BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031L12

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010660689.1|  PREDICTED: aspartokinase 2, chloroplastic is...  80.5    5e-14   Vitis vinifera
ref|XP_002275779.1|  PREDICTED: aspartokinase 2, chloroplastic is...  80.5    5e-14   Vitis vinifera
ref|XP_009378035.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  64.3    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_009378037.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  63.9    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_006364050.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  63.9    1e-08   Solanum tuberosum [potatoes]
ref|XP_006364051.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  63.9    1e-08   Solanum tuberosum [potatoes]
ref|XP_008362086.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  63.5    2e-08   Malus domestica [apple tree]
ref|XP_008362087.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  63.5    2e-08   Malus domestica [apple tree]
ref|XP_010316459.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  60.5    2e-07   Solanum lycopersicum
ref|XP_004228743.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  60.5    2e-07   Solanum lycopersicum
ref|XP_004304561.1|  PREDICTED: aspartokinase 2, chloroplastic is...  58.9    5e-07   Fragaria vesca subsp. vesca
ref|XP_011006114.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.9    5e-07   Populus euphratica
ref|XP_011468211.1|  PREDICTED: aspartokinase 2, chloroplastic is...  58.9    6e-07   Fragaria vesca subsp. vesca
ref|XP_011006115.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.9    6e-07   Populus euphratica
ref|XP_011006109.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    7e-07   Populus euphratica
ref|XP_011006113.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    7e-07   Populus euphratica
ref|XP_009781445.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    8e-07   Nicotiana sylvestris
ref|XP_009781448.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    8e-07   Nicotiana sylvestris
ref|XP_009781447.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    8e-07   Nicotiana sylvestris
ref|XP_009781446.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  58.5    8e-07   Nicotiana sylvestris
ref|XP_006468884.1|  PREDICTED: aspartokinase 3, chloroplastic-li...  58.2    1e-06   Citrus sinensis [apfelsine]
ref|XP_006468885.1|  PREDICTED: aspartokinase 3, chloroplastic-li...  58.2    1e-06   Citrus sinensis [apfelsine]
ref|XP_008231031.1|  PREDICTED: aspartokinase 2, chloroplastic is...  58.2    1e-06   Prunus mume [ume]
ref|XP_007215316.1|  hypothetical protein PRUPE_ppa003561mg           58.2    1e-06   Prunus persica
ref|XP_008231032.1|  PREDICTED: aspartokinase 2, chloroplastic is...  58.2    1e-06   Prunus mume [ume]
ref|XP_002512848.1|  aspartate kinase, putative                       57.8    2e-06   
gb|KDO43562.1|  hypothetical protein CISIN_1g008621mg                 57.4    2e-06   Citrus sinensis [apfelsine]
gb|KDO43560.1|  hypothetical protein CISIN_1g008621mg                 57.4    2e-06   Citrus sinensis [apfelsine]
ref|XP_002321084.2|  hypothetical protein POPTR_0014s14270g           57.4    2e-06   Populus trichocarpa [western balsam poplar]
gb|KDO43559.1|  hypothetical protein CISIN_1g008621mg                 57.4    2e-06   Citrus sinensis [apfelsine]
gb|KDO43561.1|  hypothetical protein CISIN_1g008621mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_006446944.1|  hypothetical protein CICLE_v10014778mg           57.0    2e-06   Citrus clementina [clementine]
