BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031I07

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02169.1|  unnamed protein product                                318   3e-105   Coffea canephora [robusta coffee]
ref|NP_001275312.1|  protein transport SEC13-like protein               317   5e-105   Solanum tuberosum [potatoes]
ref|XP_011098538.1|  PREDICTED: protein transport protein SEC13 h...    315   4e-104   Sesamum indicum [beniseed]
dbj|BAO49717.1|  nuclear pore complex protein Sec13c                    315   5e-104   Nicotiana benthamiana
ref|XP_004232260.1|  PREDICTED: protein transport protein SEC13 h...    313   2e-103   Solanum lycopersicum
ref|XP_009764554.1|  PREDICTED: protein SEC13 homolog                   313   4e-103   Nicotiana sylvestris
dbj|BAO49718.1|  nuclear pore complex protein Sec13d                    312   4e-103   Nicotiana benthamiana
ref|XP_009623350.1|  PREDICTED: protein SEC13 homolog                   312   5e-103   Nicotiana tomentosiformis
gb|EYU44682.1|  hypothetical protein MIMGU_mgv1a010776mg                312   6e-103   Erythranthe guttata [common monkey flower]
dbj|BAO49715.1|  nuclear pore complex protein Sec13a                    312   6e-103   Nicotiana benthamiana
ref|XP_003551869.1|  PREDICTED: protein SEC13 homolog                   311   1e-102   Glycine max [soybeans]
gb|AGV54445.1|  protein transport SEC13-like protein                    309   8e-102   Phaseolus vulgaris [French bean]
gb|KHM99531.1|  Protein SEC13 like                                      311   8e-102   Glycine soja [wild soybean]
ref|XP_002281856.1|  PREDICTED: protein transport protein SEC13 h...    309   1e-101   Vitis vinifera
gb|KHN12541.1|  Protein SEC13 like                                      309   1e-101   Glycine soja [wild soybean]
ref|XP_006586096.1|  PREDICTED: protein SEC13 homolog isoform X1        309   1e-101   Glycine max [soybeans]
gb|KDP43859.1|  hypothetical protein JCGZ_20869                         309   1e-101   Jatropha curcas
ref|XP_010099520.1|  Protein SEC13-like protein                         308   2e-101   Morus notabilis
ref|XP_010094976.1|  Protein SEC13-like protein                         308   2e-101   Morus notabilis
ref|XP_008380946.1|  PREDICTED: protein transport protein SEC13-like    309   2e-101   Malus domestica [apple tree]
ref|XP_010033246.1|  PREDICTED: protein SEC13 homolog                   308   3e-101   Eucalyptus grandis [rose gum]
gb|KHM99522.1|  Protein SEC13 like                                      307   4e-101   Glycine soja [wild soybean]
ref|XP_007145729.1|  hypothetical protein PHAVU_007G263000g             307   5e-101   Phaseolus vulgaris [French bean]
ref|XP_003551800.1|  PREDICTED: protein SEC13 homolog isoform X1        307   5e-101   
ref|XP_011085795.1|  PREDICTED: protein transport protein SEC13 h...    307   6e-101   Sesamum indicum [beniseed]
ref|XP_002265971.1|  PREDICTED: protein transport protein SEC13 h...    307   7e-101   Vitis vinifera
gb|KCW52832.1|  hypothetical protein EUGRSUZ_J02164                     306   1e-100   Eucalyptus grandis [rose gum]
ref|XP_011021702.1|  PREDICTED: protein transport protein SEC13 h...    306   1e-100   Populus euphratica
dbj|BAJ10727.1|  SEC13 family protein                                   306   1e-100   Lotus japonicus
ref|XP_006586103.1|  PREDICTED: protein SEC13 homolog isoform X2        308   2e-100   
gb|ACU18089.1|  unknown                                                 305   2e-100   Glycine max [soybeans]
ref|XP_003532149.2|  PREDICTED: protein SEC13 homolog isoform X1        308   2e-100   
ref|XP_009759579.1|  PREDICTED: protein transport protein SEC13-like    305   4e-100   Nicotiana sylvestris
gb|ACU20139.1|  unknown                                                 305   5e-100   Glycine max [soybeans]
ref|XP_006470402.1|  PREDICTED: protein SEC13 homolog                   304   7e-100   
emb|CAN81348.1|  hypothetical protein VITISV_021485                     303   1e-99    Vitis vinifera
emb|CAN79974.1|  hypothetical protein VITISV_009154                     304   1e-99    Vitis vinifera
ref|XP_010550097.1|  PREDICTED: protein transport protein SEC13 h...    303   2e-99    Tarenaya hassleriana [spider flower]
gb|KHG11308.1|  Protein SEC13                                           304   2e-99    Gossypium arboreum [tree cotton]
emb|CAN63472.1|  hypothetical protein VITISV_000787                     304   2e-99    Vitis vinifera
gb|KJB45573.1|  hypothetical protein B456_007G314500                    303   2e-99    Gossypium raimondii
ref|XP_011072420.1|  PREDICTED: protein transport protein SEC13 h...    303   2e-99    Sesamum indicum [beniseed]
ref|XP_007144311.1|  hypothetical protein PHAVU_007G145400g             303   3e-99    Phaseolus vulgaris [French bean]
ref|XP_008462440.1|  PREDICTED: protein SEC13 homolog                   303   3e-99    Cucumis melo [Oriental melon]
gb|AFK36737.1|  unknown                                                 299   3e-99    Lotus japonicus
ref|XP_002266827.2|  PREDICTED: protein transport protein SEC13 h...    302   5e-99    Vitis vinifera
ref|XP_009603401.1|  PREDICTED: protein transport protein SEC13-like    298   5e-99    Nicotiana tomentosiformis
ref|XP_002321555.1|  hypothetical protein POPTR_0015s080101g            301   8e-99    
ref|XP_006446433.1|  hypothetical protein CICLE_v10016079mg             301   8e-99    Citrus clementina [clementine]
ref|XP_004141658.1|  PREDICTED: protein SEC13 homolog                   301   1e-98    Cucumis sativus [cucumbers]
ref|XP_010272104.1|  PREDICTED: protein transport protein SEC13 h...    301   1e-98    Nelumbo nucifera [Indian lotus]
ref|XP_007024275.1|  Transducin family protein / WD-40 repeat fam...    301   1e-98    
ref|XP_002315836.1|  transport protein SEC13                            301   2e-98    
ref|XP_011028666.1|  PREDICTED: protein transport protein SEC13 h...    301   2e-98    Populus euphratica
gb|KEH33918.1|  transducin/WD-like repeat-protein                       300   2e-98    Medicago truncatula
ref|XP_007215469.1|  hypothetical protein PRUPE_ppa006517mg             303   3e-98    
ref|XP_010267185.1|  PREDICTED: protein transport protein SEC13 h...    300   5e-98    Nelumbo nucifera [Indian lotus]
ref|XP_010551882.1|  PREDICTED: protein transport protein SEC13 h...    299   6e-98    Tarenaya hassleriana [spider flower]
ref|XP_010524317.1|  PREDICTED: protein transport protein SEC13 h...    299   7e-98    Tarenaya hassleriana [spider flower]
ref|XP_004150601.1|  PREDICTED: protein SEC13 homolog                   299   7e-98    Cucumis sativus [cucumbers]
ref|XP_004512728.1|  PREDICTED: protein SEC13 homolog isoform X1        299   8e-98    Cicer arietinum [garbanzo]
emb|CAN80755.1|  hypothetical protein VITISV_027966                     298   2e-97    Vitis vinifera
ref|XP_006410056.1|  hypothetical protein EUTSA_v10016789mg             301   2e-97    
ref|XP_006410057.1|  hypothetical protein EUTSA_v10016789mg             301   2e-97    
ref|XP_008379297.1|  PREDICTED: protein SEC13 homolog                   298   3e-97    Malus domestica [apple tree]
ref|XP_007215747.1|  hypothetical protein PRUPE_ppa009252mg             297   4e-97    Prunus persica
ref|XP_008230683.1|  PREDICTED: protein SEC13 homolog                   297   5e-97    Prunus mume [ume]
ref|XP_009335780.1|  PREDICTED: protein SEC13 homolog                   296   6e-97    Pyrus x bretschneideri [bai li]
dbj|BAJ10728.1|  SEC13 family protein                                   295   3e-96    Lotus japonicus
emb|CDY24035.1|  BnaC03g16560D                                          295   3e-96    Brassica napus [oilseed rape]
emb|CDP21792.1|  unnamed protein product                                295   3e-96    Coffea canephora [robusta coffee]
gb|AAM65185.1|  transport protein SEC13, putative                       295   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_186783.1|  transport protein SEC13B                              294   5e-96    Arabidopsis thaliana [mouse-ear cress]
dbj|BAO49716.1|  nuclear pore complex protein Sec13b                    294   6e-96    Nicotiana benthamiana
emb|CDX84863.1|  BnaA03g13670D                                          294   8e-96    
gb|KDO51761.1|  hypothetical protein CISIN_1g036510mg                   293   1e-95    Citrus sinensis [apfelsine]
ref|XP_006465678.1|  PREDICTED: protein SEC13 homolog                   293   1e-95    Citrus sinensis [apfelsine]
ref|XP_011080528.1|  PREDICTED: protein transport protein SEC13 h...    293   1e-95    Sesamum indicum [beniseed]
ref|XP_006426897.1|  hypothetical protein CICLE_v10026168mg             293   2e-95    Citrus clementina [clementine]
ref|XP_010510416.1|  PREDICTED: protein transport protein SEC13 h...    292   3e-95    Camelina sativa [gold-of-pleasure]
gb|AAM65095.1|  putative protein transport protein SEC13                292   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790006.1|  PREDICTED: protein SEC13 homolog                   292   4e-95    Phoenix dactylifera
ref|XP_010687899.1|  PREDICTED: protein transport protein SEC13 h...    292   5e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_180566.1|  transport protein SEC13A                              292   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929133.1|  PREDICTED: protein transport protein SEC13 h...    291   7e-95    Elaeis guineensis
ref|XP_006294683.1|  hypothetical protein CARUB_v10023720mg             291   8e-95    Capsella rubella
emb|CDY02025.1|  BnaC04g14760D                                          291   1e-94    
ref|XP_010469902.1|  PREDICTED: protein transport protein SEC13 h...    291   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002515980.1|  protein transport protein sec13, putative          291   1e-94    Ricinus communis
gb|KCW84259.1|  hypothetical protein EUGRSUZ_B01116                     291   2e-94    Eucalyptus grandis [rose gum]
ref|XP_004302867.1|  PREDICTED: protein transport protein SEC13 h...    290   3e-94    Fragaria vesca subsp. vesca
ref|XP_006408491.1|  hypothetical protein EUTSA_v10021223mg             290   4e-94    Eutrema salsugineum [saltwater cress]
ref|XP_007032314.1|  Transducin family protein / WD-40 repeat fam...    290   4e-94    
gb|KDP40875.1|  hypothetical protein JCGZ_24874                         289   6e-94    Jatropha curcas
ref|XP_002879246.1|  transducin family protein                          289   7e-94    Arabidopsis lyrata subsp. lyrata
emb|CDY10705.1|  BnaA05g12310D                                          291   8e-94    Brassica napus [oilseed rape]
ref|XP_011466664.1|  PREDICTED: protein transport protein SEC13 h...    289   1e-93    Fragaria vesca subsp. vesca
ref|XP_011466663.1|  PREDICTED: protein transport protein SEC13 h...    289   1e-93    Fragaria vesca subsp. vesca
emb|CDY37530.1|  BnaA05g33950D                                          288   1e-93    Brassica napus [oilseed rape]
gb|EYU21504.1|  hypothetical protein MIMGU_mgv1a010808mg                287   3e-93    Erythranthe guttata [common monkey flower]
ref|XP_009408052.1|  PREDICTED: protein SEC13 homolog                   287   3e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414320.1|  PREDICTED: protein transport protein SEC13 h...    289   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010942123.1|  PREDICTED: protein transport protein SEC13 h...    287   3e-93    Elaeis guineensis
ref|XP_006298213.1|  hypothetical protein CARUB_v10014264mg             286   7e-93    Capsella rubella
ref|XP_010665916.1|  PREDICTED: protein transport protein SEC13 h...    286   7e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010485502.1|  PREDICTED: protein transport protein SEC13 h...    286   9e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010500953.1|  PREDICTED: protein transport protein SEC13 h...    286   1e-92    Camelina sativa [gold-of-pleasure]
emb|CDY49046.1|  BnaC05g48740D                                          286   1e-92    Brassica napus [oilseed rape]
ref|XP_010463534.1|  PREDICTED: protein transport protein SEC13 h...    285   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009147418.1|  PREDICTED: protein SEC13 homolog                   285   4e-92    Brassica rapa
emb|CDX97854.1|  BnaC04g40850D                                          284   5e-92    
ref|NP_001045820.1|  Os02g0135800                                       284   7e-92    
ref|XP_009141033.1|  PREDICTED: protein SEC13 homolog                   283   8e-92    Brassica rapa
ref|XP_004235651.1|  PREDICTED: protein transport protein SEC13 h...    283   2e-91    Solanum lycopersicum
ref|XP_011466267.1|  PREDICTED: protein transport protein SEC13 h...    283   2e-91    Fragaria vesca subsp. vesca
gb|EPS72747.1|  hypothetical protein M569_02010                         282   3e-91    Genlisea aurea
gb|KJB40797.1|  hypothetical protein B456_007G077700                    282   3e-91    Gossypium raimondii
gb|AFX66988.1|  protein transport SEC13-like protein                    283   4e-91    Solanum tuberosum [potatoes]
gb|EMT07862.1|  hypothetical protein F775_17938                         281   9e-91    
gb|EMT13956.1|  hypothetical protein F775_31904                         281   1e-90    
gb|AGT16309.1|  SEC13-related protein                                   280   2e-90    Saccharum hybrid cultivar R570
ref|XP_002454939.1|  hypothetical protein SORBIDRAFT_03g001760          280   2e-90    Sorghum bicolor [broomcorn]
gb|AGT17401.1|  SEC13-related protein                                   280   2e-90    Saccharum hybrid cultivar R570
ref|XP_003565584.1|  PREDICTED: protein transport protein SEC13 h...    280   4e-90    Brachypodium distachyon [annual false brome]
gb|EMS54340.1|  Protein SEC13-like protein                              280   4e-90    Triticum urartu
gb|ACN59487.1|  SEC13                                                   279   5e-90    Triticum aestivum [Canadian hard winter wheat]
gb|KHG02181.1|  Protein SEC13                                           278   7e-90    Gossypium arboreum [tree cotton]
ref|XP_004968630.1|  PREDICTED: protein SEC13 homolog                   279   8e-90    Setaria italica
ref|XP_006646853.1|  PREDICTED: protein SEC13 homolog                   278   9e-90    Oryza brachyantha
ref|NP_001149004.1|  SEC13-related protein                              278   1e-89    
gb|ACG46695.1|  SEC13-related protein                                   278   2e-89    Zea mays [maize]
ref|NP_001150249.1|  SEC13-related protein                              278   2e-89    Zea mays [maize]
dbj|BAJ89756.1|  predicted protein                                      278   2e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006646846.1|  PREDICTED: protein SEC13 homolog                   277   5e-89    Oryza brachyantha
emb|CDY29706.1|  BnaA04g17210D                                          288   7e-89    Brassica napus [oilseed rape]
ref|XP_004169158.1|  PREDICTED: protein SEC13 homolog                   275   1e-88    
ref|XP_008443459.1|  PREDICTED: protein SEC13 homolog                   275   2e-88    Cucumis melo [Oriental melon]
ref|XP_004147452.1|  PREDICTED: protein SEC13 homolog                   275   3e-88    Cucumis sativus [cucumbers]
ref|XP_010249546.1|  PREDICTED: protein transport protein SEC13 h...    275   3e-88    
ref|XP_004956945.1|  PREDICTED: protein SEC13 homolog                   273   9e-88    Setaria italica
ref|XP_010914535.1|  PREDICTED: protein transport protein SEC13 h...    269   4e-86    Elaeis guineensis
ref|XP_006836221.1|  hypothetical protein AMTR_s00101p00099400          268   2e-85    Amborella trichopoda
ref|XP_006854548.1|  hypothetical protein AMTR_s00030p00063600          262   3e-83    Amborella trichopoda
ref|XP_010098129.1|  Protein SEC13-like protein                         258   4e-81    
gb|EPS72324.1|  hypothetical protein M569_02435                         249   1e-78    Genlisea aurea
ref|NP_001059284.1|  Os07g0246300                                       249   4e-78    
ref|XP_002460282.1|  hypothetical protein SORBIDRAFT_02g025945          246   1e-77    
ref|XP_003563373.1|  PREDICTED: protein transport protein SEC13 h...    247   3e-77    Brachypodium distachyon [annual false brome]
