PTLGSFI-GLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKL  430
            L S LAA S P LG FI G   +  YSVE  + K+   KP WMK ++PGGEKYTQIK KL
Sbjct  3    LISLLAAPSGPDLGDFITGKDLEAAYSVEAPSWKERKRKPDWMKRSVPGGEKYTQIKSKL  62

Query  431  RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTS  586
            RELKLHTVCEEA+CPN+GECW GG+  TATATIM++GDTCTRGCRFC VKTS
Sbjct  63   RELKLHTVCEEARCPNVGECWGGGDGHTATATIMLMGDTCTRGCRFCAVKTS  114



>ref|XP_001418286.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 sp|A4RZ86.1|LIAS_OSTLU RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO96579.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=399

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 88/127 (69%), Gaps = 5/127 (4%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEV--GTkkkplpkpkWMKEAIPGGEKYTQ  415
             TLEG R  L    P    F+  + D  YSV      K K   KP W+K  +PGGE+YT+
Sbjct  61   HTLEGFREALR-HGPGFDDFV--RGDVAYSVPAPKSLKDKTTRKPAWLKREVPGGERYTE  117

Query  416  IKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTP  595
            IK KLRELKL TVCEEAKCPNLGECW GG+  TATATIMI+GDTCTRGCRFC VKT++ P
Sbjct  118  IKSKLRELKLATVCEEAKCPNLGECWGGGDGKTATATIMIMGDTCTRGCRFCAVKTAKAP  177

Query  596  PPPDPNE  616
            PP D +E
Sbjct  178  PPLDKDE  184



>ref|XP_975527.1| PREDICTED: lipoyl synthase, mitochondrial [Tribolium castaneum]
 gb|EFA02475.1| hypothetical protein TcasGA2_TC008166 [Tribolium castaneum]
Length=372

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 13/135 (10%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIG-----LQSDNEYSVEVG-------TkkkplpkpkWMKEAI  391
            LE LR R+    P+L  FI      L+ D+E   +         ++   L  P W+K +I
Sbjct  26   LEALRERII-NGPSLQDFIKSPDPVLKEDSEAWKDYNGRLKRTKSESSRLRLPPWLKTSI  84

Query  392  PGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFC  571
            P G+K++++K++LR L LHTVCEEA+CPN+GECW GGE GTATATIM+LGDTCTRGCRFC
Sbjct  85   PKGKKFSELKEQLRNLNLHTVCEEARCPNIGECWGGGEHGTATATIMLLGDTCTRGCRFC  144

Query  572  NVKTSRTPPPPDPNE  616
            +VKTS+TPP PDPNE
Sbjct  145  SVKTSKTPPAPDPNE  159



>emb|CEF98458.1| Radical SAM [Ostreococcus tauri]
Length=332

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +2

Query  275  AESPTLGSFIGLQSDNEYSVEV--GTkkkplpkpkWMKEAIPGGEKYTQIKKKLRELKLH  448
            A  PT   F+  + D  Y+V      + K   KP W+K  +PGG +YT+IK KLRELKL 
Sbjct  2    ARGPTFDDFV--RGDATYAVPAPRSLRDKTTRKPTWLKREVPGGARYTEIKAKLRELKLA  59

Query  449  TVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDPNE  616
            TVCEEAKCPNLGECW GGE  TATATIMI+GDTCTRGCRFC VKTSR PPP D +E
Sbjct  60   TVCEEAKCPNLGECWGGGEGRTATATIMIMGDTCTRGCRFCAVKTSRAPPPLDKDE  115



>ref|XP_002507881.1| lipoic acid synthase [Micromonas sp. RCC299]
 gb|ACO69139.1| lipoic acid synthase [Micromonas sp. RCC299]
Length=401

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 89/126 (71%), Gaps = 9/126 (7%)
 Frame = +2

Query  257  LRSRLAAESPTLGSFIGLQSD----NEYSVEV--GTkkkplpkpkWMKEAIPGGEKYTQI  418
             R RLA E P  G F+  + D      YS+      + K + KP WMK  IPGG++YT+I
Sbjct  62   FRERLA-EGPDFGDFV--RGDELPGTAYSLAAPKNLRDKSVRKPPWMKRTIPGGDRYTEI  118

Query  419  KKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPP  598
            K KLRELKL TVCEEA+CPNLGECW GG+  TATATIMI+GDTCTR CRFC VKTS+TPP
Sbjct  119  KAKLRELKLSTVCEEARCPNLGECWGGGDGHTATATIMIMGDTCTRACRFCAVKTSKTPP  178

Query  599  PPDPNE  616
            P DP E
Sbjct  179  PLDPEE  184



>gb|EMT08295.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=470

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKK  427
            L  +R RL AE+P+LG F        YSVEVGT+ KPLPKPK MKE IPGG KY  IK K
Sbjct  50   LAEMRRRLQAETPSLGDFA-------YSVEVGTRTKPLPKPKRMKETIPGGAKYAAIKAK  102

Query  428  LRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGC  562
            LRELKLHTVCEEA+CPNLGECWSGGETGTATATIMILGDTCTRGC
Sbjct  103  LRELKLHTVCEEARCPNLGECWSGGETGTATATIMILGDTCTRGC  147



>ref|XP_005847137.1| hypothetical protein CHLNCDRAFT_24051 [Chlorella variabilis]
 gb|EFN55035.1| hypothetical protein CHLNCDRAFT_24051 [Chlorella variabilis]
Length=357

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  +PGG+ YT IK KLRELKL TVCEEAKCPNLGECW GGE   ATATIM++GDTCT
Sbjct  55   WLKRELPGGDAYTGIKSKLRELKLATVCEEAKCPNLGECWKGGEGHAATATIMLMGDTCT  114

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC VKTSR PPP DPNE
Sbjct  115  RGCRFCAVKTSRAPPPLDPNE  135



>ref|XP_007512984.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16542.1| predicted protein [Bathycoccus prasinos]
Length=447

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 8/133 (6%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFI---GLQSDNEYSVEV--GTkkkplpkpkWMKEAIPGG--  400
            Q L  LR  LA E  T+  F+    L  +NEYS       + K + KP+W+K  +PGG  
Sbjct  77   QRLAELRETLAKEDATVSDFVLGTSLSGENEYSSPAPKNMRDKTVRKPEWLKRTLPGGTE  136

Query  401  -EKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNV  577
              KY++IK +L+ELKL TVCEEAKCPNLGECW GG+  TATATIMI+GDTCTRGC+FC V
Sbjct  137  DSKYSKIKSRLKELKLSTVCEEAKCPNLGECWGGGDGHTATATIMIMGDTCTRGCKFCAV  196

Query  578  KTSRTPPPPDPNE  616
            KTS+ PPP D +E
Sbjct  197  KTSKAPPPLDKDE  209



>ref|XP_011311370.1| PREDICTED: lipoyl synthase, mitochondrial [Fopius arisanus]
Length=372

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 5/135 (4%)
 Frame = +2

Query  224  ATHQYPQTLEGLR-SRLAAESPTLGSFI---GLQSDNEYSVEVGTkkkplpkpkWMKEAI  391
            +  QY +T + +  S+  ++ P L  F+     + + +  +E G +   L  P W+K  I
Sbjct  21   SVKQYSKTTDDISFSKKLSDGPQLDDFLSGSATKYEGKLKLEKG-ETTRLRLPPWLKTEI  79