gb|KDO43558.1|  hypothetical protein CISIN_1g008621mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_008379050.1|  PREDICTED: aspartokinase 2, chloroplastic is...  56.6    3e-06   
ref|XP_008379051.1|  PREDICTED: aspartokinase 2, chloroplastic is...  56.6    3e-06   
ref|XP_008379052.1|  PREDICTED: aspartokinase 2, chloroplastic is...  56.6    3e-06   
gb|EYU34829.1|  hypothetical protein MIMGU_mgv1a003795mg              56.2    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_006399914.1|  hypothetical protein EUTSA_v10013157mg           56.2    5e-06   
ref|XP_006399912.1|  hypothetical protein EUTSA_v10013157mg           56.2    5e-06   Eutrema salsugineum [saltwater cress]
gb|KHG00746.1|  Aspartokinase 3, chloroplastic -like protein          55.5    8e-06   Gossypium arboreum [tree cotton]
ref|XP_009607338.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  55.1    1e-05   Nicotiana tomentosiformis
ref|XP_009607339.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  55.1    1e-05   Nicotiana tomentosiformis
ref|XP_009607340.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  55.1    1e-05   Nicotiana tomentosiformis
ref|XP_009607337.1|  PREDICTED: aspartokinase 2, chloroplastic-li...  55.1    1e-05   Nicotiana tomentosiformis
ref|XP_008357847.1|  PREDICTED: aspartokinase 2, chloroplastic-like   55.1    1e-05   
emb|CDP16734.1|  unnamed protein product                              54.7    2e-05   Coffea canephora [robusta coffee]
ref|XP_007032013.1|  Aspartate kinase 3 isoform 3                     54.7    2e-05   
ref|XP_007032011.1|  Aspartate kinase 3 isoform 1                     54.7    2e-05   
ref|XP_009131382.1|  PREDICTED: aspartokinase 2, chloroplastic        54.3    2e-05   Brassica rapa
emb|CDX78557.1|  BnaA03g04690D                                        53.5    3e-05   
ref|XP_006286781.1|  hypothetical protein CARUB_v10003334mg           53.1    6e-05   Capsella rubella
emb|CDX70538.1|  BnaC03g06220D                                        52.8    6e-05   
ref|XP_010492197.1|  PREDICTED: aspartokinase 2, chloroplastic-like   52.8    7e-05   Camelina sativa [gold-of-pleasure]
gb|KCW55775.1|  hypothetical protein EUGRSUZ_I01605                   50.4    4e-04   Eucalyptus grandis [rose gum]
ref|XP_010453516.1|  PREDICTED: aspartokinase 2, chloroplastic        50.4    4e-04   Camelina sativa [gold-of-pleasure]
gb|KCW55774.1|  hypothetical protein EUGRSUZ_I01605                   50.4    4e-04   Eucalyptus grandis [rose gum]
ref|XP_009127042.1|  PREDICTED: aspartokinase 3, chloroplastic-like   50.4    4e-04   Brassica rapa
gb|KJB33201.1|  hypothetical protein B456_006G000400                  50.4    4e-04   Gossypium raimondii
ref|XP_010028950.1|  PREDICTED: aspartokinase 2, chloroplastic-like   50.4    4e-04   Eucalyptus grandis [rose gum]
gb|KJB33202.1|  hypothetical protein B456_006G000400                  50.4    4e-04   Gossypium raimondii
ref|XP_002882151.1|  hypothetical protein ARALYDRAFT_896038           50.4    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_011024777.1|  PREDICTED: aspartokinase 3, chloroplastic is...  50.4    5e-04   Populus euphratica
ref|XP_011024774.1|  PREDICTED: aspartokinase 2, chloroplastic is...  50.1    5e-04   Populus euphratica
gb|KJB33203.1|  hypothetical protein B456_006G000400                  50.1    5e-04   Gossypium raimondii
emb|CDY06621.1|  BnaC02g13450D                                        50.1    6e-04   
ref|XP_010420027.1|  PREDICTED: aspartokinase 2, chloroplastic-like   50.1    6e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008369639.1|  PREDICTED: aspartokinase 1, chloroplastic        49.3    9e-04   
emb|CDY20797.1|  BnaA02g09370D                                        49.3    9e-04   Brassica napus [oilseed rape]