gb|ABK22893.1|  unknown                                                 246   5e-77    Picea sitchensis
ref|XP_002979018.1|  hypothetical protein SELMODRAFT_109958             244   4e-76    
ref|XP_002988399.1|  hypothetical protein SELMODRAFT_128111             243   9e-76    
ref|XP_006657588.1|  PREDICTED: protein SEC13 homolog                   243   1e-75    Oryza brachyantha
ref|XP_006650845.1|  PREDICTED: protein SEC13 homolog                   241   4e-75    Oryza brachyantha
ref|NP_001051797.1|  Os03g0831800                                       238   6e-74    
ref|XP_001781370.1|  predicted protein                                  238   8e-74    
ref|XP_004955890.1|  PREDICTED: protein SEC13 homolog                   236   2e-73    Setaria italica
ref|XP_010228200.1|  PREDICTED: protein transport protein SEC13 h...    236   3e-73    
ref|NP_001146460.1|  SEC13 protein                                      235   6e-73    Zea mays [maize]
ref|XP_006379798.1|  hypothetical protein POPTR_0008s14080g             232   6e-72    
ref|NP_001149986.1|  SEC13-related protein                              230   5e-71    Zea mays [maize]
gb|ACN31668.1|  unknown                                                 230   5e-71    Zea mays [maize]
ref|XP_001768123.1|  predicted protein                                  230   7e-71    
ref|XP_008651486.1|  PREDICTED: SEC13-related protein isoform X2        232   2e-70    
gb|EMS55260.1|  Protein SEC13-like protein                              228   9e-70    Triticum urartu
dbj|BAJ95085.1|  predicted protein                                      226   4e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001774339.1|  predicted protein                                  226   4e-69    
gb|EMT21065.1|  hypothetical protein F775_28222                         226   2e-68    
gb|ABK26393.1|  unknown                                                 221   9e-68    Picea sitchensis
ref|XP_001767345.1|  predicted protein                                  221   2e-67    
gb|EMT33754.1|  hypothetical protein F775_27473                         204   5e-61    
ref|XP_001700438.1|  COP-II coat subunit                                204   1e-60    Chlamydomonas reinhardtii
ref|XP_011407281.1|  PREDICTED: protein SEC13 homolog                   202   6e-60    Amphimedon queenslandica
ref|XP_003384987.1|  PREDICTED: protein SEC13 homolog                   201   1e-59    Amphimedon queenslandica
ref|XP_005834017.1|  secretory protein Sec13                            200   4e-59    Guillardia theta CCMP2712
ref|XP_002949031.1|  hypothetical protein VOLCADRAFT_80440              199   7e-59    Volvox carteri f. nagariensis
emb|CDH60247.1|  wd40 repeat-like protein                               196   1e-57    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS08364.1|  hypothetical protein LRAMOSA02312                      196   1e-57    Lichtheimia ramosa
ref|XP_004345908.1|  SEC13, putative                                    194   5e-57    Acanthamoeba castellanii str. Neff
gb|EFX87077.1|  hypothetical protein DAPPUDRAFT_221812                  194   8e-57    Daphnia pulex
gb|EMD31608.1|  hypothetical protein CERSUDRAFT_119652                  194   1e-56    Gelatoporia subvermispora B
ref|XP_002127937.1|  PREDICTED: protein SEC13 homolog                   193   2e-56    Ciona intestinalis [sea vase]
ref|NP_988967.1|  SEC13 homolog                                         194   2e-56    Xenopus tropicalis [western clawed frog]
ref|XP_006173389.1|  PREDICTED: protein SEC13 homolog                   195   2e-56    
ref|XP_001631519.1|  predicted protein                                  192   4e-56    Nematostella vectensis
ref|XP_002599724.1|  hypothetical protein BRAFLDRAFT_287194             192   6e-56    Branchiostoma floridae
gb|ABO65080.1|  SEC13-like 1 isoform                                    187   6e-56    Homo sapiens [man]
ref|XP_007251556.1|  PREDICTED: protein SEC13 homolog                   192   7e-56    
gb|AAH73381.1|  Unknown (protein for MGC:80813)                         192   8e-56    Xenopus laevis [clawed frog]
ref|XP_003395453.1|  PREDICTED: protein SEC13 homolog                   191   1e-55    Bombus terrestris [large earth bumblebee]
ref|XP_393516.3|  PREDICTED: protein SEC13 homolog isoform X2           191   1e-55    Apis mellifera [bee]
emb|CCG81563.1|  Protein transport protein sec13                        191   1e-55    Taphrina deformans PYCC 5710
ref|XP_005650517.1|  WD40 repeat-like protein                           191   2e-55    Coccomyxa subellipsoidea C-169
ref|XP_005846000.1|  hypothetical protein CHLNCDRAFT_31922              190   2e-55    Chlorella variabilis
ref|XP_006957939.1|  WD40 repeat-like protein                           191   2e-55    Wallemia mellicola CBS 633.66
ref|XP_006807456.1|  PREDICTED: protein SEC13 homolog                   189   2e-55    Neolamprologus brichardi [lyretail cichlid]
ref|XP_003826330.1|  PREDICTED: protein SEC13 homolog isoform X1        192   2e-55    Pan paniscus [bonobo]
ref|NP_001080442.1|  SEC13 homolog                                      191   2e-55    Xenopus laevis [clawed frog]
ref|XP_002509166.1|  predicted protein                                  190   2e-55    Micromonas commoda
ref|XP_005265434.1|  PREDICTED: protein SEC13 homolog isoform X1        191   3e-55    
ref|XP_005066189.1|  PREDICTED: protein SEC13 homolog isoform X2        190   3e-55    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006083906.1|  PREDICTED: protein SEC13 homolog                   190   3e-55    Myotis lucifugus
ref|XP_008150256.1|  PREDICTED: protein SEC13 homolog                   190   3e-55    Eptesicus fuscus
ref|XP_004901951.1|  PREDICTED: protein SEC13 homolog                   190   3e-55    
ref|NP_001187522.1|  protein SEC13 homolog                              190   4e-55    Ictalurus punctatus
ref|XP_005066188.1|  PREDICTED: protein SEC13 homolog isoform X1        190   4e-55    
ref|NP_001129498.1|  protein SEC13 homolog isoform 3                    191   4e-55    Homo sapiens [man]
ref|NP_998500.1|  protein SEC13 homolog                                 190   4e-55    Danio rerio [leopard danio]
ref|XP_011368966.1|  PREDICTED: protein SEC13 homolog                   190   4e-55    
ref|XP_003464126.1|  PREDICTED: protein SEC13 homolog                   190   4e-55    Cavia porcellus [guinea pig]
ref|XP_006917678.1|  PREDICTED: protein SEC13 homolog                   190   5e-55    Pteropus alecto
ref|XP_005265435.1|  PREDICTED: protein SEC13 homolog isoform X2        190   6e-55    
gb|KDR17793.1|  SEC13-like protein                                      189   6e-55    Zootermopsis nevadensis
ref|XP_004358973.1|  WD40 repeat-containing protein                     189   6e-55    Cavenderia fasciculata
ref|XP_007944008.1|  PREDICTED: protein SEC13 homolog                   189   6e-55    Orycteropus afer afer
gb|EPQ10095.1|  Protein SEC13 like protein                              191   7e-55    Myotis brandtii
gb|KFP30820.1|  Protein SEC13                                           189   7e-55    Colius striatus
gb|AGM32573.1|  WD40 domain containing protein                          188   7e-55    Coptotermes formosanus
ref|XP_010617575.1|  PREDICTED: protein SEC13 homolog                   189   7e-55    Fukomys damarensis [Damara mole rat]
ref|XP_004625281.1|  PREDICTED: protein SEC13 homolog                   191   8e-55    
gb|ABM55656.1|  putative SEC13-like protein 1                           189   9e-55    Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|KFZ64786.1|  Protein SEC13                                           189   9e-55    Antrostomus carolinensis
ref|XP_005997883.1|  PREDICTED: protein SEC13 homolog                   189   9e-55    Latimeria chalumnae
ref|XP_004033647.1|  PREDICTED: protein SEC13 homolog isoform 3         190   9e-55    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_006902250.1|  PREDICTED: protein SEC13 homolog                   189   9e-55    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007983410.1|  PREDICTED: protein SEC13 homolog isoform X1        190   1e-54    Chlorocebus sabaeus
ref|XP_005186970.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Musca domestica
ref|XP_004084891.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Oryzias latipes [Japanese rice fish]
gb|KFQ30001.1|  Protein SEC13                                           189   1e-54    Mesitornis unicolor
ref|XP_005145852.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Melopsittacus undulatus
ref|NP_077168.2|  protein SEC13 homolog                                 189   1e-54    Mus musculus [mouse]
ref|XP_005365083.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Microtus ochrogaster [prairie voles]
ref|XP_006994752.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Peromyscus maniculatus bairdii
ref|XP_005413135.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Chinchilla lanigera
ref|XP_004452753.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Dasypus novemcinctus
gb|AAH02128.1|  Sec13 protein                                           189   1e-54    Mus musculus [mouse]
ref|XP_010085319.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Pterocles gutturalis
ref|XP_005333860.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Ictidomys tridecemlineatus
gb|EDK99502.1|  SEC13-like 1 (S. cerevisiae), isoform CRA_b             189   1e-54    Mus musculus [mouse]
ref|XP_008057837.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Carlito syrichta
ref|XP_004443648.1|  PREDICTED: protein SEC13 homolog isoform 1         189   1e-54    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_001006979.1|  protein SEC13 homolog                              189   1e-54    Rattus norvegicus [brown rat]
ref|XP_007075531.1|  PREDICTED: protein SEC13 homolog isoform X1        189   1e-54    Panthera tigris altaica
ref|XP_850437.1|  PREDICTED: protein SEC13 homolog isoformX1            189   1e-54    Canis lupus familiaris [dogs]
ref|XP_004392737.1|  PREDICTED: protein SEC13 homolog isoform 1         189   1e-54    Odobenus rosmarus divergens
ref|XP_006900603.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003982518.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Felis catus [cat]
ref|XP_007060002.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Chelonia mydas [green seaturtle]
ref|XP_003265017.1|  PREDICTED: protein SEC13 homolog                   190   1e-54    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003785488.1|  PREDICTED: protein SEC13 homolog isoform 2         189   1e-54    
ref|XP_008853099.1|  PREDICTED: protein SEC13 homolog isoform X1        189   1e-54    Nannospalax galili
ref|XP_004559093.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Maylandia zebra
ref|XP_010172929.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Antrostomus carolinensis
gb|KFW82958.1|  Protein SEC13                                           189   1e-54    Manacus vitellinus
gb|KFV45554.1|  Protein SEC13                                           189   1e-54    Gavia stellata
ref|XP_006132885.1|  PREDICTED: protein SEC13 homolog                   189   1e-54    Pelodiscus sinensis [Chinese softshell turtle]
gb|KFO59722.1|  Protein SEC13                                           188   2e-54    Corvus brachyrhynchos
gb|KFM01351.1|  Protein SEC13                                           188   2e-54    Aptenodytes forsteri
ref|XP_005522008.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008924583.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
gb|EMC83360.1|  Protein SEC13 like protein                              188   2e-54    
gb|KFV84534.1|  Protein SEC13                                           188   2e-54    Struthio camelus australis
ref|XP_009512940.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Phalacrocorax carbo [common cormorant]
ref|XP_002962084.1|  hypothetical protein SELMODRAFT_76631              188   2e-54    Selaginella moellendorffii
gb|KFP91989.1|  Protein SEC13                                           188   2e-54    Apaloderma vittatum
ref|XP_011211710.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Bactrocera dorsalis [papaya fruit fly]
gb|KFP72681.1|  Protein SEC13                                           188   2e-54    Acanthisitta chloris
ref|NP_001267197.1|  protein SEC13 homolog                              188   2e-54    Pan troglodytes
ref|XP_006206940.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    191   2e-54    
dbj|BAB26480.1|  unnamed protein product                                188   2e-54    Mus musculus [mouse]
gb|ELK07876.1|  Protein SEC13 like protein                              191   2e-54    Pteropus alecto
ref|NP_001264770.1|  protein SEC13 homolog                              188   2e-54    Gallus gallus [bantam]
ref|XP_005797173.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Xiphophorus maculatus
ref|XP_003785487.1|  PREDICTED: protein SEC13 homolog isoform 1         188   2e-54    Otolemur garnettii
ref|XP_009080512.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Acanthisitta chloris
gb|ELU04892.1|  hypothetical protein CAPTEDRAFT_149284                  187   2e-54    Capitella teleta
ref|XP_010159209.1|  PREDICTED: protein SEC13 homolog                   189   2e-54    Eurypyga helias
ref|XP_008632704.1|  PREDICTED: protein SEC13 homolog                   189   2e-54    
ref|XP_009704500.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    Cariama cristata
ref|XP_003031195.1|  hypothetical protein SCHCODRAFT_76913              188   2e-54    Schizophyllum commune H4-8
ref|XP_007983411.1|  PREDICTED: protein SEC13 homolog isoform X2        188   2e-54    
ref|XP_009925138.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    189   2e-54    
ref|XP_004368382.1|  PREDICTED: protein SEC13 homolog isoform 1         188   2e-54    
ref|XP_004738581.1|  PREDICTED: protein SEC13 homolog isoform X1        189   2e-54    
ref|XP_005490235.1|  PREDICTED: protein SEC13 homolog                   189   2e-54    
gb|KFH71651.1|  protein transporter SEC13                               188   2e-54    
ref|XP_007569682.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_009490110.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_009874190.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_003927110.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_009946398.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_002187493.1|  PREDICTED: protein SEC13 homolog                   189   2e-54    
ref|XP_009282024.1|  PREDICTED: protein SEC13 homolog                   188   2e-54    
ref|XP_009816902.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    188   2e-54    
ref|XP_010588271.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_004368383.1|  PREDICTED: protein SEC13 homolog isoform 2         188   3e-54    
ref|XP_011188336.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_002925064.1|  PREDICTED: protein SEC13 homolog isoform X1        188   3e-54    
ref|XP_008587479.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_003762460.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_005509092.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_009577357.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|NP_109598.2|  protein SEC13 homolog isoform 4                       188   3e-54    
ref|XP_006152053.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
gb|KIN98473.1|  hypothetical protein M404DRAFT_1005321                  188   3e-54    
ref|XP_010300088.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    188   3e-54    
ref|XP_001375694.2|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_009679424.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    188   3e-54    
ref|XP_010281426.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_009318389.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_009963519.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    188   3e-54    
ref|XP_009881170.1|  PREDICTED: protein SEC13 homolog                   188   3e-54    
ref|XP_007983412.1|  PREDICTED: protein SEC13 homolog isoform X3        187   4e-54    
ref|XP_003826328.1|  PREDICTED: protein SEC13 homolog isoform X2        187   4e-54    