Query  392  PGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFC  571
            P GE Y++IK +LRELKL TVCEEA+CPN+GECW GG  GTATATIM++GDTCTRGCRFC
Sbjct  80   PMGENYSRIKSQLRELKLATVCEEARCPNIGECWGGGAHGTATATIMLMGDTCTRGCRFC  139

Query  572  NVKTSRTPPPPDPNE  616
            ++KT+RTPP  DPNE
Sbjct  140  SIKTARTPPALDPNE  154



>ref|XP_006922504.1| PREDICTED: lipoyl synthase, mitochondrial [Pteropus alecto]
 ref|XP_011361043.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Pteropus 
vampyrus]
Length=368

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++KK LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  75   WLKTEIPMGKNYNKLKKTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  134

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPPPD NE
Sbjct  135  RGCRFCSVKTARKPPPPDANE  155



>ref|XP_001354122.1| GA18753 [Drosophila pseudoobscura pseudoobscura]
 sp|Q2LYK1.1|LIAS_DROPS RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila pseudoobscura 
pseudoobscura]
 gb|EAL29861.1| GA18753 [Drosophila pseudoobscura pseudoobscura]
Length=374

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 11/134 (8%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFI---------GLQSDNEYSVEVGTkkkplpkpkWMKEAIP  394
            + LE +R RLA + P    F+         G   D +   E G +++ L  P W+K  IP
Sbjct  23   KKLEEIRERLA-KGPNFQDFVQNPDNLKSVGENYDGKLRREKG-EEQRLRLPPWLKTTIP  80

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G+ YT+IK++LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  81   MGKNYTKIKEQLRELKLSTVCEEARCPNIGECWGGGENGTQTATIMLMGDTCTRGCRFCS  140

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP D NE
Sbjct  141  VKTARIPPPLDENE  154



>ref|XP_002028324.1| GL11904 [Drosophila persimilis]
 gb|EDW39539.1| GL11904 [Drosophila persimilis]
Length=350

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 11/134 (8%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFI---------GLQSDNEYSVEVGTkkkplpkpkWMKEAIP  394
            + LE +R RLA + P    F+         G   D +   E G +++ L  P W+K  IP
Sbjct  23   KKLEEIRERLA-KGPNFQDFVQNPDNLKNVGENYDGKLRREKG-EEQRLRLPPWLKTTIP  80

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G+ YT+IK++LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  81   MGKNYTKIKEQLRELKLSTVCEEARCPNIGECWGGGENGTQTATIMLMGDTCTRGCRFCS  140

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP D NE
Sbjct  141  VKTARIPPPLDENE  154



>ref|XP_003079989.1| lipoic acid synthase (ISS) [Ostreococcus tauri]
Length=826

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  +PGG +YT+IK KLRELKL TVCEEAKCPNLGECW GGE  TATATIMI+GDTCT
Sbjct  529  WLKREVPGGARYTEIKAKLRELKLATVCEEAKCPNLGECWGGGEGRTATATIMIMGDTCT  588

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC VKTSR PPP D +E
Sbjct  589  RGCRFCAVKTSRAPPPLDKDE  609



>gb|ACZ26290.1| putative lipoic acid synthetase [Mayetiola destructor]
Length=370

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 91/134 (68%), Gaps = 11/134 (8%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDN------EYSVEVGTkkkplpkpk---WMKEAIP  394
            +TLE +R RLA   P    F+   +DN      EY  ++   K    + +   W+K+ IP
Sbjct  19   KTLEKIRERLA-NGPNFQEFVQ-DTDNIAENWPEYDGKLKRDKGDEKRLRLPPWLKKEIP  76

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G  + +IK +LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  77   IGANFNKIKSQLRELKLATVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCS  136

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP DPNE
Sbjct  137  VKTARQPPPLDPNE  150



>ref|XP_011361042.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Pteropus 
vampyrus]
Length=383

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++KK LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  90   WLKTEIPMGKNYNKLKKTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  149

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPPPD NE
Sbjct  150  RGCRFCSVKTARKPPPPDANE  170



>gb|ETN62407.1| lipoic acid synthetase [Anopheles darlingi]
Length=408

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ +T+IK++LRELKL TVCEEAKCPN+GECW GGE GT TATIM++GDTCT
Sbjct  94   WLKTKIPMGKNFTRIKEQLRELKLATVCEEAKCPNIGECWGGGEHGTQTATIMLMGDTCT  153

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  154  RGCRFCSVKTARAPPPLDPDE  174



>ref|XP_001702321.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
 sp|A8JGF7.1|LIAS_CHLRE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|EDO97051.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
Length=318

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  380  KEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRG  559
            +  +PGG+KYT+IK KLRELKL TVCEEA+CPNLGECW GG+  TATATIM++GDTCTRG
Sbjct  3    RNKLPGGDKYTEIKAKLRELKLSTVCEEARCPNLGECWGGGDGHTATATIMLMGDTCTRG  62

Query  560  CRFCNVKTSRTPPPPDPNE  616
            C+FC VKTS+ PPP DP+E
Sbjct  63   CKFCAVKTSKAPPPLDPHE  81



>ref|XP_006787315.1| PREDICTED: lipoyl synthase, mitochondrial-like [Neolamprologus 
brichardi]
Length=385

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 90/137 (66%), Gaps = 6/137 (4%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIG--LQSDNEYSVEVGTkkkplpkpk----WMKE  385
            +T   P+  +  +  L  + P L  FI   L   N+++   GT K+   +      W+K 
Sbjct  35   STRASPERSDRKKELLRDDGPDLQDFISGELSEKNKWAEYKGTLKRQKGERLRLPPWLKT  94

Query  386  AIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR  565
             IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCTRGCR
Sbjct  95   EIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCR  154

Query  566  FCNVKTSRTPPPPDPNE  616
            FC+VKT+R PPP DP+E
Sbjct  155  FCSVKTARQPPPLDPDE  171



>ref|XP_314540.4| AGAP010568-PA [Anopheles gambiae str. PEST]
 gb|EAA09970.4| AGAP010568-PA [Anopheles gambiae str. PEST]
Length=400

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ +T+IK++LRELKL TVCEEAKCPN+GECW GGE GT TATIM++GDTCT
Sbjct  88   WLKTKIPMGKDFTRIKEQLRELKLATVCEEAKCPNIGECWGGGEHGTQTATIMLMGDTCT  147

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  148  RGCRFCSVKTARAPPPLDPAE  168



>ref|XP_010866875.1| PREDICTED: lipoyl synthase, mitochondrial [Esox lucius]
Length=387

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE GTATATIM++GDTCT
Sbjct  93   WLKTEIPIGKNYNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEHGTATATIMLMGDTCT  152

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  153  RGCRFCSVKTARRPPPLDPDE  173



>ref|XP_004065786.1| PREDICTED: lipoyl synthase, mitochondrial [Oryzias latipes]
Length=390

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y Q+K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  94   WLKTEIPIGKNYNQLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  153

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  154  RGCRFCSVKTARQPPPLDPDE  174



>ref|XP_002065849.1| GK17689 [Drosophila willistoni]
 sp|B4MXR6.1|LIAS_DROWI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila willistoni]
 gb|EDW76835.1| GK17689 [Drosophila willistoni]
Length=372