>ref|XP_010660689.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Vitis vinifera]
Length=569

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLR-HVYG---VCTSIKGSSRSRVLR  500
            M   +HL G T  P      + SLH +PLWSQ +D    V G   +C S+K SSR  VLR
Sbjct  1    MAGALHLCGVTT-PNCAVSSRRSLHCQPLWSQRVDFTLSVAGGSRLCRSVKDSSRKNVLR  59

Query  501  VSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            V C   +ID+++ S T+N   DGV  + T  MKFGGSSVASA+
Sbjct  60   VCCSGGSIDVLEKSKTENQTTDGVTEQLTIAMKFGGSSVASAE  102



>ref|XP_002275779.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Vitis vinifera]
Length=567

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHFRPLWSQTIDLR-HVYG---VCTSIKGSSRSRVLR  500
            M   +HL G T  P      + SLH +PLWSQ +D    V G   +C S+K SSR  VLR
Sbjct  1    MAGALHLCGVTT-PNCAVSSRRSLHCQPLWSQRVDFTLSVAGGSRLCRSVKDSSRKNVLR  59

Query  501  VSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            V C   +ID+++ S T+N   DGV  + T  MKFGGSSVASA+
Sbjct  60   VCCSGGSIDVLEKSKTENQTTDGVTEQLTIAMKFGGSSVASAE  102



>ref|XP_009378035.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=568

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 58/108 (54%), Gaps = 14/108 (13%)
 Frame = +3

Query  333  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTS---IKGSSR----  485
            MET +H  R  T  P  P+    SL F+ PLWSQ   LR   GV +S     G+      
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQR--LRFATGVASSNGFFAGAKNFPCT  55

Query  486  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            SRVLRVSC+    D+++   T N        + TCVMKFGGSSVASA+
Sbjct  56   SRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVASAE  103



>ref|XP_009378037.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=566

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 58/108 (54%), Gaps = 14/108 (13%)
 Frame = +3

Query  333  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTS---IKGSSR----  485
            MET +H  R  T  P  P+    SL F+ PLWSQ   LR   GV +S     G+      
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQR--LRFATGVASSNGFFAGAKNFPCT  55

Query  486  SRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            SRVLRVSC+    D+++   T N        + TCVMKFGGSSVASA+
Sbjct  56   SRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVASAE  103



>ref|XP_006364050.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=569

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  509
            M TL H  G  TPYP      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFCGVKTPYPSV---LKRSVHF-PQLDFVGTVPFVSTPSKSVKASCCERVQRLVC  56

Query  510  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            K+Q  D V    T+N  F  VP E TCVMKFGGSSVASA+
Sbjct  57   KAQAAD-VNPKETKNESFGEVPDELTCVMKFGGSSVASAE  95



>ref|XP_006364051.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=567

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  509
            M TL H  G  TPYP      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFCGVKTPYPSV---LKRSVHF-PQLDFVGTVPFVSTPSKSVKASCCERVQRLVC  56

Query  510  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            K+Q  D V    T+N  F  VP E TCVMKFGGSSVASA+
Sbjct  57   KAQAAD-VNPKETKNESFGEVPDELTCVMKFGGSSVASAE  95



>ref|XP_008362086.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Malus 
domestica]
Length=568

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 59/109 (54%), Gaps = 16/109 (15%)
 Frame = +3

Query  333  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTSIKG--------SS  482
            MET +H  R  T  P  P+    SL F+ PLWSQ+  LR   GV +S  G        S 
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQS--LRFATGVASS-NGFFASAKSFSC  54

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
             SRVLRVSC+    D+++   T N        + TCVMKFGGSSVA+A+
Sbjct  55   TSRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVATAE  103



>ref|XP_008362087.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Malus 
domestica]
Length=566

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 59/109 (54%), Gaps = 16/109 (15%)
 Frame = +3

Query  333  METLMHL-RGTTPYPYFPKECKASLHFR-PLWSQTIDLRHVYGVCTSIKG--------SS  482
            MET +H  R  T  P  P+    SL F+ PLWSQ+  LR   GV +S  G        S 
Sbjct  1    METALHFSRVKTLCPASPER---SLRFKQPLWSQS--LRFATGVASS-NGFFASAKSFSC  54

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
             SRVLRVSC+    D+++   T N        + TCVMKFGGSSVA+A+
Sbjct  55   TSRVLRVSCEGGIADVLEKKQTDNQSLGDNEKQLTCVMKFGGSSVATAE  103



>ref|XP_010316459.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
lycopersicum]
Length=567

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  509
            M TL H  G  TP P      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFSGVKTPCPSI---FKRSVHF-PQLDFVATVPFVSAPSKSVKVSCCERVQRLVC  56

Query  510  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            K+Q  D V    T+N  F   P E TCVMKFGGSSVASA+
Sbjct  57   KAQATD-VNRKETKNESFGEAPDELTCVMKFGGSSVASAE  95