ref|XP_001599879.1|  PREDICTED: protein SEC13 homolog                   187   4e-54    
ref|XP_009044725.1|  hypothetical protein LOTGIDRAFT_207505             187   4e-54    
dbj|BAD96739.1|  SEC13-like 1 isoform b variant                         187   4e-54    
ref|XP_004581358.1|  PREDICTED: protein SEC13 homolog                   187   4e-54    
ref|XP_007888672.1|  PREDICTED: protein SEC13 homolog                   187   4e-54    
ref|NP_899195.1|  protein SEC13 homolog isoform 1                       187   4e-54    
ref|XP_010862020.1|  PREDICTED: protein SEC13 homolog                   187   4e-54    
pdb|3BG0|A  Chain A, Architecture Of A Coat For The Nuclear Pore ...    187   4e-54    
ref|XP_009468260.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    188   4e-54    
ref|XP_008248147.1|  PREDICTED: protein SEC13 homolog                   187   5e-54    
ref|XP_010375603.1|  PREDICTED: protein SEC13 homolog                   187   5e-54    
ref|XP_003894158.1|  PREDICTED: protein SEC13 homolog isoform X1        188   5e-54    
dbj|GAM20430.1|  hypothetical protein SAMD00019534_036050               187   5e-54    
ref|XP_007517208.1|  PREDICTED: protein SEC13 homolog                   190   5e-54    
dbj|GAN06362.1|  WD40 repeat-like protein                               187   5e-54    
ref|XP_007848859.1|  vesicle budding-related protein                    187   5e-54    
gb|KIY47815.1|  protein transporter SEC13                               188   6e-54    
ref|NP_001134240.1|  protein SEC13 homolog                              186   6e-54    
ref|XP_006631140.1|  PREDICTED: protein SEC13 homolog                   187   6e-54    
ref|XP_002470576.1|  predicted protein                                  184   6e-54    
ref|XP_010951346.1|  PREDICTED: protein SEC13 homolog                   187   6e-54    
dbj|BAD92791.1|  SEC13-like 1 isoform b variant                         186   6e-54    
ref|XP_009236976.1|  PREDICTED: protein SEC13 homolog isoform X1        188   6e-54    
ref|XP_010745417.1|  PREDICTED: protein SEC13 homolog                   187   6e-54    
gb|ADO28267.1|  sec13-like                                              187   6e-54    
ref|XP_007423317.1|  PREDICTED: protein SEC13 homolog                   187   7e-54    
emb|CEP11970.1|  hypothetical protein                                   186   8e-54    
ref|XP_002971002.1|  hypothetical protein SELMODRAFT_94917              186   8e-54    
gb|KIK69017.1|  hypothetical protein GYMLUDRAFT_188436                  187   8e-54    
ref|XP_008303874.1|  PREDICTED: protein SEC13 homolog                   186   8e-54    
ref|XP_005696117.1|  PREDICTED: protein SEC13 homolog                   186   9e-54    
gb|ETE71337.1|  Protein SEC13-like protein                              186   9e-54    
ref|XP_004274879.1|  PREDICTED: protein SEC13 homolog isoform 2         186   1e-53    
ref|XP_004274878.1|  PREDICTED: protein SEC13 homolog isoform 1         186   1e-53    
emb|CDQ92083.1|  unnamed protein product                                186   1e-53    
ref|XP_006077544.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
emb|CEI88084.1|  hypothetical protein RMCBS344292_02484                 185   1e-53    
ref|XP_002406173.1|  vesicle coat complex COPII, subunit SEC13, p...    186   1e-53    
ref|XP_003976966.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
ref|XP_011144386.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
ref|XP_010983235.1|  PREDICTED: protein SEC13 homolog                   187   1e-53    
ref|XP_005956736.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
ref|XP_003705427.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
ref|NP_001069033.1|  protein SEC13 homolog                              186   1e-53    
ref|XP_004018574.1|  PREDICTED: protein SEC13 homolog                   186   1e-53    
ref|XP_002813484.1|  PREDICTED: protein SEC13 homolog isoform X2        186   2e-53    
gb|ELR56129.1|  Protein SEC13-like protein                              186   2e-53    
ref|XP_004651480.1|  PREDICTED: protein SEC13 homolog                   186   2e-53    
ref|XP_008558049.1|  PREDICTED: protein SEC13 homolog                   186   2e-53    
ref|XP_005896173.1|  PREDICTED: protein SEC13 homolog                   186   2e-53    
ref|NP_001253899.1|  protein SEC13 homolog                              186   2e-53    
emb|CCM02720.1|  predicted protein                                      189   2e-53    
ref|XP_003224930.2|  PREDICTED: protein SEC13 homolog                   186   2e-53    
gb|AFK43487.1|  unknown                                                 183   2e-53    
ref|XP_011258903.1|  PREDICTED: protein SEC13 homolog                   185   2e-53    
gb|KIJ19381.1|  hypothetical protein PAXINDRAFT_174886                  186   3e-53    
ref|XP_002813485.1|  PREDICTED: protein SEC13 homolog isoform X3        185   3e-53    
gb|KDQ58034.1|  hypothetical protein JAAARDRAFT_34850                   186   3e-53    
ref|XP_001509095.2|  PREDICTED: protein SEC13 homolog                   185   3e-53    
ref|XP_006872266.1|  PREDICTED: protein SEC13 homolog                   184   3e-53    
ref|XP_003287675.1|  hypothetical protein DICPUDRAFT_151816             184   3e-53    
emb|CCF51698.1|  probable SEC13-protein transport protein               186   4e-53    
ref|XP_011306080.1|  PREDICTED: protein SEC13 homolog                   184   4e-53    
ref|XP_002429091.1|  protein transport protein sec13, putative          186   5e-53    
gb|KIK86600.1|  hypothetical protein PAXRUDRAFT_831899                  185   5e-53    
ref|XP_005106911.1|  PREDICTED: protein SEC13 homolog                   184   5e-53    
gb|EFA85457.1|  WD40 repeat-containing protein                          184   5e-53    
emb|CAF89860.1|  unnamed protein product                                184   5e-53    
emb|CEG77402.1|  Putative WD40 repeat-like protein                      184   6e-53    
gb|KIJ67346.1|  hypothetical protein HYDPIDRAFT_127263                  185   6e-53    
emb|CBQ70973.1|  probable SEC13-protein transport protein               186   6e-53    
ref|XP_008615576.1|  hypothetical protein SDRG_11321                    184   6e-53    
gb|KIM52349.1|  hypothetical protein SCLCIDRAFT_18187                   184   7e-53    
ref|XP_001845022.1|  transport protein SEC13                            184   7e-53    
gb|EST05777.1|  putative SEC13-protein transport protein                185   7e-53    
ref|XP_009824525.1|  hypothetical protein H257_02541                    184   7e-53    
ref|XP_009551293.1|  hypothetical protein HETIRDRAFT_421852             184   8e-53    
gb|KIO17537.1|  hypothetical protein M407DRAFT_246718                   184   9e-53    
tpg|DAA34484.1|  TPA: vesicle coat complex COPII subunit SEC13          182   9e-53    
gb|KDO31944.1|  hypothetical protein SPRG_03160                         184   9e-53    
emb|CEG81796.1|  Putative WD40 repeat-like protein                      183   1e-52    
gb|KDN35578.1|  WD40 repeat-like protein                                185   1e-52    
gb|EHJ78717.1|  putative protein transport protein sec13                183   1e-52    
gb|KFM60497.1|  Protein SEC13-like protein                              183   1e-52    
gb|KIP02372.1|  hypothetical protein PHLGIDRAFT_32221                   184   1e-52    
gb|ERZ97105.1|  hypothetical protein GLOINDRAFT_340332                  183   1e-52    
ref|XP_011160175.1|  PREDICTED: protein SEC13 homolog                   183   1e-52    
ref|XP_009269186.1|  Protein transport protein SEC13                    190   1e-52    
gb|EJT98067.1|  WD40 repeat-like protein                                184   2e-52    
ref|XP_001742270.1|  hypothetical protein                               183   2e-52    
ref|XP_008319422.1|  PREDICTED: protein SEC13 homolog                   183   2e-52    
ref|XP_011343632.1|  PREDICTED: protein SEC13 homolog                   183   2e-52    
ref|XP_007305823.1|  vesicle budding-like protein                       183   2e-52    
gb|ETS60765.1|  hypothetical protein PaG_04673                          184   2e-52    
ref|XP_007269359.1|  WD40 repeat-like protein                           184   2e-52    
emb|CDO70048.1|  hypothetical protein BN946_scf184650.g6                188   2e-52    
ref|XP_008863897.1|  hypothetical protein H310_02232                    182   3e-52    
gb|KIK21946.1|  hypothetical protein PISMIDRAFT_532584                  182   3e-52    
ref|XP_011388583.1|  putative protein transport protein                 184   3e-52    
gb|KIL60388.1|  hypothetical protein M378DRAFT_26525                    183   3e-52    
ref|XP_005870132.1|  PREDICTED: protein SEC13 homolog                   182   3e-52    
emb|CCJ30100.1|  unnamed protein product                                190   3e-52    
gb|KDQ26882.1|  hypothetical protein PLEOSDRAFT_1105781                 183   3e-52    
dbj|BAN21266.1|  protein transport protein sec13                        182   3e-52    
ref|XP_007409327.1|  hypothetical protein MELLADRAFT_43221              183   3e-52    
ref|XP_001838138.2|  protein transporter SEC13                          183   3e-52    
gb|ERE66933.1|  plasma membrane calcium-transporting ATPase 2 iso...    193   4e-52    
dbj|GAC98825.1|  hypothetical protein PHSY_006420                       185   4e-52    
dbj|GAK64138.1|  vesicle budding-like protein                           183   5e-52    
gb|ERE66934.1|  plasma membrane calcium-transporting ATPase 2 iso...    192   5e-52    
gb|KIY73878.1|  WD40 repeat-like protein                                182   5e-52    
ref|XP_011398741.1|  SEC13-like protein                                 181   5e-52    
gb|ERE66932.1|  plasma membrane calcium-transporting ATPase 2 iso...    192   5e-52    
gb|KIM29727.1|  hypothetical protein M408DRAFT_67279                    182   6e-52    
ref|XP_010197940.1|  PREDICTED: protein SEC13 homolog                   181   7e-52    
gb|ELW63485.1|  Protein SEC13 like protein                              180   8e-52    
ref|XP_011500941.1|  PREDICTED: protein SEC13 homolog                   181   9e-52    
ref|XP_005012129.1|  PREDICTED: protein SEC13 homolog                   181   9e-52    
ref|XP_007075532.1|  PREDICTED: protein SEC13 homolog isoform X2        181   9e-52    
ref|XP_005240252.1|  PREDICTED: protein SEC13 homolog                   181   9e-52    
gb|ELK34363.1|  Protein SEC13 like protein                              182   9e-52    
gb|ERL92416.1|  hypothetical protein D910_09730                         181   1e-51    
ref|XP_004392738.1|  PREDICTED: protein SEC13 homolog isoform 2         181   1e-51    
ref|XP_005632224.1|  PREDICTED: protein SEC13 homolog isoform X2        181   1e-51    
ref|XP_005600431.1|  PREDICTED: protein SEC13 homolog isoform X2        181   1e-51    
ref|XP_006457176.1|  hypothetical protein AGABI2DRAFT_196016            181   1e-51    
ref|XP_005288532.1|  PREDICTED: protein SEC13 homolog                   181   1e-51    
ref|XP_007766508.1|  WD40 repeat-like protein                           181   1e-51    
ref|XP_009564163.1|  PREDICTED: protein SEC13 homolog                   181   1e-51    
gb|KII90409.1|  hypothetical protein PLICRDRAFT_38938                   181   1e-51    
gb|EZA51201.1|  SEC13-like protein                                      180   2e-51    
ref|XP_011053770.1|  PREDICTED: protein SEC13 homolog                   180   2e-51    
ref|XP_007320210.1|  hypothetical protein SERLADRAFT_471545             181   2e-51    
ref|XP_011230339.1|  PREDICTED: protein SEC13 homolog isoform X2        180   2e-51    
ref|XP_788763.1|  PREDICTED: protein SEC13 homolog                      180   2e-51    
ref|XP_629794.1|  WD40 repeat-containing protein                        179   3e-51    
ref|XP_004033648.1|  PREDICTED: protein SEC13 homolog isoform 4         180   3e-51    
gb|KFQ30347.1|  Protein SEC13                                           179   3e-51    
ref|XP_004702299.1|  PREDICTED: protein SEC13 homolog isoform X1        180   3e-51    
ref|XP_010022441.1|  PREDICTED: protein SEC13 homolog                   179   3e-51    
gb|EMP35578.1|  Protein SEC13 like protein                              181   3e-51    
ref|XP_004702300.1|  PREDICTED: protein SEC13 homolog isoform X2        180   3e-51    
ref|XP_005754890.1|  PREDICTED: protein SEC13 homolog                   179   3e-51    
ref|XP_008980398.1|  PREDICTED: protein SEC13 homolog                   179   3e-51    
gb|EMS20580.1|  vesicle budding-related protein, protein transpor...    180   3e-51    
ref|XP_007983413.1|  PREDICTED: protein SEC13 homolog isoform X4        179   4e-51    
gb|KFP06692.1|  Protein SEC13                                           179   4e-51    
ref|XP_004923349.1|  PREDICTED: protein SEC13 homolog                   179   4e-51    
ref|XP_010123453.1|  PREDICTED: protein SEC13 homolog                   179   4e-51    
ref|NP_001129704.1|  protein SEC13 homolog isoform 2                    179   4e-51    
gb|KIJ53339.1|  hypothetical protein M422DRAFT_202256                   180   4e-51    
ref|XP_312881.4|  AGAP003183-PA                                         180   4e-51    
ref|XP_006024214.1|  PREDICTED: protein SEC13 homolog                   179   4e-51    
ref|XP_007868434.1|  WD40 repeat-like protein                           180   5e-51    
gb|KFB48498.1|  AGAP003183-PA-like protein                              179   6e-51    
ref|XP_010134784.1|  PREDICTED: protein SEC13 homolog                   179   6e-51    
ref|XP_008499612.1|  PREDICTED: protein SEC13 homolog                   179   6e-51    
ref|XP_005426717.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    181   6e-51    
ref|XP_005053372.1|  PREDICTED: protein SEC13 homolog                   179   7e-51    
ref|XP_004274880.1|  PREDICTED: protein SEC13 homolog isoform 3         178   9e-51    
ref|XP_004616069.1|  PREDICTED: protein SEC13 homolog                   178   9e-51    
ref|XP_009097616.1|  PREDICTED: LOW QUALITY PROTEIN: protein SEC1...    179   9e-51    
gb|KIK45891.1|  hypothetical protein CY34DRAFT_801043                   179   9e-51    
ref|XP_002052974.1|  GJ23624                                            179   9e-51    
ref|XP_006274225.1|  PREDICTED: protein SEC13 homolog                   178   1e-50    
ref|XP_001998472.1|  moj137                                             179   1e-50    
gb|KIM44026.1|  hypothetical protein M413DRAFT_443092                   179   1e-50    
gb|KFU93946.1|  Protein SEC13                                           178   1e-50    
gb|KDQ17387.1|  hypothetical protein BOTBODRAFT_156163                  179   1e-50    
ref|XP_010001682.1|  PREDICTED: protein SEC13 homolog                   178   1e-50    
gb|KDR66878.1|  hypothetical protein GALMADRAFT_258759                  179   1e-50    
gb|KFR14993.1|  Protein SEC13                                           177   2e-50    
ref|XP_005547864.1|  PREDICTED: protein SEC13 homolog isoform X4        177   2e-50    
ref|XP_001662344.1|  AAEL012240-PA                                      179   2e-50    
ref|XP_007878373.1|  hypothetical protein PFL1_02668                    180   2e-50    
ref|XP_002098417.1|  GE10367                                            179   2e-50    
ref|XP_007874241.1|  hypothetical protein PNEG_02252                    177   2e-50    
ref|XP_009236979.1|  PREDICTED: protein SEC13 homolog isoform X4        177   2e-50    
ref|XP_001357877.2|  GA19854                                            179   2e-50    
ref|XP_002032337.1|  GM26501                                            179   2e-50    
gb|ENN78132.1|  hypothetical protein YQE_05286                          180   3e-50    
ref|XP_001982150.1|  GG11201                                            178   3e-50    
ref|NP_651977.1|  Sec13 ortholog, isoform A                             178   3e-50    
ref|XP_001953926.1|  GF16993                                            179   3e-50    
ref|XP_009938282.1|  PREDICTED: protein SEC13 homolog                   178   3e-50    
ref|XP_969127.1|  PREDICTED: protein SEC13 homolog                      177   3e-50    
gb|AAD46849.2|AF160909_1  LD03471p                                      179   3e-50    