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 9/133 (7%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSD--NEYSVEVGTkkkplpkpk------WMKEAIPG  397
            + L+ +R RLA + P+   FI   ++  NE+    G  ++   + +      W+K  IP 
Sbjct  25   EKLDEIRERLA-KGPSFQDFIQNPNNTKNEWDNYDGKLRREKVEEQRLRLPPWLKTTIPM  83

Query  398  GEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNV  577
            G+ Y +IK +LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+V
Sbjct  84   GKNYAKIKDQLRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCSV  143

Query  578  KTSRTPPPPDPNE  616
            KT+R PPP D NE
Sbjct  144  KTARAPPPLDENE  156



>gb|KFB38613.1| AGAP010568-PA-like protein [Anopheles sinensis]
Length=421

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ +T+IK++LRELKL TVCEEAKCPN+GECW GGE GT TATIM++GDTCT
Sbjct  110  WLKTKIPMGKNFTRIKEQLRELKLATVCEEAKCPNIGECWGGGEHGTQTATIMLMGDTCT  169

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  170  RGCRFCSVKTARVPPPLDPAE  190



>ref|XP_007243627.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Astyanax 
mexicanus]
Length=308

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  77   WLKTEIPIGKNYNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  136

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC++KT+R PPP DP+E
Sbjct  137  RGCRFCSIKTARNPPPLDPDE  157



>ref|NP_001103871.1| lipoyl synthase, mitochondrial [Danio rerio]
 gb|AAI54782.1| Zgc:66080 protein [Danio rerio]
Length=397

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LREL LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  99   WLKTEIPIGKNYNKLKNTLRELNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  158

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  159  RGCRFCSVKTARRPPPLDPDE  179



>sp|Q6PHG4.1|LIAS_DANRE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Danio rerio]
 gb|AAH56561.1| Zgc:66080 [Danio rerio]
Length=399

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LREL LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  101  WLKTEIPIGKNYNKLKNTLRELNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  160

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  161  RGCRFCSVKTARRPPPLDPDE  181



>gb|EPY49264.1| lipoic acid synthetase [Schizosaccharomyces cryophilus OY26]
Length=371

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 8/122 (7%)
 Frame = +2

Query  275  AESPTLGSFIGLQS--------DNEYSVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKL  430
            A+ PT   F+ L+         + +  VE+         P W+K  +P G  +T+IK  L
Sbjct  33   AKGPTFSDFLNLEKPLNGEEAFELDRKVELPNGAVHKRLPSWLKTKVPLGSNFTKIKNDL  92

Query  431  RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDP  610
            R L LHTVCEEAKCPN+GECW G +   ATATIM++GDTCTRGCRFC+VKTSR PPP DP
Sbjct  93   RGLNLHTVCEEAKCPNIGECWGGKDKSQATATIMLMGDTCTRGCRFCSVKTSRRPPPLDP  152

Query  611  NE  616
            NE
Sbjct  153  NE  154



>ref|XP_010115912.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Chlamydotis 
macqueenii]
Length=168

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  124  RGCRFCSVKTARNPPPLDPEE  144



>ref|NP_001085534.1| lipoyl synthase, mitochondrial [Xenopus laevis]
 sp|Q6GQ48.1|LIAS_XENLA RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Xenopus laevis]
 gb|AAH72900.1| MGC80349 protein [Xenopus laevis]
Length=372

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE GTATATIM++GDTCT
Sbjct  79   WVKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  139  RGCRFCSVKTARNPPPLDPDE  159



>ref|XP_010740107.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Larimichthys 
crocea]
Length=202

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  98   WLKTEIPIGKNYNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  157

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC++KT+R PPP DP+E
Sbjct  158  RGCRFCSIKTARKPPPLDPDE  178



>gb|EDL90063.1| rCG57017 [Rattus norvegicus]
Length=218

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  78   WLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  137

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  138  RGCRFCSVKTARNPPPLDPSE  158



>gb|KFH64353.1| lipoic acid synthetase [Mortierella verticillata NRRL 6337]
Length=425

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K AIP G+ YTQIKK LRELKLHTVCEEAKCPN+ +CW GGE  TATATIM++GD CT
Sbjct  114  WLKTAIPVGKNYTQIKKNLRELKLHTVCEEAKCPNISDCWGGGEHQTATATIMLMGDECT  173

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKTS+ P P D +E
Sbjct  174  RGCRFCSVKTSKAPKPLDIHE  194



>ref|XP_001845830.1| lipoic acid synthase [Culex quinquefasciatus]
 sp|B0WAU6.1|LIAS_CULQU RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Culex quinquefasciatus]
 gb|EDS41812.1| lipoic acid synthase [Culex quinquefasciatus]
Length=380

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ +++IK +LRELKL TVCEEAKCPN+GECW GGE GT TATIM++GDTCT
Sbjct  77   WLKTKIPMGKNFSRIKDQLRELKLATVCEEAKCPNIGECWGGGEHGTQTATIMLMGDTCT  136

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  137  RGCRFCSVKTARAPPPLDPDE  157



>gb|KDD75330.1| hypothetical protein H632_c740p1 [Helicosporidium sp. ATCC 50920]
Length=375

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNE---YSVEVGTkkkplpkpkWMKEAIP  394
            +T Q    +  LR RLA+  P+   F+     +    YSV     K+ + KP W+K  +P
Sbjct  29   STSQRTAAVASLRERLAS-GPSFEDFVSSSPTSPASAYSVYAPKPKERMRKPDWLKREVP  87

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
            GGEKYT IK +LREL L TVCEEA+CPN+GECW G +  TATATIM++GDTCTRGCRFC 
Sbjct  88   GGEKYTAIKGRLRELGLSTVCEEARCPNIGECWGGADGHTATATIMLMGDTCTRGCRFCA  147

Query  575  VKTSRTPPPPDPNE  616
            VKTS+ PP  D  E
Sbjct  148  VKTSKAPPALDQQE  161



>ref|NP_001011234.1| lipoyl synthase, mitochondrial [Xenopus (Silurana) tropicalis]
 gb|AAH87803.1| lipoic acid synthetase [Xenopus (Silurana) tropicalis]
Length=327

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W++  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE GTATATIM++GDTCT
Sbjct  79   WVRTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  139  RGCRFCSVKTARNPPPLDPDE  159



>ref|XP_006189038.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Camelus 
ferus]
 ref|XP_010960961.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Camelus 
bactrianus]
Length=329

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_010978684.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Camelus 
dromedarius]
Length=329

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_002426395.1| lipoic acid synthetase, putative [Pediculus humanus corporis]
 gb|EEB13657.1| lipoic acid synthetase, putative [Pediculus humanus corporis]
Length=495

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +2

Query  275  AESPTLGSFIGLQSDN--EYSVEVGTkkkplpkpk---WMKEAIPGGEKYTQIKKKLREL  439
            AE P L  F+  QS +  +Y+ ++  +K  L + +   W+K  IP GE ++++K +LR L
Sbjct  165  AEGPQLDHFLEQQSKDWSDYTGDLKKEKGELKRLRLPPWLKTKIPTGENFSKLKTQLRNL  224