>ref|XP_004228743.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
lycopersicum]
Length=565

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSC  509
            M TL H  G  TP P      K S+HF P       +  V     S+K S   RV R+ C
Sbjct  1    MATLSHFSGVKTPCPSI---FKRSVHF-PQLDFVATVPFVSAPSKSVKVSCCERVQRLVC  56

Query  510  KSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            K+Q  D V    T+N  F   P E TCVMKFGGSSVASA+
Sbjct  57   KAQATD-VNRKETKNESFGEAPDELTCVMKFGGSSVASAE  95



>ref|XP_004304561.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468210.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=562

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +3

Query  414  PLWSQTIDLRHVYGV-------CTSIKGSS-RSRVLRVSCKSQTIDLVQLSGTQNLGFDG  569
            PLWSQ   L     V       CTS K  S  SRVLRVSCK   +D++   G  N G   
Sbjct  24   PLWSQPQRLHFANSVSSSCGFYCTSGKYVSFASRVLRVSCKGGVVDVLDKKGKGNQGGAE  83

Query  570  VPSEFTCVMKFGGSSVASAQ  629
               + TCVMKFGGSSVASA+
Sbjct  84   NDKQLTCVMKFGGSSVASAE  103



>ref|XP_011006114.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Populus 
euphratica]
Length=561

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  503
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASA  626
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASA  93



>ref|XP_011468211.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=560

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +3

Query  414  PLWSQTIDLRHVYGV-------CTSIKGSS-RSRVLRVSCKSQTIDLVQLSGTQNLGFDG  569
            PLWSQ   L     V       CTS K  S  SRVLRVSCK   +D++   G  N G   
Sbjct  24   PLWSQPQRLHFANSVSSSCGFYCTSGKYVSFASRVLRVSCKGGVVDVLDKKGKGNQGGAE  83

Query  570  VPSEFTCVMKFGGSSVASAQ  629
               + TCVMKFGGSSVASA+
Sbjct  84   NDKQLTCVMKFGGSSVASAE  103



>ref|XP_011006115.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=559

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  503
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASA  626
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASA  93



>ref|XP_011006109.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006110.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006111.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006112.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=586

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  503
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASA  626
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASA  93



>ref|XP_011006113.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=584

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  503
            ME  +H   T      P F K     +H + L  Q ++      V T++  S  +RVL+V
Sbjct  1    MENTLHFSATLQAAASPVFSKRMN-KMHCQSLRVQMVNYN---SVATNLTLSRSNRVLKV  56

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASA  626
            SC++ ++D+++++ T+N       ++ TCVMKFGGSS+ASA
Sbjct  57   SCEAASVDVLEMNKTENQA----ETQLTCVMKFGGSSLASA  93



>ref|XP_009781445.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  506
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  507  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  92



>ref|XP_009781448.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
sylvestris]
Length=559

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  506
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  507  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  92



>ref|XP_009781447.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
sylvestris]
Length=561

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  506
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  507  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  92



>ref|XP_009781446.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 54/101 (53%), Gaps = 11/101 (11%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPL-WSQTIDLRHVYGVCTSIKGSSRSRVLRVS  506
            M +L H  G  TP P      K S+HFR L +  ++    V       K S   RV  V 
Sbjct  1    MASLSHFCGVKTPCPSL---FKRSVHFRQLDFVASVPFASVPS--KYAKASCYERVQSVI  55

Query  507  CKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  56   CKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  92



>ref|XP_006468884.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X1 [Citrus 
sinensis]
Length=559

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = +3

Query  393  KASLHFRPLWSQTIDLRHVYG----VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  557
            K SLH + L  Q  +          +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFEFAKCVSSSSRLCVSVRNSCGGRCGLRVSCEGARIDVIERKKSENL  72

Query  558  GFDGVPSEFTCVMKFGGSSVASAQ  629
            G D    + TCVMKFGGSS+ASA+
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAE  96