>emb|CDP02169.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+DTVHDVSMDYYGKRVATASSD++IK+IGVSNN+TSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVSMDYYGKRVATASSDSTIKVIGVSNNNTSQHLATLSGHQGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DGKVI+WKEGNQNEW+QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSLLASCSYDGKVIIWKEGNQNEWSQAHVFSDHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISVYTARSDG WD  RIDQAHP+GVT+VSWAPS APGALV
Sbjct  121  ACGSSDGNISVYTARSDGTWDITRIDQAHPVGVTSVSWAPSTAPGALV  168



>ref|NP_001275312.1| protein transport SEC13-like protein [Solanum tuberosum]
 gb|ABC01897.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=303

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+DTVHDV+MDYYGKRVATASSD +IKI GVSNN+TSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVTMDYYGKRVATASSDTTIKITGVSNNATSQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF++HKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSEHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVHTARSDGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  168



>ref|XP_011098538.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=302

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDV+MDYYGKRVATASSDA+IKIIG+SNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDVVHDVAMDYYGKRVATASSDATIKIIGISNNSTSQHLATLSGHQGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS LASCS+DGKVI+WKEGNQNEW+Q  VF DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSALASCSYDGKVIIWKEGNQNEWSQFQVFTDHKSSVNSIAWAPHELGFCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISVYTARSDGGWDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVYTARSDGGWDTTKIDQAHPVGVTSVSWAPSMAPGALV  168



>dbj|BAO49717.1| nuclear pore complex protein Sec13c [Nicotiana benthamiana]
Length=302

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAH+F+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHIFSDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+TARSDG WDT +IDQAHP+GVTAVSWAPSMAPGALV
Sbjct  121  ACGSSDGSISVHTARSDGLWDTTKIDQAHPVGVTAVSWAPSMAPGALV  168



>ref|XP_004232260.1| PREDICTED: protein transport protein SEC13 homolog B [Solanum 
lycopersicum]
Length=302

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+DTVHDV+MDYYGKRVATASSD +IKI GVSNN+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVTMDYYGKRVATASSDTTIKITGVSNNAASQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q  WAHPKFGS+LASCS+DGKVI+WKEGNQNEW QAHVF++HKSSVNSISWAPHELGLCL
Sbjct  61   QAGWAHPKFGSILASCSYDGKVIIWKEGNQNEWAQAHVFSEHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVHTARSDGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  168


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 8/129 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++A+   D ++K+  + N          L  H   V  V+WA P  G   S +AS S D
Sbjct  177  QKLASGGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWA-PNLGLPKSTIASASED  235

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            G V++W  G + +  +  V  D KS V  +SW+    G  LA  + D N++++    DG 
Sbjct  236  GTVVIWTVGKEGDQWEGKVLKDFKSPVWRVSWS--LTGNLLAVAAGDNNVTLWKEAVDGE  293

Query  591  WDTA-RIDQ  614
            W  A  +DQ
Sbjct  294  WQQASTVDQ  302



>ref|XP_009764554.1| PREDICTED: protein SEC13 homolog [Nicotiana sylvestris]
Length=302

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF+DH SSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFSDHISSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+TARSDG WDT +IDQAHP+GVTAVSWAPSMAPGALV
Sbjct  121  ACGSSDGSISVHTARSDGLWDTTKIDQAHPVGVTAVSWAPSMAPGALV  168



>dbj|BAO49718.1| nuclear pore complex protein Sec13d [Nicotiana benthamiana]
Length=302

 Score =   312 bits (800),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDV+MDYYGKRVATASSD +IKI GVS N+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVTMDYYGKRVATASSDTTIKITGVSYNAASQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSMLASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVHTARSDGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  168



>ref|XP_009623350.1| PREDICTED: protein SEC13 homolog [Nicotiana tomentosiformis]
Length=302

 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDVSMDYYGKRVATASSD +IKI+GVSNNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVSMDYYGKRVATASSDMTIKIVGVSNNSTSQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV+TARSDG WDT +IDQAHP+GV AVSWAPSMAPGALV
Sbjct  121  ACGSSDGCISVHTARSDGLWDTTKIDQAHPVGVIAVSWAPSMAPGALV  168



>gb|EYU44682.1| hypothetical protein MIMGU_mgv1a010776mg [Erythranthe guttata]
Length=302

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGHS+ VHDV+MDYYGKRVATASSDA+IKIIGV NNSTSQHLATL GH GPVW
Sbjct  1    MPAQKIETGHSNVVHDVAMDYYGKRVATASSDATIKIIGVGNNSTSQHLATLTGHQGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQ EW+Q HVF+DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVIIWKEGNQKEWSQFHVFSDHKSSVNSIAWAPHELGFCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISVYT+RSDGGW+T +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVYTSRSDGGWETTKIDQAHPVGVTSVSWAPSMAPGALV  168


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 14/132 (11%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++A+   D ++K+  + N S        L  H   V  V+WA P  G   S +AS S D
Sbjct  177  QKLASGGCDNTVKVWKLYNGSWKMDCFPALQMHSDWVRDVAWA-PNLGLPKSTIASASQD  235

Query  411  GKVIVW---KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARS  581
            G V+VW   KEG+Q E     V  D K+ V  +SW+    G  LA  S D N++++    
Sbjct  236  GTVVVWTAVKEGDQWE---GKVLKDFKNPVWRVSWS--LTGNLLAVASGDNNVTLWKESV  290

Query  582  DGGW-DTARIDQ  614
            DG W +   +DQ
Sbjct  291  DGEWQEVTTVDQ  302



>dbj|BAO49715.1| nuclear pore complex protein Sec13a [Nicotiana benthamiana]
Length=302

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDV+MDYYGKRVATASSD +IKI GVS N+ SQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDIVHDVTMDYYGKRVATASSDTTIKITGVSYNAASQHLATLSGHTGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q +WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QAAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVHTARSDGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  168



>ref|XP_003551869.1| PREDICTED: protein SEC13 homolog [Glycine max]
 gb|KHN12525.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFGSLLASCSFDG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSFDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|AGV54445.1| protein transport SEC13-like protein [Phaseolus vulgaris]
Length=301

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGV NN+ SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGV-NNTASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVIIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|KHM99531.1| Protein SEC13 like, partial [Glycine soja]
Length=358