Query  440  KLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDPNE  616
             LHTVCEEA+CPN+GECW GG+ GTATATIM++GDTCTRGCRFC+VKTSR PPP +P E
Sbjct  225  NLHTVCEEARCPNIGECWGGGKYGTATATIMLMGDTCTRGCRFCSVKTSRAPPPLNPLE  283



>ref|XP_004910979.1| PREDICTED: lipoyl synthase, mitochondrial-like [Xenopus (Silurana) 
tropicalis]
Length=372

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W++  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE GTATATIM++GDTCT
Sbjct  79   WVRTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  139  RGCRFCSVKTARNPPPLDPDE  159



>ref|XP_006029302.1| PREDICTED: lipoyl synthase, mitochondrial [Alligator sinensis]
Length=363

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  70   WLKTEIPMGKNYNKLKSTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  129

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+++PPP DPNE
Sbjct  130  RGCRFCSVKTAKSPPPLDPNE  150



>gb|KDD75287.1| hypothetical protein H632_c764p1 [Helicosporidium sp. ATCC 50920]
Length=385

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIGLQSDNE---YSVEVGTkkkplpkpkWMKEAIP  394
            +T Q    +  LR RLA+  P+   F+     +    YSV     K+ + KP W+K  +P
Sbjct  29   STSQRTAAVASLRERLAS-GPSFEDFVSSSPTSPASAYSVYAPKPKERMRKPDWLKREVP  87

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
            GGEKYT IK +LREL L TVCEEA+CPN+GECW G +  TATATIM++GDTCTRGCRFC 
Sbjct  88   GGEKYTAIKGRLRELGLSTVCEEARCPNIGECWGGADGHTATATIMLMGDTCTRGCRFCA  147

Query  575  VKTSRTPPPPDPNE  616
            VKTS+ PP  D  E
Sbjct  148  VKTSKAPPALDQQE  161



>emb|CDH58810.1| lipoic acid synthetase precursor [Lichtheimia corymbifera JMRC:FSU:9682]
Length=410

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 85/139 (61%), Gaps = 16/139 (12%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYS-----------VEVGTkkkplpkpk-----WM  379
            L  LR RLAAE   +  F+   S  + S           VE G + K     +     W+
Sbjct  48   LTQLRERLAAEDAAIDEFVNTGSTGKLSPEEALELKETVVEAGKQVKTKKLKQPRLPEWL  107

Query  380  KEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRG  559
            K  IP G  Y +IKK LR LKLHTVCEEA+CPN+ +CW GGE  TATATIM++GD CTRG
Sbjct  108  KTDIPAGGNYARIKKDLRGLKLHTVCEEARCPNISDCWGGGEHQTATATIMLMGDECTRG  167

Query  560  CRFCNVKTSRTPPPPDPNE  616
            CRFC+VKT+R P P DP+E
Sbjct  168  CRFCSVKTNRNPAPLDPHE  186



>ref|XP_001659989.1| AAEL009368-PA [Aedes aegypti]
 sp|Q16W22.1|LIAS_AEDAE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Aedes aegypti]
 gb|EAT38774.1| AAEL009368-PA [Aedes aegypti]
Length=393

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ +++IK +LRELKL TVCEEAKCPN+GECW GGE GT TATIM++GDTCT
Sbjct  84   WLKTKIPMGKNFSRIKDQLRELKLATVCEEAKCPNIGECWGGGEHGTQTATIMLMGDTCT  143

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  144  RGCRFCSVKTARVPPPLDPAE  164



>gb|KFV02172.1| hypothetical protein N340_11963, partial [Tauraco erythrolophus]
Length=217

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPQE  130



>ref|XP_004927741.1| PREDICTED: lipoyl synthase, mitochondrial-like [Bombyx mori]
Length=366

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 7/135 (5%)
 Frame = +2

Query  230  HQYPQTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpk------WMKEAI  391
            +++   L+ +R +L  E P L  FI       +    G  K+   + +      W+K  I
Sbjct  20   YKHSNKLDAIREKLK-EGPNLTDFISEDRPKNWDEYQGKLKREKGESERLRLPPWLKTTI  78

Query  392  PGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFC  571
            P G K+ +IK++LR LKL TVCEEA+CPN+GECWSGG+ G +TATIM++GDTCTRGC FC
Sbjct  79   PTGSKFNEIKQQLRSLKLSTVCEEARCPNIGECWSGGKHGASTATIMLMGDTCTRGCMFC  138

Query  572  NVKTSRTPPPPDPNE  616
            +VKTSR PPP DP E
Sbjct  139  SVKTSRNPPPLDPEE  153



>ref|XP_006759354.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Myotis 
davidii]
Length=203

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDANE  159



>ref|XP_009984989.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Tauraco 
erythrolophus]
Length=231

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPQE  144



>ref|XP_001957274.1| GF24134 [Drosophila ananassae]
 sp|B3M996.1|LIAS_DROAN RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila ananassae]
 gb|EDV40080.1| GF24134 [Drosophila ananassae]
Length=376

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y +IK +LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCT
Sbjct  76   WLKTTIPMGKNYAKIKNQLRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCT  135

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  136  RGCRFCSVKTARKPPPLDENE  156



>gb|KFP47920.1| hypothetical protein N323_05733, partial [Cathartes aura]
Length=217

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>ref|XP_004514720.1| PREDICTED: lipoyl synthase 2, chloroplastic-like [Cicer arietinum]
Length=385

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+++  P GE+++QIK+ + +LKL+TVCEEA+CPN+GECW+GG+ G ATATIM+LGDTCT
Sbjct  88   WLRQKAPQGERFSQIKESISQLKLNTVCEEAQCPNIGECWNGGDDGIATATIMVLGDTCT  147

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC VKTSR P PPDP E
Sbjct  148  RGCRFCAVKTSRNPAPPDPME  168



>ref|XP_007426517.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Python 
bivittatus]
Length=269

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  102  WLKTEIPIGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  161

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKTSR+PPP DP E
Sbjct  162  RGCRFCSVKTSRSPPPLDPEE  182



>gb|KFQ68761.1| hypothetical protein N335_00414, partial [Phaethon lepturus]
Length=217

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>ref|XP_008947334.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Merops 
nubicus]
Length=168

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTEIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKAPPPLDPEE  144



>gb|KFP76616.1| hypothetical protein N311_03530, partial [Apaloderma vittatum]
Length=217

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>gb|KFQ43558.1| hypothetical protein N333_12244, partial [Nestor notabilis]
Length=212

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  45   WLKTEIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  104

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  105  RGCRFCSVKTAKNPPPLDPEE  125



>ref|XP_010776311.1| PREDICTED: lipoyl synthase, mitochondrial [Notothenia coriiceps]
Length=389

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ + ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  93   WLKTEIPIGKNFNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEYNTATATIMLMGDTCT  152

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DPNE
Sbjct  153  RGCRFCSVKTARRPPPLDPNE  173



>ref|XP_006189037.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
ferus]
 ref|XP_010960960.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
bactrianus]
Length=372

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_008410916.1| PREDICTED: lipoyl synthase, mitochondrial [Poecilia reticulata]
Length=392

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  93   WLKTEIPIGKNYNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  152

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  153  RGCRFCSVKTARQPPPLDPDE  173