>ref|XP_006468885.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=557

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = +3

Query  393  KASLHFRPLWSQTIDLRHVYG----VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNL  557
            K SLH + L  Q  +          +C S++ S   R  LRVSC+   ID+++   ++NL
Sbjct  13   KNSLHCQALSWQRFEFAKCVSSSSRLCVSVRNSCGGRCGLRVSCEGARIDVIERKKSENL  72

Query  558  GFDGVPSEFTCVMKFGGSSVASAQ  629
            G D    + TCVMKFGGSS+ASA+
Sbjct  73   GVDESEKQLTCVMKFGGSSLASAE  96



>ref|XP_008231031.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Prunus 
mume]
Length=565

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 7/106 (7%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTID----LRHVYGVCTSIKG-SSRSRV  494
            M T +H  G  TP P      ++  + +PLWSQ +     +    G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATCVASNNGFYTSAKNFSCTSRV  60

Query  495  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAE  106



>ref|XP_007215316.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
 gb|EMJ16515.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
Length=565

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 7/106 (7%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTID----LRHVYGVCTSIKG-SSRSRV  494
            M T +H  G  TP P      ++  + +PLWSQ +     +    G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATRVASNNGFYTSAKNFSCTSRV  60

Query  495  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAE  106



>ref|XP_008231032.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Prunus 
mume]
Length=563

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 7/106 (7%)
 Frame = +3

Query  333  METLMHLRGT-TPYPYFPKECKASLHFRPLWSQTID----LRHVYGVCTSIKG-SSRSRV  494
            M T +H  G  TP P      ++  + +PLWSQ +     +    G  TS K  S  SRV
Sbjct  1    MATALHFSGVKTPCPASASSERSLQYKQPLWSQRLRFATCVASNNGFYTSAKNFSCTSRV  60

Query  495  LRVSCKSQTI-DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+   I D+++   T N        + TCVMKFGGSSVASA+
Sbjct  61   LRVSCEGGGITDVLEKKQTDNQCLGENEKQLTCVMKFGGSSVASAE  106



>ref|XP_002512848.1| aspartate kinase, putative [Ricinus communis]
 gb|EEF49351.1| aspartate kinase, putative [Ricinus communis]
Length=556

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +3

Query  333  METLMHLRG--TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSS-RSRVLRV  503
            M   +H  G     +P FPK+      F   ++ ++ +    G+  S+K SS  SRVLRV
Sbjct  1    MAAALHFGGGKVACHPVFPKKALQCQAFG--FANSVAVPSSKGLFKSVKFSSCTSRVLRV  58

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSE--FTCVMKFGGSSVASAQ  629
            SC+ + ID+++ + +++     V SE  FTCVMKFGGSS+ASA+
Sbjct  59   SCEGRNIDVLERNKSESSIDGNVESEKQFTCVMKFGGSSLASAE  102



>gb|KDO43562.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=358

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>gb|KDO43560.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=387

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>ref|XP_002321084.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
 gb|EEE99399.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
Length=561

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 11/102 (11%)
 Frame = +3

Query  333  METLMHLRGT---TPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRV  503
            M   +H   T    P P F K     +H + L  Q ++        T++  S  +RVL+V
Sbjct  1    MANTLHFSATLQAAPSPVFSKRMN-KMHCQSLRVQMVNYN---SEATNLALSRSNRVLKV  56

Query  504  SCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            SC++ ++D+++++ T N       ++ TCVMKFGGSS+ASA+
Sbjct  57   SCEAASVDVLEMNKTDNQA----ETQLTCVMKFGGSSLASAE  94



>gb|KDO43559.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=557

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>gb|KDO43561.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=456

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>ref|XP_006446944.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
 gb|ESR60184.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
Length=557

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>gb|KDO43558.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=559

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  456  VCTSIKGSSRSRV-LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +C S++ S   R  LRVSC+   ID+++   ++NLG D    + TCVMKFGGSS+ASA+
Sbjct  38   LCVSVRNSCGGRGGLRVSCEGARIDVIERKKSENLGVDESEKQLTCVMKFGGSSLASAE  96



>ref|XP_008379050.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Malus domestica]
Length=568

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 8/105 (8%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  494
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  495  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAE  103



>ref|XP_008379051.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Malus domestica]
Length=568

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 8/105 (8%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  494
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  495  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAE  103