 Score =   311 bits (797),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 161/170 (95%), Gaps = 1/170 (1%)
 Frame = +3

Query  168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP  347
            G MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GP
Sbjct  74   GNMPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGP  132

Query  348  VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL  527
            VWQV WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGL
Sbjct  133  VWQVVWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGL  192

Query  528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            CLACGSSDGNISV TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  193  CLACGSSDGNISVLTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  242



>ref|XP_002281856.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CAN73348.1| hypothetical protein VITISV_040760 [Vitis vinifera]
Length=301

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKRVATASSD +IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRVATASSDTTIKIIGVSNNA-SQHLATLIGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSILASCSYDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGTWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|KHN12541.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVVTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_006586096.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006586097.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVLTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|KDP43859.1| hypothetical protein JCGZ_20869 [Jatropha curcas]
Length=301

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGVSNN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRIATASSDHSIKIIGVSNN-TSQHLAQLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHEIGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_010099520.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB79400.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DT H ++MDYYGKR+ATASSDA+IKIIGVSNNS SQHLATL+GH GPVW
Sbjct  1    MPPQKIETGHQDTAHGIAMDYYGKRLATASSDATIKIIGVSNNSGSQHLATLSGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQNEW QAHVFNDHKSSVNSI WAPHELGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVIIWKEGNQNEWQQAHVFNDHKSSVNSIDWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHPIGVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTTRIDQAHPIGVTSVSWAPSMAPGALV  168



>ref|XP_010094976.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB57735.1| Protein SEC13-like protein [Morus notabilis]
Length=302

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVH ++MDYYGKR+ATASSDA+IKIIGVSNNS SQHLATL+GH GPVW
Sbjct  1    MPPQKIETGHQDTVHGIAMDYYGKRLATASSDATIKIIGVSNNSGSQHLATLSGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V WAHPKFGS+LASCS+DG+VI+WKEGNQNEW QAHVFNDHKSSVNSI WAPHELGL L
Sbjct  61   EVVWAHPKFGSILASCSYDGQVIIWKEGNQNEWQQAHVFNDHKSSVNSIDWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  168



>ref|XP_008380946.1| PREDICTED: protein transport protein SEC13-like [Malus domestica]
Length=335

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 1/169 (1%)
 Frame = +3

Query  171  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  350
            +MPAQK+ETGH DTVHDV MDYYGKR+ATASSD +IKIIGVSN S+SQHLATL GH GPV
Sbjct  34   EMPAQKVETGHQDTVHDVVMDYYGKRLATASSDNTIKIIGVSN-SSSQHLATLTGHQGPV  92

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            WQV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLC
Sbjct  93   WQVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLC  152

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  153  LACGSSDGNISVFTARSDGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  201



>ref|XP_010033246.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033247.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 ref|XP_010033248.1| PREDICTED: protein SEC13 homolog [Eucalyptus grandis]
 gb|KCW52833.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
 gb|KCW52834.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=302

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDV+MDYYGKRVATASSD +IKIIGVSN+S SQHLA+L+GH GPVW
Sbjct  1    MPSQKIETGHQDIVHDVAMDYYGKRVATASSDTTIKIIGVSNSSGSQHLASLSGHKGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+W QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGQVILWKEGNQNDWAQAHVFNDHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT RI+QAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVFTARPDGGWDTTRIEQAHPVGVTSVSWAPSMAPGALV  168



>gb|KHM99522.1| Protein SEC13 like [Glycine soja]
Length=301

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVLTARADGGWDTVRIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_007145729.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
 gb|ESW17723.1| hypothetical protein PHAVU_007G263000g [Phaseolus vulgaris]
Length=301

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGV NN+ SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGV-NNTASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCSFDG+VI+WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSFDGRVIIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGN+SV+TAR+DGGWDTA IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNVSVFTARADGGWDTAGIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_003551800.1| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
 ref|XP_006602184.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=301

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++W PHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWVPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVVTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_011085795.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   307 bits (786),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+D VHDVSMDYYGKRVATASSDA+IKIIGV NNSTSQHLATL+GH GPVW
Sbjct  1    MPAQKIETGHNDVVHDVSMDYYGKRVATASSDATIKIIGVGNNSTSQHLATLSGHQGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS LASCS+DGKVI+WKEGNQNEW+Q  VF DHKSSVNSI+WAPHELG CL
Sbjct  61   QVAWAHPKFGSALASCSYDGKVIIWKEGNQNEWSQFQVF-DHKSSVNSIAWAPHELGFCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISVYTA+S+GGWDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVYTAQSEGGWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_002265971.1| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
Length=301

 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGTWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|KCW52832.1| hypothetical protein EUGRSUZ_J02164 [Eucalyptus grandis]
Length=310

 Score =   306 bits (785),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDV+MDYYGKRVATASSD +IKIIGVSN+S SQHLA+L+GH GPVW
Sbjct  1    MPSQKIETGHQDIVHDVAMDYYGKRVATASSDTTIKIIGVSNSSGSQHLASLSGHKGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+W QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGQVILWKEGNQNDWAQAHVFNDHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT RI+QAHP+GVT+VSWAPSMAPGALV
Sbjct  121  ACGSSDGNISVFTARPDGGWDTTRIEQAHPVGVTSVSWAPSMAPGALV  168



>ref|XP_011021702.1| PREDICTED: protein transport protein SEC13 homolog B-like [Populus 
euphratica]
Length=301

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKI+GV+NNS SQHLA L GHHGPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIVGVNNNS-SQHLANLTGHHGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+W QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWIQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DG WDT+RIDQAHP GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGNWDTSRIDQAHPAGVTSVSWAPSMAPGALV  167



>dbj|BAJ10727.1| SEC13 family protein [Lotus japonicus]
 gb|AFK45896.1| unknown [Lotus japonicus]
Length=301

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATLAGH GPVW
Sbjct  1    MPAQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLAGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS++ASCS+DG+VI+WKEGNQNEW QAHVF+DHKSSVNS+ WAPHELGLCL
Sbjct  60   QVAWAHPKFGSMIASCSYDGRVIIWKEGNQNEWIQAHVFDDHKSSVNSVVWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSMAPGALV  167


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 7/121 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSN-NSTSQHLATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++ +   D ++K+  ++N N        L  H   V  V+WA P  G   S +AS S D
Sbjct  176  QKLCSGGCDNTVKVWKLTNGNWKMDCFPALHMHTDWVRDVAWA-PNLGLPKSTIASASQD  234

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            GKVI+W  G + +  +  + ND K+ V  +SW+    G  LA    + N++++    DG 
Sbjct  235  GKVIIWTVGKEGDQWEGKILNDFKTPVWRVSWS--LTGNILAVADGNNNVTLWKEAVDGE  292

Query  591  W  593
            W
Sbjct  293  W  293



>ref|XP_006586103.1| PREDICTED: protein SEC13 homolog isoform X2 [Glycine max]
Length=376

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  76   MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  134

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  135  QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  194

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  195  ACGSSDGNISVLTARADGGWDTVRIDQAHPVGVTSVSWAPSMAPGALV  242



>gb|ACU18089.1| unknown [Glycine max]
Length=301

 Score =   305 bits (782),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+ IVWKEGNQNEWTQAHVF+DHKSSVNS++W PHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRAIVWKEGNQNEWTQAHVFDDHKSSVNSVAWVPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDTARIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVVTARADGGWDTARIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_003532149.2| PREDICTED: protein SEC13 homolog isoform X1 [Glycine max]
Length=375

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  75   MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  133

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  134  QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  193

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  194  ACGSSDGNISVLTARADGGWDTVRIDQAHPVGVTSVSWAPSMAPGALV  241



>ref|XP_009759579.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759644.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759712.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759764.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759824.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759881.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
 ref|XP_009759950.1| PREDICTED: protein transport protein SEC13-like [Nicotiana sylvestris]
Length=302

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH+DTVHDVSMDYY KR+ATASSD +IKI+GV +NS SQHLA+L+GH GPVW
Sbjct  1    MPAQKIETGHNDTVHDVSMDYYRKRMATASSDNTIKIVGVGDNSASQHLASLSGHSGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAHVFSDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            AC SSDGNISV+ ARSDGGWDT +IDQAHP+GVT+VSWAPSM+PGA+V
Sbjct  121  ACASSDGNISVHNARSDGGWDTKKIDQAHPVGVTSVSWAPSMSPGAIV  168



>gb|ACU20139.1| unknown [Glycine max]
Length=301

 Score =   305 bits (780),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VIVWKEGNQNEWTQAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIVWKEGNQNEWTQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV TAR+DGGWDT  IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVLTARADGGWDTVSIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_006470402.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=302

 Score =   304 bits (779),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH DTVHDV+MD+YGKR+ATASSD+SIKIIG+SN S SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSN-SASQHLATLKGHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAH FNDHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAP+MAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTTRIDQAHPVGVTSVSWAPAMAPGALV  167



>emb|CAN81348.1| hypothetical protein VITISV_021485 [Vitis vinifera]
Length=301

 Score =   303 bits (777),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WD  +IDQAHPIGVT+VSWAP MAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGAWDPTKIDQAHPIGVTSVSWAPXMAPGALV  167



>emb|CAN79974.1| hypothetical protein VITISV_009154 [Vitis vinifera]
Length=312

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++IKIIGVSNN+ SQHL+TL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTIKIIGVSNNA-SQHLSTLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSHDGRVIIWKEGNQNDWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGAWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_010550097.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550098.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
 ref|XP_010550099.1| PREDICTED: protein transport protein SEC13 homolog B [Tarenaya 
hassleriana]
Length=302

 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH DTVHDV MDYYGKR+A+ASSD +IKIIGVSN+  SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVQMDYYGKRIASASSDCTIKIIGVSNSGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF +HKSSVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNEWTQAHVFTEHKSSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTTRIDQAHPVGVTSVSWAPATAPGALV  168



>gb|KHG11308.1| Protein SEC13 [Gossypium arboreum]
Length=314

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 161/171 (94%), Gaps = 1/171 (1%)
 Frame = +3

Query  165  EGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG  344
            +G+MP+QKIETGH DTVHDV+MD+YGKR+ATASSD++IKI GVSNN T QHLATL GH G
Sbjct  11   KGEMPSQKIETGHQDTVHDVAMDFYGKRIATASSDSTIKIAGVSNN-THQHLATLTGHQG  69

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVWQV+WAHPKFGSLLASC +DG+VI+WKEGNQNEW QAHVF+DHKSSVNSI+WAPHELG
Sbjct  70   PVWQVAWAHPKFGSLLASCCYDGRVILWKEGNQNEWAQAHVFDDHKSSVNSIAWAPHELG  129

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LCLACGSSDGNISV+TAR+DGGWD +RIDQAHP+GVT+VSWAPS APGALV
Sbjct  130  LCLACGSSDGNISVFTARADGGWDVSRIDQAHPVGVTSVSWAPSTAPGALV  180



>emb|CAN63472.1| hypothetical protein VITISV_000787 [Vitis vinifera]
Length=313

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD++ KIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTXKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNDWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGAWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>gb|KJB45573.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
 gb|KJB45574.1| hypothetical protein B456_007G314500 [Gossypium raimondii]
Length=301

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MD+YGKR+ATASSD++IKI+GVSNN T QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDFYGKRIATASSDSTIKIVGVSNN-THQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASC +DG+VI+WKEGNQNEW QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCCYDGRVIIWKEGNQNEWAQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWD +RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDVSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_011072420.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
 ref|XP_011072421.1| PREDICTED: protein transport protein SEC13 homolog B [Sesamum 
indicum]
Length=301

 Score =   303 bits (775),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDVVHDVAMDYYGKRLATASSDNTIKIIGVSN-SGSQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DGKV++WKEGNQNEWTQAHVF+DHK+SVNSISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVVIWKEGNQNEWTQAHVFDDHKASVNSISWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+ AR+DGGWD +RIDQAHPIGVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFMARADGGWDKSRIDQAHPIGVTSVSWAPSTAPGALV  167



>ref|XP_007144311.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
 gb|ESW16305.1| hypothetical protein PHAVU_007G145400g [Phaseolus vulgaris]
Length=301

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN + SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-TASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFGSLLASCS+DG+V +WKEGNQNEWTQAHVF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVVWAHPKFGSLLASCSYDGRVTIWKEGNQNEWTQAHVFDEHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDTA IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTAGIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_008462440.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKI++GH DTVHDVSMDYYGKR+AT SSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKIDSGHQDTVHDVSMDYYGKRLATVSSDQTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q +WAHPKFGSLLASCS+DG+VI+WKEGNQNEW+QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QAAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWSQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARQDGGWDTSRIDQAHPLGVTSVSWAPSSAPGALV  167



>gb|AFK36737.1| unknown [Lotus japonicus]
Length=212

 Score =   299 bits (766),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVS  + SQHLATL GH GPVW
Sbjct  1    MPGQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSI-AASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_002266827.2| PREDICTED: protein transport protein SEC13 homolog B [Vitis vinifera]
 emb|CBI39765.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD+++KIIGVSNN+ SQHLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTVKIIGVSNNA-SQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQN+WTQAHVF+D KSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSCDGRVIIWKEGNQNDWTQAHVFSDRKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARSDGAWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_009603401.1| PREDICTED: protein transport protein SEC13-like [Nicotiana tomentosiformis]
Length=183