>ref|XP_001605463.2| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Nasonia 
vitripennis]
Length=378

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y++IK +LR+L+L TVCEEA+CPN+GECW GG  GTATATIM++GDTCT
Sbjct  81   WLKTQIPMGKNYSRIKSQLRDLRLSTVCEEARCPNIGECWGGGAHGTATATIMLMGDTCT  140

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  141  RGCRFCSVKTARAPPPLDPEE  161



>gb|KFO05702.1| hypothetical protein N312_00096, partial [Balearica regulorum 
gibbericeps]
Length=216

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  49   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  108

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+++PPP DP E
Sbjct  109  RGCRFCSVKTAKSPPPLDPQE  129



>ref|XP_010978683.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
dromedarius]
Length=372

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_008315124.1| PREDICTED: lipoyl synthase, mitochondrial [Cynoglossus semilaevis]
Length=413

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  117  WLKTEIPIGKNYNKLKNTLRDLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  176

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  177  RGCRFCSVKTARRPPPLDPDE  197



>gb|KFU95968.1| hypothetical protein M959_04245, partial [Chaetura pelagica]
Length=343

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K +IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTSIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  110  RGCRFCSVKTARNPPPLDPEE  130



>ref|XP_006220318.1| PREDICTED: LOW QUALITY PROTEIN: lipoic acid synthetase [Vicugna 
pacos]
Length=372

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_010305218.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Balearica 
regulorum gibbericeps]
Length=231

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+++PPP DP E
Sbjct  124  RGCRFCSVKTAKSPPPLDPQE  144



>ref|XP_005807826.1| PREDICTED: lipoyl synthase, mitochondrial-like [Xiphophorus maculatus]
Length=392

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  93   WLKTEIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  152

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  153  RGCRFCSVKTARQPPPLDPDE  173



>ref|XP_007551988.1| PREDICTED: lipoyl synthase, mitochondrial [Poecilia formosa]
Length=393

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  93   WLKTEIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  152

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  153  RGCRFCSVKTARQPPPLDPDE  173



>ref|XP_009068856.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Acanthisitta 
chloris]
Length=230

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPQE  144



>ref|XP_001984904.1| GH16746 [Drosophila grimshawi]
 sp|B4J3F3.1|LIAS_DROGR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila grimshawi]
 gb|EDV97252.1| GH16746 [Drosophila grimshawi]
Length=364

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y +IK +LR+LKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCT
Sbjct  72   WLKTTIPMGKNYAKIKSQLRDLKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCT  131

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  132  RGCRFCSVKTARAPPPLDVNE  152



>ref|XP_010293387.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Phaethon 
lepturus]
Length=230

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPKE  144



>ref|XP_009868761.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Apaloderma 
vittatum]
Length=231

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPEE  144



>ref|XP_003062162.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH53874.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  377  MKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTR  556
            +K  IP G++Y +IK KLREL L TVCEEAKCPNLGECW GGE  TATATIMI+GDTCTR
Sbjct  4    LKRTIPSGDRYVEIKSKLRELNLSTVCEEAKCPNLGECWGGGEGQTATATIMIMGDTCTR  63

Query  557  GCRFCNVKTSRTPPPPDPNE  616
             CRFC VKTSR PPP D +E
Sbjct  64   ACRFCAVKTSRAPPPLDADE  83



>ref|XP_008546620.1| PREDICTED: lipoyl synthase, mitochondrial [Microplitis demolitor]
 gb|EZA46320.1| Lipoyl synthase, mitochondrial [Microplitis demolitor]
Length=366

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP GE Y Q+K +LRE KL TVCEEA+CPN+GECW GGE GT+TATIM++GDTCT
Sbjct  70   WLKREIPMGENYAQLKSQLRESKLATVCEEARCPNIGECWGGGEHGTSTATIMLMGDTCT  129

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC++KT+R PPP +P E
Sbjct  130  RGCRFCSIKTARAPPPLNPEE  150



>gb|KFV93025.1| hypothetical protein N327_00292, partial [Fulmarus glacialis]
Length=174

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>gb|KFP94414.1| hypothetical protein N329_11295, partial [Haliaeetus albicilla]
Length=212

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  45   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  104

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  105  RGCRFCSVKTAKNPPPLDPKE  125



>ref|XP_003452182.2| PREDICTED: lipoyl synthase, mitochondrial-like [Oreochromis niloticus]
Length=410

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 6/137 (4%)
 Frame = +2

Query  224  ATHQYPQTLEGLRSRLAAESPTLGSFIG--LQSDNEYSVEVGTkkkplpkpk----WMKE  385
            +T   P+  +  +  L  + P L  FI   L   ++++   GT K+   +      W+K 
Sbjct  60   STRSSPERSDRKKELLRDDGPDLQDFISGELSEKSKWAEYKGTLKRQKGERLRLPPWLKT  119

Query  386  AIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCR  565
             IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCTRGCR
Sbjct  120  EIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCR  179

Query  566  FCNVKTSRTPPPPDPNE  616
            FC+VKT+R PPP DP+E
Sbjct  180  FCSVKTARQPPPLDPDE  196



>ref|XP_003424380.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Nasonia 
vitripennis]
Length=372

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y++IK +LR+L+L TVCEEA+CPN+GECW GG  GTATATIM++GDTCT
Sbjct  75   WLKTQIPMGKNYSRIKSQLRDLRLSTVCEEARCPNIGECWGGGAHGTATATIMLMGDTCT  134

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  135  RGCRFCSVKTARAPPPLDPEE  155



>ref|XP_009918808.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Haliaeetus 
albicilla]
Length=231

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPKE  144



>gb|KFQ76339.1| hypothetical protein N337_00646, partial [Phoenicopterus ruber 
ruber]
Length=217

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPQE  130



>gb|KFW97292.1| hypothetical protein N336_07982, partial [Phalacrocorax carbo]
Length=217

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>ref|XP_010019608.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Nestor 
notabilis]
Length=244

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  77   WLKTEIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  136

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  137  RGCRFCSVKTAKNPPPLDPEE  157



>gb|KFP69827.1| hypothetical protein N310_04898, partial [Acanthisitta chloris]
Length=217

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPQE  130



>gb|KFP59442.1| hypothetical protein N322_11033, partial [Cariama cristata]
Length=217

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>ref|XP_006258548.1| PREDICTED: lipoyl synthase, mitochondrial [Alligator mississippiensis]
Length=416

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  123  WLKTEIPMGKNYNKLKSTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  182

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+++PPP DPNE
Sbjct  183  RGCRFCSVKTAKSPPPLDPNE  203



>gb|EPX74142.1| lipoic acid synthetase [Schizosaccharomyces octosporus yFS286]
Length=371

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 77/122 (63%), Gaps = 8/122 (7%)
 Frame = +2

Query  275  AESPTLGSFIG----LQSDNEY----SVEVGTkkkplpkpkWMKEAIPGGEKYTQIKKKL  430
            A  P+   FI     L  +  Y     VE+         P W+K  +P G  +T+IK  L
Sbjct  33   ANGPSFADFINSEKPLSGEEAYELDRKVELPNGTVHKRLPSWLKTKVPLGSNFTKIKNDL  92