>ref|XP_008379052.1| PREDICTED: aspartokinase 2, chloroplastic isoform X3 [Malus domestica]
Length=566

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 8/105 (8%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  494
            M T +H  G       P   + SLHF +PL SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQPLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  495  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+    D+ +     N        + TCVMKFGGSSVASA+
Sbjct  59   LRVSCEGXIADVXEKKRXDNQSLGENEKQLTCVMKFGGSSVASAE  103



>gb|EYU34829.1| hypothetical protein MIMGU_mgv1a003795mg [Erythranthe guttata]
Length=563

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +3

Query  402  LHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSE  581
            LHF       + L  V G C  + G S++  LR+ C +  +D+++++ T +   D    E
Sbjct  33   LHF------AVSLPSVIGPCLPLNGLSQTLALRLRCAASKVDVLEMNDTLSQDSDQSAKE  86

Query  582  FTCVMKFGGSSVASAQ  629
             TCVMKFGGSSVASA 
Sbjct  87   LTCVMKFGGSSVASAD  102



>ref|XP_006399914.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41367.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=554

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSVASA+
Sbjct  44   TVERSCRNTALRVSCEAARVDLLERKETETCNLSGTGKELTCVMKFGGSSVASAE  98



>ref|XP_006399912.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 ref|XP_006399913.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41365.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41366.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=545

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSVASA+
Sbjct  44   TVERSCRNTALRVSCEAARVDLLERKETETCNLSGTGKELTCVMKFGGSSVASAE  98



>gb|KHG00746.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=517

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGV--CTSIKGSSRSRVLRVSCKSQTIDLV  533
            T P   FPK+   S H R  +S  +          C  ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFSSQLHFGSFRSTDSCRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  534  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            + +  +        +E TCVMKFGGSSVASA+
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAE  101



>ref|XP_009607338.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +3

Query  498  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  89



>ref|XP_009607339.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
tomentosiformis]
Length=554

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +3

Query  498  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  89



>ref|XP_009607340.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
tomentosiformis]
Length=552

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +3

Query  498  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  89



>ref|XP_009607337.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%)
 Frame = +3

Query  498  RVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            RV+CK+Q  D+V+L  T+N  F     EFTCVMKFGGSSVASA+
Sbjct  50   RVTCKAQAADVVELKETKNEAF----GEFTCVMKFGGSSVASAE  89



>ref|XP_008357847.1| PREDICTED: aspartokinase 2, chloroplastic-like [Malus domestica]
Length=566

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 8/105 (8%)
 Frame = +3

Query  333  METLMHLRGTTPYPYFPKECKASLHF-RPLWSQTIDLRHVYGVCTSIKGSSR-----SRV  494
            M T +H  G       P   + SLHF + L SQ++              S++     SRV
Sbjct  1    MATALHFSGVKTL--CPSSSERSLHFNQXLLSQSLGFATCVASSNGFYASAKDFSCTSRV  58

Query  495  LRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            LRVSC+    D+ +   T N        + TCVMKFGGSSVASA+
Sbjct  59   LRVSCEGXIADVXEKKRTDNQSLGENEKQLTCVMKFGGSSVASAE  103



>emb|CDP16734.1| unnamed protein product [Coffea canephora]
Length=570

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 9/95 (9%)
 Frame = +3

Query  363  TPYPYFPKECKASLHFRPL------WSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTI  524
            TP+   P  C     F+PL      +   + L  + G  +S+K S + R LRV C+   +
Sbjct  13   TPFQASPWRCS---RFQPLLQSQQRFESFVSLLSLPGGFSSLKVSYQERDLRVRCQGGNL  69

Query  525  DLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
             +++   T+   F+   +E TCVMKFGGSSVASA+
Sbjct  70   HILERGQTETHDFEESANELTCVMKFGGSSVASAE  104



>ref|XP_007032013.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 ref|XP_007032014.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02939.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02940.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
Length=564

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +3

Query  360  TTPYPYFPKE----CKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTID  527
            T P   FPK+    C+++L  + L            +C +++   +SRV +VSC+   +D
Sbjct  13   TAPSHLFPKQRSLPCRSALPSQ-LNFAAFRSSSSSNLCWNLRHCCKSRVFKVSCQGGNVD  71