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M  QKIETGH+D VHDVSMDYYGKR+AT+SSD +IKI+GVSNNS SQHLATL+GH G VW
Sbjct  1    MHVQKIETGHNDIVHDVSMDYYGKRMATSSSDMTIKIVGVSNNSASQHLATLSGHTGHVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+W HPKFGS+LASCS+DGKV++WKEGNQNEWTQAHVF DHKSSVNSISWAPHELGLCL
Sbjct  61   QVAWTHPKFGSILASCSYDGKVVIWKEGNQNEWTQAHVFGDHKSSVNSISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
             CGSSDG+ISV+TARSDG WDT +IDQAHP+GVT VSWAPSMAPGALV
Sbjct  121  GCGSSDGSISVHTARSDGLWDTTKIDQAHPVGVTTVSWAPSMAPGALV  168



>ref|XP_002321555.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374503.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 ref|XP_006374504.1| transport protein SEC13 [Populus trichocarpa]
 gb|EEF05682.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52300.1| hypothetical protein POPTR_0015s080101g [Populus trichocarpa]
 gb|ERP52301.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV+NN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIIGVNNN-TSQHLANLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DG WDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGNWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_006446433.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|ESR59673.1| hypothetical protein CICLE_v10016079mg [Citrus clementina]
 gb|KDO66291.1| hypothetical protein CISIN_1g022111mg [Citrus sinensis]
Length=302

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH DTVHDV+MD+YGKR+ATASSD+SIKIIG+SN S SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDTVHDVAMDFYGKRLATASSDSSIKIIGLSN-SASQHLATLKGHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAH FNDHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSILASCSYDGQVIIWKEGNQNDWTQAHTFNDHKSSVNSIAWAPHELGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TA +DGGWDT RIDQAHP+GVT+VSWAP+MAPGALV
Sbjct  120  ACGSSDGNISVFTATADGGWDTTRIDQAHPVGVTSVSWAPAMAPGALV  167



>ref|XP_004141658.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004155955.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN45591.1| hypothetical protein Csa_7G452950 [Cucumis sativus]
Length=301

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPA KI++GH DTVHDVSMDYYGKR+AT SSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPALKIDSGHQDTVHDVSMDYYGKRLATVSSDQTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q +WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QAAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARQDGGWDTSRIDQAHPLGVTSVSWAPSSAPGALV  167



>ref|XP_010272104.1| PREDICTED: protein transport protein SEC13 homolog B [Nelumbo 
nucifera]
Length=301

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD++IKIIGV  +S SQ LATL+GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVAMDYYGKRLATASSDSTIKIIGV-GSSGSQDLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEWTQA +F DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWTQAQIFTDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT +IDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTTKIDQAHPVGVTSVSWAPSMAPGALV  167



>ref|XP_007024275.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY26897.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=312

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV+MDYYGKR+A+ASSD +IKI GVSNN T QHLATL+ H GPVW
Sbjct  1    MPPQKIETGHQDTVHDVAMDYYGKRIASASSDTTIKIAGVSNN-THQHLATLSAHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW+QAHVF DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNEWSQAHVFEDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_002315836.1| transport protein SEC13 [Populus trichocarpa]
 gb|ABK92752.1| unknown [Populus trichocarpa]
 gb|ABK93029.1| unknown [Populus trichocarpa]
 gb|EEF02007.1| transport protein SEC13 [Populus trichocarpa]
Length=301

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV+MDYYGKR+ATASSD SIKI+GV+NNS SQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVAMDYYGKRIATASSDHSIKIVGVNNNS-SQHLANLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+W QAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWIQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DG WDT+RIDQAHP GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGNWDTSRIDQAHPAGVTSVSWAPSTAPGALV  167



>ref|XP_011028666.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028667.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028668.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
 ref|XP_011028669.1| PREDICTED: protein transport protein SEC13 homolog B [Populus 
euphratica]
Length=301

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV MDYYGKR+ATASSD SIKIIGV+NN TSQHLA L GH GPVW
Sbjct  1    MPSQKIETGHEDTVHDVVMDYYGKRIATASSDHSIKIIGVNNN-TSQHLANLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPHELGL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFEDHKSSVNSIAWAPHELGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DG WDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGNWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>gb|KEH33918.1| transducin/WD-like repeat-protein [Medicago truncatula]
Length=301

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH D +HDVSMDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPSQKVETGHQDIIHDVSMDYYGKRLATASSDHTIKIIGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   EVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWIQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            AC SSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACASSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSMAPGALV  167


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 7/121 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++ +   D ++K+  +SN          L  H+  V  V+WA P  G   S +AS S D
Sbjct  176  QKLCSGGCDNTVKVWKLSNGQWKMDCFPALQKHNDWVRDVAWA-PNLGLPKSTIASASQD  234

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            GKVI+W  G + +  +    ND K+ V  +SW+    G  LA    + N++++    DG 
Sbjct  235  GKVIIWTAGKEGDHWEGKDLNDFKTPVWRVSWS--LTGNILAVADGNNNVTLWKEAVDGE  292

Query  591  W  593
            W
Sbjct  293  W  293



>ref|XP_007215469.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
 gb|EMJ16668.1| hypothetical protein PRUPE_ppa006517mg [Prunus persica]
Length=408

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +3

Query  171  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  350
            +MPAQK+ETGH DT+HDV MDYYGKR+AT S+D ++KIIGVSN S SQHLATL GH GPV
Sbjct  107  EMPAQKVETGHQDTIHDVVMDYYGKRLATGSADNTVKIIGVSN-SASQHLATLTGHQGPV  165

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            WQV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAH+F+DHKSSVNSI+WAPHELGLC
Sbjct  166  WQVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWIQAHIFDDHKSSVNSIAWAPHELGLC  225

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  226  LACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  274



>ref|XP_010267185.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
 ref|XP_010267187.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=301

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH DTVHDV MDYYGKR+ATASSD +IKIIGVS  S SQHLATL+GH GPVW
Sbjct  1    MPSQKIETGHQDTVHDVVMDYYGKRLATASSDTTIKIIGVST-SASQHLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQNEWTQAHVF+DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGRVIIWKEGNQNEWTQAHVFDDHKASVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAH +GVT+VSWAPS APG LV
Sbjct  120  ACGSSDGNISVFTARADGGWDTTRIDQAHLVGVTSVSWAPSTAPGGLV  167



>ref|XP_010551882.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551884.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551885.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
 ref|XP_010551886.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=301

 Score =   299 bits (766),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D VHDV MDYYGKRVATASSD +IKI GV N++ SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVGNSAGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKE NQNEWTQAHVF +HKSSVNSISWAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVIIWKEDNQNEWTQAHVFTEHKSSVNSISWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDTARIDQAHP+GVT+VSWAP+ +PGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTARIDQAHPVGVTSVSWAPATSPGALV  168



>ref|XP_010524317.1| PREDICTED: protein transport protein SEC13 homolog B-like [Tarenaya 
hassleriana]
Length=302

 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D VHDV MDYYGKRVATASSD +IKIIGV+++  SQHLATL GH GPVW
Sbjct  1    MPAQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKIIGVNSSGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+V +WKEGNQNEWTQAHVF +HKSSVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSILASCSYDGQVTIWKEGNQNEWTQAHVFTEHKSSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAPS APGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTTRIDQAHPVGVTSVSWAPSTAPGALV  168



>ref|XP_004150601.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 ref|XP_004171462.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN58046.1| hypothetical protein Csa_3G462670 [Cucumis sativus]
Length=301

 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DT+HDV+MDYYGKRVA+ASSD +IKI GVSN++T QHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDTIHDVAMDYYGKRVASASSDQTIKITGVSNSAT-QHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFG LLASCS+DG+VI+WKEGNQNEW+QAH+F+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGPLLASCSYDGRVIIWKEGNQNEWSQAHIFDDHKSSVNSIAWAPHEVGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS  PGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTTPGALV  167



>ref|XP_004512728.1| PREDICTED: protein SEC13 homolog isoform X1 [Cicer arietinum]
 ref|XP_004512729.1| PREDICTED: protein SEC13 homolog isoform X2 [Cicer arietinum]
Length=301

 Score =   299 bits (765),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQ LATL GH GPVW
Sbjct  1    MPSQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSN-SASQPLATLTGHEGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGSLLASCS+DG+VI+WKEGNQNEW QAHVF+DHKSSVNS++WAPHELGLCL
Sbjct  60   EVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWVQAHVFDDHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            AC SSDGNIS++TAR+DGGWDT+RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  120  ACASSDGNISIFTARADGGWDTSRIDQAHPVGVTSVSWAPSMAPGALV  167



>emb|CAN80755.1| hypothetical protein VITISV_027966 [Vitis vinifera]
Length=301

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKI+TGH DTVHDV+MDYYGKRVATASSD+++KIIGVSNN+ S HLATL GH GPVW
Sbjct  1    MPSQKIKTGHQDTVHDVAMDYYGKRVATASSDSTVKIIGVSNNA-SLHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSHDGRVIIWKEGNQNEWTQAHVFSDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDG WDT +IDQAHP+GVT+VSWAPSM  GALV
Sbjct  120  ACGSSDGNISVFTARSDGAWDTTKIDQAHPVGVTSVSWAPSMPSGALV  167



>ref|XP_006410056.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51509.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=383

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = +3

Query  135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ  314
            D  F R S   G MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQ
Sbjct  70   DRAFSRES-HSGNMPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQ  128

Query  315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN  494
            HLATL GH GPVW+V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVN
Sbjct  129  HLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVN  188

Query  495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            SI+WAPHELGL LACGSSDGNISV+T R+DGGWDTA+IDQAH +GVT+VSWAP+ APGAL
Sbjct  189  SIAWAPHELGLSLACGSSDGNISVFTGRADGGWDTAKIDQAHSVGVTSVSWAPATAPGAL  248

Query  675  V  677
            V
Sbjct  249  V  249


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  ++N S        L  H   V 
Sbjct  245  PGALVSSGSLDPVY---------KLASGGCDDTVKVWKLTNGSWKMDCYPGLKKHTDWVR  295

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  296  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTG  352

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W    +
Sbjct  353  NLLAVSDGNNNVTVWKEAVDGEWQQVTV  380



>ref|XP_006410057.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
 gb|ESQ51510.1| hypothetical protein EUTSA_v10016789mg [Eutrema salsugineum]
Length=384

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ  314
            D  F       G MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQ
Sbjct  70   DRAFSSRESHSGNMPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQ  129

Query  315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN  494
            HLATL GH GPVW+V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVN
Sbjct  130  HLATLTGHRGPVWEVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVN  189

Query  495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            SI+WAPHELGL LACGSSDGNISV+T R+DGGWDTA+IDQAH +GVT+VSWAP+ APGAL
Sbjct  190  SIAWAPHELGLSLACGSSDGNISVFTGRADGGWDTAKIDQAHSVGVTSVSWAPATAPGAL  249

Query  675  V  677
            V
Sbjct  250  V  250


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  ++N S        L  H   V 
Sbjct  246  PGALVSSGSLDPVY---------KLASGGCDDTVKVWKLTNGSWKMDCYPGLKKHTDWVR  296

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  297  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTG  353

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W    +
Sbjct  354  NLLAVSDGNNNVTVWKEAVDGEWQQVTV  381



>ref|XP_008379297.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008379298.1| PREDICTED: protein SEC13 homolog [Malus domestica]
 ref|XP_008348048.1| PREDICTED: protein SEC13 homolog [Malus domestica]
Length=300

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH DTVHDV+MDYYGKR+ATASSDA+IKIIGV N   SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDTVHDVAMDYYGKRLATASSDATIKIIGVGN--ASQHLATLSAHSGPVW  58

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSISWAPHELGL L
Sbjct  59   EVAWAHPKFGSILASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLIL  118

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT +IDQAHP+GVT+VSWAP+MAPGALV
Sbjct  119  ACGSSDGNISVFTARADGGWDTTKIDQAHPVGVTSVSWAPAMAPGALV  166



>ref|XP_007215747.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
 gb|EMJ16946.1| hypothetical protein PRUPE_ppa009252mg [Prunus persica]
Length=300

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV   S SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDIVHDVAMDYYGKRLATASSDATIKIIGV--GSGSQHLATLSAHRGPVW  58

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGSLLASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSI+WAPHELGL L
Sbjct  59   EVAWAHPKFGSLLASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSIAWAPHELGLSL  118

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAPSMAPGALV
Sbjct  119  ACGSSDGNISVFTARADGGWDTTRIDQAHPVGVTSVSWAPSMAPGALV  166



>ref|XP_008230683.1| PREDICTED: protein SEC13 homolog [Prunus mume]
Length=300

 Score =   297 bits (760),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV   S SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDIVHDVAMDYYGKRLATASSDATIKIIGV--GSGSQHLATLSAHRGPVW  58

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGSLLASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSI+WAPHELGL L
Sbjct  59   EVAWAHPKFGSLLASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSIAWAPHELGLSL  118

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT RIDQAHPIGVT+VSWAPSMAPGALV
Sbjct  119  ACGSSDGNISVFTARPDGGWDTTRIDQAHPIGVTSVSWAPSMAPGALV  166



>ref|XP_009335780.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
 ref|XP_009335781.1| PREDICTED: protein SEC13 homolog [Pyrus x bretschneideri]
Length=300

 Score =   296 bits (759),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH DTVHDV+MDYYGKR+ATASSDA+IKIIGV N   SQHLATL+ H GPVW
Sbjct  1    MPAQKIETGHQDTVHDVAMDYYGKRLATASSDATIKIIGVGN--ASQHLATLSVHSGPVW  58

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QAHVFNDHKSSVNSISWAPHELGL L
Sbjct  59   EVAWAHPKFGSILASCSYDGQVIIWKEGNPNEWQQAHVFNDHKSSVNSISWAPHELGLIL  118

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT +IDQAHP+GVT+VSWAP+MAPGALV
Sbjct  119  ACGSSDGNISVFTARADGGWDTTKIDQAHPVGVTSVSWAPAMAPGALV  166