Query  431  RELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDP  610
            R L LHTVCEEAKCPN+GECW G +   ATATIM++GDTCTRGCRFC+VKTSR PPP DP
Sbjct  93   RGLNLHTVCEEAKCPNIGECWGGKDKSQATATIMLMGDTCTRGCRFCSVKTSRRPPPLDP  152

Query  611  NE  616
            NE
Sbjct  153  NE  154



>emb|CDS10851.1| Putative Lipoyl synthase, mitochondrial [Absidia idahoensis var. 
thermophila]
Length=410

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 84/139 (60%), Gaps = 16/139 (12%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSD-----------NEYSVEVGTkkkplpkpk-----WM  379
            L  LR RLAAE   +  F+   S             E  VE G + K     +     W+
Sbjct  48   LTQLRERLAAEDAAIDEFVNTGSTGKLTPEEALELKETVVEAGKQVKTKKLKQPRLPDWL  107

Query  380  KEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRG  559
            K  IP G  Y +IKK LR LKLHTVCEEA+CPN+ +CW GGE  TATATIM++GD CTRG
Sbjct  108  KTDIPAGGNYARIKKDLRGLKLHTVCEEARCPNISDCWGGGEHQTATATIMLMGDECTRG  167

Query  560  CRFCNVKTSRTPPPPDPNE  616
            CRFC+VKT+R P P DP+E
Sbjct  168  CRFCSVKTNRNPAPLDPHE  186



>gb|KFZ52696.1| hypothetical protein N338_05233, partial [Podiceps cristatus]
Length=217

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>gb|KFV40153.1| hypothetical protein N341_10722, partial [Tyto alba]
Length=217

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>gb|KFP96037.1| hypothetical protein N330_00400, partial [Leptosomus discolor]
Length=217

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPTE  130



>ref|XP_009510363.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Phalacrocorax 
carbo]
Length=231

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPKE  144



>ref|XP_009701528.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Cariama cristata]
Length=231

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPKE  144



>ref|XP_009577332.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03123}-like, 
partial [Fulmarus glacialis]
Length=184

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  61   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  120

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  121  RGCRFCSVKTAKNPPPLDPKE  141



>ref|XP_006066203.1| PREDICTED: lipoyl synthase, mitochondrial isoform X3 [Bubalus 
bubalis]
Length=248

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|NP_001012037.1| lipoyl synthase, mitochondrial precursor [Rattus norvegicus]
 sp|Q5XIH4.1|LIAS_RAT RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Rattus norvegicus]
 gb|AAH83708.1| Lipoic acid synthetase [Rattus norvegicus]
Length=373

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  78   WLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  137

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  138  RGCRFCSVKTARNPPPLDPSE  158



>ref|XP_002609221.1| hypothetical protein BRAFLDRAFT_125969 [Branchiostoma floridae]
 sp|C3Y3G4.1|LIAS_BRAFL RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Branchiostoma floridae]
 gb|EEN65231.1| hypothetical protein BRAFLDRAFT_125969 [Branchiostoma floridae]
Length=376

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K+ IP G+ Y  +K  LREL L TVCEEAKCPN+GECW GGE  TATATIM++GDTCT
Sbjct  75   WLKKEIPIGKNYHSLKGTLRELNLATVCEEAKCPNIGECWGGGEDKTATATIMVMGDTCT  134

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R+PPP DPNE
Sbjct  135  RGCRFCSVKTARSPPPLDPNE  155



>gb|KFZ46233.1| hypothetical protein N321_00411, partial [Caprimulgus carolinensis]
Length=217

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKKPPPLDPKE  130



>gb|KFV41089.1| hypothetical protein N328_11580, partial [Gavia stellata]
Length=217

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPIGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPKE  130



>ref|XP_004564359.1| PREDICTED: lipoyl synthase, mitochondrial-like [Maylandia zebra]
 ref|XP_005928364.1| PREDICTED: lipoyl synthase, mitochondrial-like [Haplochromis 
burtoni]
Length=385

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  91   WLKTEIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  150

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  151  RGCRFCSVKTARQPPPLDPDE  171



>ref|XP_005741202.1| PREDICTED: lipoyl synthase, mitochondrial-like [Pundamilia nyererei]
Length=385

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  91   WLKTEIPIGKNYNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  150

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP+E
Sbjct  151  RGCRFCSVKTARQPPPLDPDE  171



>ref|NP_524183.2| lipoic acid synthase [Drosophila melanogaster]
 sp|Q7JQW6.2|LIAS_DROME RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila melanogaster]
 gb|AAF51596.2| lipoic acid synthase [Drosophila melanogaster]
Length=377

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 11/134 (8%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIG---------LQSDNEYSVEVGTkkkplpkpkWMKEAIP  394
            + LE +R RLA + P    F+           Q D +   E G +++ L  P W+K  IP
Sbjct  25   EKLEEIRERLA-KGPNFHDFVQNPDNTRNEWEQYDGKLRREKG-EEQRLRLPPWLKTTIP  82

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  83   VGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCS  142

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP D NE
Sbjct  143  VKTARKPPPLDVNE  156



>gb|AAL13786.1| LD24887p [Drosophila melanogaster]
 gb|AAO41414.1| RH26374p [Drosophila melanogaster]
 gb|ACL89904.1| Las-PC [synthetic construct]
Length=380

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 9/133 (7%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSD--NEYSVEVGTkkkplpkpk------WMKEAIPG  397
            + LE +R RLA + P    F+    +  NE+    G  ++   + +      W+K  IP 
Sbjct  28   EKLEEIRERLA-KGPNFHDFVQNPDNTRNEWEQYDGKLRREKGEEQRLRLPPWLKTTIPV  86

Query  398  GEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNV  577
            G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+V
Sbjct  87   GKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCSV  146

Query  578  KTSRTPPPPDPNE  616
            KT+R PPP D NE
Sbjct  147  KTARKPPPLDVNE  159



>ref|XP_009958190.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Leptosomus 
discolor]
Length=231

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPTE  144



>gb|EHJ72263.1| hypothetical protein KGM_05108 [Danaus plexippus]
Length=366

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G K++++K +LR L L TVCEEA+CPN+GECWSGG+ GT+TATIM++GDTCT
Sbjct  73   WLKTTIPTGSKFSELKAQLRSLNLSTVCEEARCPNIGECWSGGKNGTSTATIMLMGDTCT  132

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGC FC+VKTSR PPP DPNE
Sbjct  133  RGCMFCSVKTSRAPPPLDPNE  153



>gb|KFP25007.1| hypothetical protein N325_00240, partial [Colius striatus]
Length=217

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTNIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>ref|XP_006759353.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Myotis 
davidii]
Length=248

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDANE  159



>ref|XP_002040667.1| GM22215 [Drosophila sechellia]
 sp|B4IAA7.1|LIAS_DROSE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila sechellia]
 gb|EDW44220.1| GM22215 [Drosophila sechellia]
Length=377

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 11/134 (8%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIG---------LQSDNEYSVEVGTkkkplpkpkWMKEAIP  394
            + LE +R RLA + P    F+           Q D +   E G +++ L  P W+K  IP
Sbjct  25   EKLEEIRERLA-KGPNFQDFVQNPDNTRSEWEQYDGKLRREKG-EEQRLRLPPWLKTTIP  82

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  83   VGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCS  142

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP D NE
Sbjct  143  VKTARKPPPLDVNE  156