Query  528  LVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ +  +  G     ++ TCVMKFGGSSVASA+
Sbjct  72   VIERNEIEEAGSGEADNQLTCVMKFGGSSVASAE  105



>ref|XP_007032011.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032012.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032015.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02937.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02938.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02941.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
Length=566

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +3

Query  360  TTPYPYFPKE----CKASLHFRPLWSQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTID  527
            T P   FPK+    C+++L  + L            +C +++   +SRV +VSC+   +D
Sbjct  13   TAPSHLFPKQRSLPCRSALPSQ-LNFAAFRSSSSSNLCWNLRHCCKSRVFKVSCQGGNVD  71

Query  528  LVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ +  +  G     ++ TCVMKFGGSSVASA+
Sbjct  72   VIERNEIEEAGSGEADNQLTCVMKFGGSSVASAE  105



>ref|XP_009131382.1| PREDICTED: aspartokinase 2, chloroplastic [Brassica rapa]
Length=537

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +I+ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+
Sbjct  36   TIEHSCRNIALRVSCEAARVDLIERKETETSSVSGTGKELTCVMKFGGSSVESAE  90



>emb|CDX78557.1| BnaA03g04690D [Brassica napus]
Length=537

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+
Sbjct  36   TVEHSCRNIALRVSCEAARVDLIERKETETRSVSGTGKELTCVMKFGGSSVESAE  90



>ref|XP_006286781.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
 gb|EOA19679.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
Length=545

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  423  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  602
            S ++ L     V  +++ S R+  LRVSC++  +DL++   T+     G   + TCVMKF
Sbjct  30   SNSVTLAASSAVFRTVEHSCRNVALRVSCEAVRVDLLERQDTEICNSSGTGKDLTCVMKF  89

Query  603  GGSSVASAQ  629
            GGSSVASA+
Sbjct  90   GGSSVASAE  98



>emb|CDX70538.1| BnaC03g06220D [Brassica napus]
Length=546

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +++ S R+  LRVSC++  +DL++   T+     G   E TCVMKFGGSSV SA+
Sbjct  45   TVEHSCRNTPLRVSCEAARVDLIERKQTETRSVSGTGKELTCVMKFGGSSVESAE  99



>ref|XP_010492197.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010492198.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=546

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  453  GVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
             V  +++ S R+  LRVSC++  +DL++   T+     G   + TCVMKFGGSSVASA+
Sbjct  41   AVFRNVEHSCRNLALRVSCEAVRVDLLERKETETCNSSGTGKDLTCVMKFGGSSVASAE  99



>gb|KCW55775.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=525

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAE  103



>ref|XP_010453516.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
 ref|XP_010453517.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
Length=545

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  423  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  602
            S ++ L     V  +++ S R+  LRVSC++  +DL++    +     G   + TCVMKF
Sbjct  30   SNSVTLASSCAVFRTVEHSCRNIALRVSCEAVRVDLLERKEPETCNSSGTGKDLTCVMKF  89

Query  603  GGSSVASAQ  629
            GGSSVASA+
Sbjct  90   GGSSVASAE  98



>gb|KCW55774.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=539

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAE  103



>ref|XP_009127042.1| PREDICTED: aspartokinase 3, chloroplastic-like [Brassica rapa]
Length=573

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+
Sbjct  46   KNRTLRVTCEARSAELLERKDTETFKLNRTERKLTCVMKFGGSSVASAE  94



>gb|KJB33201.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=556

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +3

Query  360  TTPYPYFPKECKASLHFRPLWSQTIDLRHVYGVCT--SIKGSSRSRVLRVSCKSQTIDLV  533
            T P   FPK+   S H R  +   ++        +   ++   +SRV +VSC+   +D++
Sbjct  12   TAPSHSFPKQ--TSFHCRSAFLSQLNFGSFRSTDSYRRLRHCCKSRVFKVSCEGGNVDVI  69

Query  534  QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            + +  +        +E TCVMKFGGSSVASA+
Sbjct  70   ERNEVEKSTLGEAKNELTCVMKFGGSSVASAE  101