>dbj|BAJ10728.1| SEC13 family protein [Lotus japonicus]
Length=301

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 158/168 (94%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QK+ETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVS  + SQHLATL GH GPVW
Sbjct  1    MPGQKVETGHQDTVHDVAMDYYGKRLATASSDHTIKIIGVSI-AASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEG+QNEWTQAHVF++HKSSVNS++WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGDQNEWTQAHVFDEHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+D GWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADVGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>emb|CDY24035.1| BnaC03g16560D [Brassica napus]
Length=301

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSFLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R+DGGWDT +IDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGNISVFTGRADGGWDTTKIDQAHPVGVTSVSWAPATAPGALV  168


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NMLAVSDGNNNMTVWKEAVDGEWEQVTV  299



>emb|CDP21792.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   295 bits (755),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD +IKIIGVSN S SQ LATL+GH GPVW
Sbjct  1    MPGQKIETGHQDTVHDVAMDYYGKRLATASSDNTIKIIGVSN-SNSQPLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSL+ASCS+DGKVI+W+EGNQNEW+QAH+F DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLVASCSYDGKVIIWREGNQNEWSQAHLFGDHKASVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNIS++TARSDG WDT++IDQAHP+GVT+VSWAPS  PGALV
Sbjct  120  ACGSSDGNISIFTARSDGSWDTSQIDQAHPVGVTSVSWAPSTGPGALV  167



>gb|AAM65185.1| transport protein SEC13, putative [Arabidopsis thaliana]
Length=301

 Score =   295 bits (754),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D+++K+   SN S        L  H   V 
Sbjct  164  PGALVSSGMIDPVY---------KLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G   +W +  V  D K+ V  +SW+     
Sbjct  215  DVAWA-PNLGLPKSTIASGSEDGKVIIWTIGKGEQW-EGTVLKDFKTPVWRVSWS--LTA  270

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  271  NLLAVSDGNNNVTVWKESVDGEWEQVTV  298



>ref|NP_186783.1| transport protein SEC13B [Arabidopsis thaliana]
 ref|NP_001030616.1| transport protein SEC13B [Arabidopsis thaliana]
 sp|Q9SRI1.1|SC13A_ARATH RecName: Full=Protein transport protein SEC13 homolog A; AltName: 
Full=SEC13-like protein A [Arabidopsis thaliana]
 gb|AAF03492.1|AC010676_2 putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAK44077.1|AF370262_1 putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AAL34253.1| putative transport protein SEC13 [Arabidopsis thaliana]
 gb|AEE73651.1| transport protein SEC13B [Arabidopsis thaliana]
 gb|AEE73652.1| transport protein SEC13B [Arabidopsis thaliana]
Length=302

 Score =   294 bits (753),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 68/148 (46%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D+++K+   SN S        L  H   V 
Sbjct  164  PGALVSSGMIDPVY---------KLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D K+ V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NLLAVSDGNNNVTVWKESVDGEWEQVTV  299



>dbj|BAO49716.1| nuclear pore complex protein Sec13b [Nicotiana benthamiana]
Length=301

 Score =   294 bits (753),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 160/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +I+I GVS+ S+SQ LATL+GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIRITGVSS-SSSQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ AHVF+DHK+SVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLAHVFDDHKASVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGW+T+RIDQAHP+GVT+VSWAPSMAPG+LV
Sbjct  120  ACGSSDGNISVFTARSDGGWETSRIDQAHPVGVTSVSWAPSMAPGSLV  167



>emb|CDX84863.1| BnaA03g13670D [Brassica napus]
Length=301

 Score =   294 bits (752),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKRVATASSDCTIKITGVSNNGGSQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSFLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R+DGGWDT +IDQAHP+GVT+VSWAP+ +PGALV
Sbjct  121  ACGSSDGNISVFTGRADGGWDTTKIDQAHPVGVTSVSWAPATSPGALV  168


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  +  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKILKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NMLAVSDGNNNVTVWKEAVDGEWEQVTV  299



>gb|KDO51761.1| hypothetical protein CISIN_1g036510mg, partial [Citrus sinensis]
Length=288

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_006465678.1| PREDICTED: protein SEC13 homolog [Citrus sinensis]
Length=301

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_011080528.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080536.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080543.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080551.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080561.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080569.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080578.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080587.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
 ref|XP_011080595.1| PREDICTED: protein transport protein SEC13 homolog B-like [Sesamum 
indicum]
Length=301

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGVSN S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDIVHDVAMDYYGKRLATASSDNAIKIIGVSN-SRSQHLATLTGHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DGKV++WKEGNQNEW QAHVF+DHK+SVN ISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVVIWKEGNQNEWIQAHVFDDHKASVNCISWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGS+DGNISV+TARSDGGWD ++I+QAHP+GVT+V+WAPS A GAL+
Sbjct  120  ACGSTDGNISVFTARSDGGWDKSQIEQAHPVGVTSVTWAPSTALGALI  167



>ref|XP_006426897.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
 gb|ESR40137.1| hypothetical protein CICLE_v10026168mg [Citrus clementina]
Length=301

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV+MDYYGKR+ATASSD SIKIIGV NN TSQHLA L+GH G VW
Sbjct  1    MPPQKIETGHEDTVHDVAMDYYGKRLATASSDYSIKIIGVGNN-TSQHLAKLSGHKGAVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCSFDG VI+WKEGN NEW + HVF DHKSSVNSI WAPHELGLCL
Sbjct  60   EVAWAHPKFGSILASCSFDGTVIIWKEGNSNEWIKDHVFEDHKSSVNSIDWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_010510416.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=302

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVTNNGGSQPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R DGGWDTARIDQAHP+GVT+V+WAP+ APGALV
Sbjct  121  ACGSSDGNISVFTGRPDGGWDTARIDQAHPVGVTSVTWAPATAPGALV  168


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLFDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G ++E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NLLAVSDGNNNVTVWKESVDGEWEQVTL  299



>gb|AAM65095.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
Length=302

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct  61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPATAPGALV  168



>ref|XP_008790006.1| PREDICTED: protein SEC13 homolog [Phoenix dactylifera]
Length=302

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 160/169 (95%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EWTQAH+F++HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWTQAHIFSEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAP+MAPG+LV
Sbjct  120  LACGSSDGNISVFTARTDGGWDTTRIDQAHPVGVTSVSWAPAMAPGSLV  168



>ref|XP_010687899.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687900.1| PREDICTED: protein transport protein SEC13 homolog B [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IK++ VS+NS SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHSDVVHDVQMDYYGKRIATASSDTTIKVLAVSSNSGSQPLATLTGHQGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEGNQN W QAHVF++HKSSVN+ISWAPHELGLCL
Sbjct  61   QVAWAHPKFGSILASCSYDGRVIIWKEGNQNVWEQAHVFHEHKSSVNAISWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+T RSDGGW+T RIDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGSISVFTVRSDGGWETNRIDQAHPVGVTSVSWAPATAPGALV  168


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 7/120 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D ++K+  + N S        L  H   V  VSWA P  G   S +AS S DG
Sbjct  178  KLASGGCDNTVKVWKLVNGSWKMDCFPALQMHSDWVRDVSWA-PNLGLPKSTIASASQDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
             V++W  G + E  +  + ND K+ V  +SW+    G  LA    D N+S++    DG W
Sbjct  237  SVVIWTVGKEGEQWEGKILNDFKTPVWRVSWS--LTGNLLAVADGDNNVSLWKEAVDGEW  294



>ref|NP_180566.1| transport protein SEC13A [Arabidopsis thaliana]
 sp|O64740.1|SC13B_ARATH RecName: Full=Protein transport protein SEC13 homolog B; AltName: 
Full=SEC13-like protein B [Arabidopsis thaliana]
 gb|AAL06565.1|AF412112_1 At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AAC16967.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM14986.1| putative protein transport protein SEC13 [Arabidopsis thaliana]
 gb|AAM70557.1| At2g30050/F23F1.3 [Arabidopsis thaliana]
 gb|AEC08339.1| transport protein SEC13A [Arabidopsis thaliana]
Length=302

 Score =   292 bits (747),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct  61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPATAPGALV  168


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (46%), Gaps = 16/144 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  ++N S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLANGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWD  596
              LA    + N++V+    DG W+
Sbjct  272  NLLAVSDGNNNVTVWKEAVDGEWE  295



>ref|XP_010929133.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEGN+ +EW QAH+F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGNKPDEWAQAHIFTEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV TAR+DGGWDT RIDQAHP+GVT++SWAP+MAPGALV
Sbjct  120  LACGSSDGNISVLTARTDGGWDTTRIDQAHPVGVTSISWAPAMAPGALV  168



>ref|XP_006294683.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
 gb|EOA27581.1| hypothetical protein CARUB_v10023720mg [Capsella rubella]
Length=302

 Score =   291 bits (746),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DTVHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDTVHDVQMDYYGKRIATASSDCTIKITGVNNNGGSQPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R DGGW+T RIDQAHP+GVT+V+WAP+ APGALV
Sbjct  121  ACGSSDGNISVFTGRPDGGWETTRIDQAHPVGVTSVTWAPATAPGALV  168


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLQDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTMGKEGEQWEGTVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NLLAVSDGNNNVTVWKESVDGEWEQVTV  299



>emb|CDY02025.1| BnaC04g14760D [Brassica napus]
Length=303

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            MP QKIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN   SQHLATL GH GPV
Sbjct  1    MPGQKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGGGSQHLATLTGHRGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHK+SVNSI+WAP+ELGL 
Sbjct  61   WEVAWAHPKFGSMLASCSYDGQVILWKEGSQNQWTQAHVFTDHKTSVNSIAWAPYELGLS  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+T R DGGWDT +IDQAHP+GVT+VSWAPS APGALV
Sbjct  121  LACGSSDGNISVFTGRGDGGWDTTKIDQAHPVGVTSVSWAPSTAPGALV  169


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 67/143 (47%), Gaps = 16/143 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  165  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  215

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKV++W  G + E  +  V ND K+ V  +SW+    G
Sbjct  216  GVAWA-PNLGLPKSTIASGSQDGKVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWS--LTG  272

Query  525  LCLACGSSDGNISVYTARSDGGW  593
              LA    + N++V+    DG W
Sbjct  273  NLLAVSDGNNNVTVWKEAVDGEW  295



>ref|XP_010469902.1| PREDICTED: protein transport protein SEC13 homolog B [Camelina 
sativa]
Length=302

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GV+NN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVNNNGGSQPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGNQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSILASCSYDGQVILWKEGNQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R DGGWDT RIDQAHP+GVT+V+WAP+ APGALV
Sbjct  121  ACGSSDGNISVFTGRPDGGWDTTRIDQAHPVGVTSVTWAPATAPGALV  168


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G ++E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  272  NLLAVSDGNNNVTVWKESVDGEWEQVTL  299



>ref|XP_002515980.1| protein transport protein sec13, putative [Ricinus communis]
 gb|EEF46400.1| protein transport protein sec13, putative [Ricinus communis]
Length=301

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH DT+HDV MDYYGKR+ATASSD SIKIIGVSNN TSQ LA L GH GPVW
Sbjct  1    MPPQKIETGHEDTIHDVVMDYYGKRIATASSDHSIKIIGVSNN-TSQQLAKLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEG QN+WTQAHVF+DHKSSVNSI+WAPHE+GLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVIIWKEGVQNDWTQAHVFDDHKSSVNSIAWAPHEVGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV T R+DGGWD + I+QAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVLTVRADGGWDKSNIEQAHPVGVTSVSWAPSTAPGALV  167



>gb|KCW84259.1| hypothetical protein EUGRSUZ_B01116 [Eucalyptus grandis]
Length=301

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIE+GH DTVHD++MDYYGKR+ATASSD +I ++GVS+ S SQHLATL GH GPVW
Sbjct  1    MPPQKIESGHKDTVHDLAMDYYGKRLATASSDHTINVVGVSS-SGSQHLATLIGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            Q+SWAHPKFGSLLASCS+DG+VI+W+EGN NEWTQA VF +HKSSVNS++WAPHELGLCL
Sbjct  60   QISWAHPKFGSLLASCSYDGRVIIWREGNPNEWTQAQVFEEHKSSVNSVAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DGGWDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARQDGGWDTSRIDQAHPVGVTSVSWAPSTAPGALV  167



>ref|XP_004302867.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=300

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV+TA+ DG W+T +ID+AHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGTISVFTAK-DGVWETTKIDEAHPVGVTSVSWAPSTAPGALV  166



>ref|XP_006408491.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
 gb|ESQ49944.1| hypothetical protein EUTSA_v10021223mg [Eutrema salsugineum]
Length=302

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSD VHDV MDYYGKRVATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQNEWT AHVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIIIWKEGNQNEWTLAHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+ +K+   +N S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSKVKVWRFANGSWKMDCFPALDKHTDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D K+ V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVIIWTIGKEGEQWEGKVLKDFKTPVWRVSWS--LTGNLLAVSDGNNNVTVWKEAVDGEW  294

Query  594  DTARI  608
            +   +
Sbjct  295  EQVTV  299



>ref|XP_007032314.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY03240.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=301

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQ+IETGH DTVHDV+MDYYGKR+ATASSD ++KIIG+++ S SQ LA L GH GP+W
Sbjct  1    MPAQRIETGHEDTVHDVAMDYYGKRLATASSDTTVKIIGITS-SGSQQLAILHGHKGPIW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEGN NEW QA VFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   EVAWAHPKFGSVLASCSYDGQVIIWKEGNPNEWVQAQVFNDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DGGWD  RIDQAHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGNISVFTARADGGWDATRIDQAHPVGVTSVSWAPSTAPGALV  167