>ref|XP_009805881.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Gavia stellata]
Length=230

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPIGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPKE  144



>gb|AAI12632.1| LIAS protein [Bos taurus]
Length=298

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_005897413.1| PREDICTED: lipoyl synthase, mitochondrial isoform X3 [Bos mutus]
Length=322

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_002086625.1| GE22745 [Drosophila yakuba]
 sp|B4IUG3.1|LIAS1_DROYA RecName: Full=Lipoyl synthase 1, mitochondrial; AltName: Full=Lipoate 
synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoic 
acid synthase 1; Flags: Precursor [Drosophila yakuba]
 gb|EDX00027.1| GE22745 [Drosophila yakuba]
Length=379

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCT
Sbjct  79   WLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDVNE  159



>ref|XP_010197083.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Colius striatus]
Length=231

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTNIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKNPPPLDPEE  144



>ref|XP_002095457.1| GE22400 [Drosophila yakuba]
 sp|B4PF83.1|LIAS2_DROYA RecName: Full=Lipoyl synthase 2, mitochondrial; AltName: Full=Lipoate 
synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoic 
acid synthase 2; Flags: Precursor [Drosophila yakuba]
 gb|EDW95169.1| GE22400 [Drosophila yakuba]
Length=379

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCT
Sbjct  79   WLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDVNE  159



>ref|XP_007522861.1| PREDICTED: lipoyl synthase, mitochondrial [Erinaceus europaeus]
Length=372

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPLGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D NE
Sbjct  139  RGCRFCSVKTARTPPPLDANE  159



>ref|XP_007670123.1| PREDICTED: lipoyl synthase, mitochondrial [Ornithorhynchus anatinus]
Length=391

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  90   WLKTEIPIGKNYNKLKSSLRNLNLHTVCEEARCPNIGECWGGGENATATATIMLMGDTCT  149

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  150  RGCRFCSVKTARNPPPLDPEE  170



>ref|XP_010004454.1| PREDICTED: lipoyl synthase, mitochondrial [Chaetura pelagica]
Length=392

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K +IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  99   WLKTSIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  158

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP DP E
Sbjct  159  RGCRFCSVKTARNPPPLDPEE  179



>ref|XP_005651902.1| lipoic acid synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE27358.1| lipoic acid synthetase [Coccomyxa subellipsoidea C-169]
Length=314

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  +PGG+KYT+IK KLRELKLHTVCEEA+CPN+GECW GG+  TATATIM++GDTCT
Sbjct  17   WLKRTVPGGDKYTEIKAKLRELKLHTVCEEARCPNIGECWGGGDGHTATATIMLMGDTCT  76

Query  554  RGCRFCNVKTSR  589
            RGCRFC VKTS+
Sbjct  77   RGCRFCAVKTSK  88



>ref|XP_005897412.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Bos mutus]
Length=329

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_010161680.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Caprimulgus 
carolinensis]
Length=231

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  124  RGCRFCSVKTAKKPPPLDPKE  144



>emb|CAF94211.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=336

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 84/125 (67%), Gaps = 6/125 (5%)
 Frame = +2

Query  260  RSRLAAESPTLGSFIG--LQSDNEYSVEVGTkkkplpkpk----WMKEAIPGGEKYTQIK  421
            R  L  + P L  FI   L   ++++   GT ++   +      W+K  IP G+ Y ++K
Sbjct  10   RGDLGDDGPDLQDFISGDLSEKSKWAEYRGTLRREKGERLRLPPWLKTEIPIGKNYNRLK  69

Query  422  KKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPP  601
              LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCTRGCRFC+VKT+R PPP
Sbjct  70   NTLRGLNLHTVCEEARCPNIGECWGGGEYSTATATIMLMGDTCTRGCRFCSVKTARQPPP  129

Query  602  PDPNE  616
             DP+E
Sbjct  130  LDPDE  134



>gb|KFQ55627.1| hypothetical protein N334_12474, partial [Pelecanus crispus]
Length=217

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPME  130



>ref|XP_009489687.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Pelecanus 
crispus]
Length=240

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  74   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  133

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  134  RGCRFCSVKTAKNPPPLDPME  154



>ref|XP_004522406.1| PREDICTED: lipoyl synthase, mitochondrial-like [Ceratitis capitata]
Length=387

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 89/134 (66%), Gaps = 15/134 (11%)
 Frame = +2

Query  248  LEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpk-----------WMKEAIP  394
            LE +R RLA + P    F+    + EYS +  T+ +   + +           W+K  IP
Sbjct  37   LEEIRDRLA-KGPNFQDFV---QNPEYSRDEWTEYEGKLRREKGENERLRLPPWLKTTIP  92

Query  395  GGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCN  574
             G+ + +IK +LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRFC+
Sbjct  93   MGKNFAKIKTQLRELKLATVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRFCS  152

Query  575  VKTSRTPPPPDPNE  616
            VKT+R PPP DP E
Sbjct  153  VKTARKPPPLDPAE  166



>gb|EDL37740.1| lipoic acid synthetase, isoform CRA_b [Mus musculus]
Length=340

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  45   WLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  104

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  105  RGCRFCSVKTARNPPPLDANE  125



>gb|KFO99312.1| hypothetical protein N300_04072, partial [Calypte anna]
Length=343

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K +IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTSIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>ref|XP_007426516.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Python 
bivittatus]
Length=395

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  102  WLKTEIPIGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  161

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKTSR+PPP DP E
Sbjct  162  RGCRFCSVKTSRSPPPLDPEE  182



>ref|XP_007178869.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=372

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM+LGDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLLGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>gb|KFV92327.1| hypothetical protein N326_00631, partial [Eurypyga helias]
Length=217

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTEIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPME  130



>ref|XP_007449481.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Lipotes 
vexillifer]
Length=329

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_001973489.1| GG13311 [Drosophila erecta]
 sp|B3NIL9.1|LIAS_DROER RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Drosophila erecta]
 gb|EDV52515.1| GG13311 [Drosophila erecta]
Length=379

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y +IK ++RELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCT
Sbjct  79   WLKTTIPVGKNYAKIKAQMRELKLSTVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARRPPPLDVNE  159



>dbj|BAC27579.1| unnamed protein product [Mus musculus]
Length=373

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  78   WLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  137

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  138  RGCRFCSVKTARNPPPLDANE  158



>ref|XP_007178870.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=360

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM+LGDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLLGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|NP_077791.1| lipoyl synthase, mitochondrial precursor [Mus musculus]
 sp|Q99M04.1|LIAS_MOUSE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; Short=mLIP1; AltName: 
Full=Lipoic acid synthase; Flags: Precursor [Mus musculus]
 gb|AAH02141.1| Lipoic acid synthetase [Mus musculus]
 dbj|BAB62009.1| lipoic acid synthase [Mus musculus]
 dbj|BAC33443.1| unnamed protein product [Mus musculus]
 dbj|BAC33804.1| unnamed protein product [Mus musculus]
 dbj|BAC36672.1| unnamed protein product [Mus musculus]
 gb|EDL37739.1| lipoic acid synthetase, isoform CRA_a [Mus musculus]
Length=373

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  78   WLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  137

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  138  RGCRFCSVKTARNPPPLDANE  158