>ref|XP_010028950.1| PREDICTED: aspartokinase 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW55773.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=565

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  465  SIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            S+K S RS V +V C    +D+++ S     GF    ++  CVMKFGGSSVASA+
Sbjct  49   SVKKSCRSGVFKVCCAGANVDVLEKSSAVTQGFGDSENQLNCVMKFGGSSVASAE  103



>gb|KJB33202.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=511

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +SRV +VSC+   +D+++ +  +        +E TCVMKFGGSSVASA+
Sbjct  53   KSRVFKVSCEGGNVDVIERNEVEKSTLGEAKNELTCVMKFGGSSVASAE  101



>ref|XP_002882151.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58410.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = +3

Query  441  RHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVA  620
            R+V   C +I       VLRV+C++  ++L++  G++    +    + TCVMKFGGSSVA
Sbjct  43   RNVDHACKNI-------VLRVTCEAGRVELLERKGSETFKLNRTEKKLTCVMKFGGSSVA  95

Query  621  SAQ  629
            SA+
Sbjct  96   SAE  98



>ref|XP_011024777.1| PREDICTED: aspartokinase 3, chloroplastic isoform X2 [Populus 
euphratica]
Length=555

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +3

Query  456  VCTSIKGSSRSR-VLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            V TS+  S RSR  L+VSC++ ++DL++ +   N        + TCVMKFGGSSVASA+
Sbjct  40   VATSLVLSKRSRRALKVSCEAASVDLLETNKIDN----EAEKKITCVMKFGGSSVASAE  94



>ref|XP_011024774.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011024776.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
Length=557

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +3

Query  456  VCTSIKGSSRSR-VLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            V TS+  S RSR  L+VSC++ ++DL++ +   N        + TCVMKFGGSSVASA+
Sbjct  40   VATSLVLSKRSRRALKVSCEAASVDLLETNKIDN----EAEKKITCVMKFGGSSVASAE  94



>gb|KJB33203.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=543

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            +SRV +VSC+   +D+++ +  +        +E TCVMKFGGSSVASA+
Sbjct  53   KSRVFKVSCEGGNVDVIERNEVEKSTLGEAKNELTCVMKFGGSSVASAE  101



>emb|CDY06621.1| BnaC02g13450D [Brassica napus]
Length=576

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+
Sbjct  46   KNRTLRVTCEARSAELLERKDTETFKLNRTEIKLTCVMKFGGSSVASAE  94



>ref|XP_010420027.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010420028.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=545

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  423  SQTIDLRHVYGVCTSIKGSSRSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKF  602
            S ++ L     +  +++ S R+  LRVSC++  +DL++    +     G   + TCVMKF
Sbjct  30   SNSVTLASSCAIFRTVEHSCRNIALRVSCEAVRVDLLERKEPETCNSTGTGKDLTCVMKF  89

Query  603  GGSSVASAQ  629
            GGSSVASA+
Sbjct  90   GGSSVASAE  98



>ref|XP_008369639.1| PREDICTED: aspartokinase 1, chloroplastic [Malus domestica]
Length=565

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 22/99 (22%)
 Frame = +3

Query  393  KASLHFR----PLWSQTIDLRHVYGVCTS----------IKGSSRSRVLRVSCKSQTIDL  530
            +ASLHFR    P +S+T  L H+  V ++          ++ + R   LR   + + I+ 
Sbjct  2    EASLHFRGVRIPCYSRTPRLMHLSQVSSALSPSRSLYAAVENACRRSRLRAKSEKRRIEA  61

Query  531  V------QLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            V      + + T++ G D VP  FTCVMKFGGSS+ASA+
Sbjct  62   VLGEEEEEENATESRGSDAVP--FTCVMKFGGSSLASAE  98



>emb|CDY20797.1| BnaA02g09370D [Brassica napus]
Length=578

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  483  RSRVLRVSCKSQTIDLVQLSGTQNLGFDGVPSEFTCVMKFGGSSVASAQ  629
            ++R LRV+C++++ +L++   T+    +    + TCVMKFGGSSVASA+
Sbjct  46   KNRSLRVTCEARSAELLERKNTETFKLNRTEIKLTCVMKFGGSSVASAE  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875