>ref|XP_011194961.1| PREDICTED: lipoyl synthase, mitochondrial [Bactrocera cucurbitae]
Length=390

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 15/136 (11%)
 Frame = +2

Query  242  QTLEGLRSRLAAESPTLGSFIGLQSDNEYSVEVGTkkkplpkpk-----------WMKEA  388
            + LE +R RLA + P    F+    + EY+ E  T  +   + +           W+K  
Sbjct  35   EKLEEIRGRLA-KGPNFQDFV---QNPEYTREEWTAYEGKLRREKGENERLRLPPWLKTT  90

Query  389  IPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRF  568
            IP G+ + +IK +LRELKL TVCEEA+CPN+GECW GGE GT TATIM++GDTCTRGCRF
Sbjct  91   IPMGKNFAKIKTQLRELKLATVCEEARCPNIGECWGGGEHGTQTATIMLMGDTCTRGCRF  150

Query  569  CNVKTSRTPPPPDPNE  616
            C+VKT+R PPP DP E
Sbjct  151  CSVKTARKPPPLDPAE  166



>ref|XP_011137775.1| PREDICTED: lipoyl synthase, mitochondrial [Harpegnathos saltator]
 gb|EFN85489.1| Lipoyl synthase, mitochondrial [Harpegnathos saltator]
Length=368

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y++IK +LR L+L+TVCEEA+CPN+GECW GG  GTATATIM++GDTCT
Sbjct  73   WLKTEIPMGKSYSKIKAQLRHLRLNTVCEEARCPNIGECWGGGSYGTATATIMLMGDTCT  132

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+RTPPP D  E
Sbjct  133  RGCRFCSVKTARTPPPLDTEE  153



>ref|XP_003221569.2| PREDICTED: lipoyl synthase, mitochondrial [Anolis carolinensis]
Length=413

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  120  WLKTEIPIGKNYNRLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  179

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+++PPP DP+E
Sbjct  180  RGCRFCSVKTAKSPPPLDPDE  200



>gb|EPQ14702.1| Lipoyl synthase, mitochondrial [Myotis brandtii]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDANE  159



>ref|XP_006066202.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Bubalus 
bubalis]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_005666642.1| PREDICTED: lipoic acid synthetase isoform X3 [Sus scrofa]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_006088562.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Myotis 
lucifugus]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDANE  159



>ref|XP_008138449.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Eptesicus 
fuscus]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDANE  159



>ref|XP_004681401.1| PREDICTED: lipoyl synthase, mitochondrial [Condylura cristata]
Length=372

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPIGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKTSR PPP D NE
Sbjct  139  RGCRFCSVKTSRNPPPLDVNE  159



>ref|XP_005897411.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Bos mutus]
 gb|ELR55232.1| Lipoyl synthase, mitochondrial [Bos mutus]
Length=372

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_008490116.1| PREDICTED: lipoyl synthase, mitochondrial [Calypte anna]
Length=359

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K +IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  66   WLKTSIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  125

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  126  RGCRFCSVKTAKNPPPLDPEE  146



>ref|XP_007113946.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Physeter 
catodon]
Length=347

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  54   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  113

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  114  RGCRFCSVKTARNPPPLDANE  134



>ref|XP_005359324.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Microtus 
ochrogaster]
Length=331

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKTTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>gb|EFB17888.1| hypothetical protein PANDA_014664 [Ailuropoda melanoleuca]
Length=343

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+KY ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  64   WLKTEIPMGKKYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  123

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D +E
Sbjct  124  RGCRFCSVKTARNPPPLDASE  144



>ref|XP_008276634.1| PREDICTED: lipoyl synthase, mitochondrial [Stegastes partitus]
Length=414

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ + ++K  LR+L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  118  WLKTEIPIGKNFNRLKNTLRDLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  177

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC++KT+R PPP DP+E
Sbjct  178  RGCRFCSIKTARKPPPLDPDE  198



>ref|XP_005608877.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Equus caballus]
Length=329

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNRLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPVDANE  159



>ref|XP_003773359.1| PREDICTED: lipoyl synthase, mitochondrial [Sarcophilus harrisii]
Length=372

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPIGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEFATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARQPPPLDSNE  159



>ref|XP_001374049.1| PREDICTED: lipoyl synthase, mitochondrial [Monodelphis domestica]
Length=372

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPFGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARKPPPLDSNE  159



>ref|NP_001017944.1| lipoyl synthase, mitochondrial precursor [Bos taurus]
 ref|XP_010831871.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Bison bison 
bison]
 sp|Q5BIP7.1|LIAS_BOVIN RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Bos taurus]
 gb|AAX31359.1| lipoic acid synthetase isoform 1 precursor [Bos taurus]
 tpg|DAA28724.1| TPA: lipoyl synthase, mitochondrial precursor [Bos taurus]
Length=372

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_007066486.1| PREDICTED: lipoyl synthase, mitochondrial [Chelonia mydas]
Length=435

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR LKLHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  142  WLKTEIPIGKNYNKLKSTLRSLKLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  201

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP D NE
Sbjct  202  RGCRFCSVKTAKNPPPLDLNE  222



>ref|XP_008925719.1| PREDICTED: lipoyl synthase, mitochondrial [Manacus vitellinus]
Length=361

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  68   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  127

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  128  RGCRFCSVKTAKNPPPLDPQE  148



>ref|XP_004419045.1| PREDICTED: lipoyl synthase, mitochondrial [Ceratotherium simum 
simum]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>gb|KFW83864.1| hypothetical protein N305_05087, partial [Manacus vitellinus]
Length=343

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPQE  130



>gb|KFV64353.1| hypothetical protein N307_06684, partial [Picoides pubescens]
Length=343

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTNIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>gb|EMP29566.1| Lipoyl synthase [Chelonia mydas]
Length=375

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR LKLHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  95   WLKTEIPIGKNYNKLKSTLRSLKLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  154

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP D NE
Sbjct  155  RGCRFCSVKTAKNPPPLDLNE  175



>gb|KFQ94486.1| hypothetical protein Y956_08279, partial [Nipponia nippon]
Length=343

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  50   WLKTKIPMGKNYNKLKNTLRSLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  109

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT++ PPP DP E
Sbjct  110  RGCRFCSVKTAKNPPPLDPEE  130



>ref|XP_004332277.1| PREDICTED: LOW QUALITY PROTEIN: lipoic acid synthetase [Tursiops 
truncatus]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_004266292.1| PREDICTED: lipoyl synthase, mitochondrial [Orcinus orca]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|NP_001230391.1| lipoic acid synthetase [Sus scrofa]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_007113945.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Physeter 
catodon]
Length=372

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  79   WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEHATATATIMLMGDTCT  138

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  139  RGCRFCSVKTARNPPPLDANE  159



>ref|XP_005666640.1| PREDICTED: lipoic acid synthetase isoform X1 [Sus scrofa]
Length=414

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  374  WMKEAIPGGEKYTQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCT  553
            W+K  IP G+ Y ++K  LR L LHTVCEEA+CPN+GECW GGE  TATATIM++GDTCT
Sbjct  121  WLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCT  180

Query  554  RGCRFCNVKTSRTPPPPDPNE  616
            RGCRFC+VKT+R PPP D NE
Sbjct  181  RGCRFCSVKTARNPPPLDANE  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090