>gb|KDP40875.1| hypothetical protein JCGZ_24874 [Jatropha curcas]
Length=301

 Score =   289 bits (739),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M  QKIE+GH DTVH+V+MDYYGKRVATA SD SI IIGV NN TS  LA L+GH GPVW
Sbjct  1    MLPQKIESGHEDTVHEVAMDYYGKRVATALSDNSINIIGVGNN-TSLPLAKLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFG+LLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSISWAPHE+GLCL
Sbjct  60   QVAWAHPKFGALLASCSYDGRVIIWKEGNQNEWTQAHVFDDHKSSVNSISWAPHEVGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+TAR+DGGWDTARIDQAHP+GVT+VSWAPS  PGALV
Sbjct  120  ACGSSDGSISVFTARADGGWDTARIDQAHPVGVTSVSWAPSTTPGALV  167



>ref|XP_002879246.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55505.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score =   289 bits (739),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct  1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+W+E NQN+WTQAHVF DHKSSVNSI+WAPH+LGL L
Sbjct  61   EVAWAHPKFGSMLASCSYDGQVILWEEANQNQWTQAHVFTDHKSSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV T+R+DGGWDT RIDQAHP+GVT+VSWAP+ APGALV
Sbjct  121  ACGSSDGNISVLTSRADGGWDTTRIDQAHPVGVTSVSWAPATAPGALV  168


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 66/144 (46%), Gaps = 16/144 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  164  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  214

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G + E  +  V  D  + V  +SW+    G
Sbjct  215  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTG  271

Query  525  LCLACGSSDGNISVYTARSDGGWD  596
              LA    + N++V+    DG W+
Sbjct  272  NLLAVSDGNNNVTVWKEAVDGEWE  295



>emb|CDY10705.1| BnaA05g12310D [Brassica napus]
Length=365

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M   KIETGH DTVHDV MDYYGKRVATASSD +IKI GVSNN  SQHLATL GH GPVW
Sbjct  1    MAGHKIETGHEDTVHDVQMDYYGKRVATASSDCTIKITGVSNNGASQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            +V+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHK+SV+SI+WAP+ELGL L
Sbjct  61   EVAWAHPKFGSMLASCSYDGQVILWKEGSQNQWTQAHVFTDHKTSVSSIAWAPYELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R DGGWDT +IDQAHP+GVT+VSWAPS APGALV
Sbjct  121  ACGSSDGNISVFTGRGDGGWDTTKIDQAHPVGVTSVSWAPSTAPGALV  168


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 7/120 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D ++K+  +SN S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHSDWVRDVAWA-PNLGLPKSTIASGSQDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KV++W  G + E  +  V ND K+ V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVVIWTVGKEGEQWEGKVLNDFKAPVWRVSWSL--TGNLLAVSDGNNNVTVWKEAVDGEW  294



>ref|XP_011466664.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=312

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV+TA+ DG W+T +ID+AHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGTISVFTAK-DGVWETTKIDEAHPVGVTSVSWAPSTAPGALV  166



>ref|XP_011466663.1| PREDICTED: protein transport protein SEC13 homolog A-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=313

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 156/168 (93%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQK+ETGH +TVHDV MDYYGKR+ATASSD +IKI+GVSN S SQHLATL GH GPVW
Sbjct  1    MPAQKVETGHQETVHDVVMDYYGKRLATASSDNTIKIVGVSN-SASQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQNEWTQAHVF+DHKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSYDGRVILWKEGNQNEWTQAHVFDDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV+TA+ DG W+T +ID+AHP+GVT+VSWAPS APGALV
Sbjct  120  ACGSSDGTISVFTAK-DGVWETTKIDEAHPVGVTSVSWAPSTAPGALV  166



>emb|CDY37530.1| BnaA05g33950D [Brassica napus]
Length=302

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPK+ SLLASCS+DG++I+WKEGNQNEWTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNQNEWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT RIDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTRIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   +N S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
             VI+W  G + E  +  V  D K+ V  ++W+    G  LA    + N++V+    DG W
Sbjct  237  SVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWS--MTGNLLAVSDGNNNVTVWKEAVDGEW  294

Query  594  DTARI  608
            +   +
Sbjct  295  EQVTV  299



>gb|EYU21504.1| hypothetical protein MIMGU_mgv1a010808mg [Erythranthe guttata]
Length=301

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV+MDYYGKR+ATASSD +IKIIGV+  S SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHQDIVHDVTMDYYGKRLATASSDNTIKIIGVTT-SNSQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DGKVI+WKEGN NEW+QAH+F DHK+SVNSISWAPHE+GL L
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVIIWKEGNPNEWSQAHIFEDHKASVNSISWAPHEVGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSD GWD +RI+QAHPIGVT+VSWAP  APG+LV
Sbjct  120  ACGSSDGNISVFTARSDDGWDKSRIEQAHPIGVTSVSWAPPTAPGSLV  167



>ref|XP_009408052.1| PREDICTED: protein SEC13 homolog [Musa acuminata subsp. malaccensis]
Length=302

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 158/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDV+MDYYGKR+ATASSD +IKI+GVS  S+ QHLATL+GHHGPVW
Sbjct  1    MPSQKIETGHQDVVHDVAMDYYGKRLATASSDMTIKIVGVSG-SSHQHLATLSGHHGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS++ASCS+DG+VI+WKEG++ +EW QAHVF +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMIASCSYDGRVIIWKEGSKPDEWIQAHVFTEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+V+WAP++APG LV
Sbjct  120  LACGSSDGNISVFTARTDGGWDTTRIDQAHPVGVTSVTWAPALAPGVLV  168



>ref|XP_010414320.1| PREDICTED: protein transport protein SEC13 homolog B-like [Camelina 
sativa]
Length=354

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 160/197 (81%), Gaps = 8/197 (4%)
 Frame = +3

Query  111  RLHSLFQGDH---TFIRSSDKEGK-----MPAQKIETGHSDTVHDVSMDYYGKRVATASS  266
            R+  L    H   +  RS+   GK     MP QKIETGH D VHDV MDYYGKR+ATASS
Sbjct  24   RVDPLLLRTHIASSLTRSAVISGKIILENMPGQKIETGHEDIVHDVQMDYYGKRIATASS  83

Query  267  DASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN  446
            D +IKI GV+NN  SQ LATL GH GPVW+V+WAHPKFGS+LASCS+DG+VI+WKEGNQN
Sbjct  84   DCTIKITGVTNNGGSQPLATLTGHRGPVWEVAWAHPKFGSILASCSYDGQVILWKEGNQN  143

Query  447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI  626
            +WTQAHVF DHKSSVNSI+WAPH+LGL LACGSSDGNISV+T   DGGWDT RIDQAHP+
Sbjct  144  QWTQAHVFTDHKSSVNSIAWAPHDLGLSLACGSSDGNISVFTGCPDGGWDTTRIDQAHPV  203

Query  627  GVTAVSWAPSMAPGALV  677
            GVT+V+WAP+ APGALV
Sbjct  204  GVTSVTWAPATAPGALV  220


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 16/148 (11%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVW  353
            P   + +G  D V+         ++A+   D ++K+  +SN S        L  H   V 
Sbjct  216  PGALVSSGLLDPVY---------KLASGGCDNTVKVWKLSNGSWKMDCFPALQKHTDWVR  266

Query  354  QVSWAHPKFG---SLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
             V+WA P  G   S +AS S DGKVI+W  G ++E  +  V  D  + V  +SW+    G
Sbjct  267  DVAWA-PNLGLPKSTIASGSQDGKVIIWTVGKEDEQWEGKVLKDFMTPVWRVSWS--LTG  323

Query  525  LCLACGSSDGNISVYTARSDGGWDTARI  608
              LA    + N++V+    DG W+   +
Sbjct  324  NLLAVSDGNNNVTVWKESVDGEWEQVTL  351



>ref|XP_010942123.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   287 bits (735),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 157/169 (93%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIETGH D VHDVSMDYYGKR+ATASSD++IKIIGVS  S+ QHLATL GH GPVW
Sbjct  1    MPSQKIETGHQDVVHDVSMDYYGKRLATASSDSTIKIIGVSG-SSHQHLATLTGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
             V+WAHPKFGS+LASCS+D +VI+WKEG++ +EWTQAH+F +HKSSVNSI+WAPHELGLC
Sbjct  60   LVAWAHPKFGSMLASCSYDSRVIIWKEGSKPDEWTQAHIFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TAR+DGGWDT RIDQAHP+GVT+VSWAP+MAPGALV
Sbjct  120  LACGSSDGNISVFTARTDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALV  168



>ref|XP_006298213.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
 gb|EOA31111.1| hypothetical protein CARUB_v10014264mg [Capsella rubella]
Length=302

 Score =   286 bits (733),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI  V+N+   QHLATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITEVNNSGGPQHLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PG+LV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGSLV  168


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 7/121 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   SN S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFSNGSWKMDCFPALHKHTDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D K++V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVIIWTIGKEGEQWEGKVLKDFKTTVWRVSWS--LTGNLLAVSYGNNNVTVWKETVDGEW  294

Query  594  D  596
            +
Sbjct  295  E  295



>ref|XP_010665916.1| PREDICTED: protein transport protein SEC13 homolog B-like [Beta 
vulgaris subsp. vulgaris]
Length=301

 Score =   286 bits (732),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M  QKIETGH DTVHD  MDYYGKR+ATASSD +IKIIGVSNNS  Q LATL+ H GPVW
Sbjct  1    MGIQKIETGHQDTVHDFQMDYYGKRIATASSDHTIKIIGVSNNS-HQQLATLSAHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVI+WKEGNQNEW+QA+VF+DHKSSVNSISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSILASCSYDGKVIIWKEGNQNEWSQANVFDDHKSSVNSISWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            A GSSDGNI VYT RSDGGWD+ +IDQAHP+GVT+VSWAP+ APGALV
Sbjct  120  ASGSSDGNIMVYTMRSDGGWDSIKIDQAHPVGVTSVSWAPATAPGALV  167



>ref|XP_010485502.1| PREDICTED: protein transport protein SEC13 homolog A [Camelina 
sativa]
Length=302

 Score =   286 bits (732),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI GV+N+S SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSQSLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+W QAH F DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWAQAHFFTDHKVSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   SN S        L+ H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D +++V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVIIWTTGKEGEQWEGKVLKDFETTVWRVSWS--LTGNLLAVSYGNNNVTVWKEIVDGEW  294

Query  594  D  596
            +
Sbjct  295  E  295



>ref|XP_010500953.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSDTVHDV MDYYGKRVATASSD +IKI GV+N+S SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSQPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+W QAH F DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWAQAHFFTDHKVSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   SN S        L+ H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDRVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D +++V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVIIWTTGKEGEQWEGKVLKDFETTVWRVSWS--LTGNLLAVSYGNNNVTVWKEVVDGEW  294

Query  594  D  596
            +
Sbjct  295  E  295



>emb|CDY49046.1| BnaC05g48740D [Brassica napus]
Length=302

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPK+ SLLASCS+DG++I+WKEGNQN+WTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNQNQWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   +N S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
             VI+W  G + E  +  V  D K+ V  ++W+    G  LA    + N++V+    DG W
Sbjct  237  SVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWS--LTGNLLAVSDGNNNVTVWKEAVDGEW  294

Query  594  DTARI  608
            +   +
Sbjct  295  EQVTV  299



>ref|XP_010463534.1| PREDICTED: protein transport protein SEC13 homolog A-like [Camelina 
sativa]
Length=302

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH+DTVHDV MDYYGKRVATASSD +IKI GV+N+S S  LATL GH GPVW
Sbjct  1    MPPQKIETGHNDTVHDVVMDYYGKRVATASSDCTIKITGVNNSSGSHPLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG++I+WKEG+QN+WTQAHVF DHK SVNSI+WAPH+LGL L
Sbjct  61   QVAWAHPKFGSLLASCSYDGQIILWKEGDQNQWTQAHVFTDHKVSVNSIAWAPHDLGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 7/121 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   SN S        L+ H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFSNGSWKMDCFPALSKHTDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D +++V  +SW+    G  LA    + N++V+    DG W
Sbjct  237  KVIIWTTGKEGEQWEGKVLKDFETTVWRVSWS--LTGNLLAVSYGNNNVTVWKEAVDGEW  294

Query  594  D  596
            +
Sbjct  295  E  295



>ref|XP_009147418.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147419.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147420.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
 ref|XP_009147421.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=302

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGHSD VHDV MDYYGKR+ATASSD +IKI GVSN+  SQ LATL GH GPVW
Sbjct  1    MPPQKIETGHSDIVHDVVMDYYGKRIATASSDGTIKITGVSNSGGSQQLATLTGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPK+ SLLASCS+DG++I+WKEGN NEWTQ+HVF DHK SVNSI+WAPHELGL L
Sbjct  61   QVAWAHPKYDSLLASCSYDGQIIIWKEGNNNEWTQSHVFTDHKVSVNSIAWAPHELGLSL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV
Sbjct  121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALV  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D+++K+   +N S        L  H   V  V+WA P  G   S +AS S DG
Sbjct  178  KLASGGCDSTVKVWKFANGSWKMDCFPALHKHKDWVRDVAWA-PNLGLPKSTIASGSEDG  236

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
             VI+W  G + E  +  V  D K+ V  ++W+    G  LA    + N++V+    DG W
Sbjct  237  SVIIWTVGKEGEQWEGKVLKDFKTPVWRVTWS--MTGNLLAVSDGNNNVTVWKEAVDGEW  294

Query  594  DTARI  608
            +   +
Sbjct  295  EQVTV  299



>emb|CDX97854.1| BnaC04g40850D [Brassica napus]
Length=301

 Score =   284 bits (727),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NAGGSQHLATLTGHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELGL  
Sbjct  60   QVAWAHPKFGSILASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELGLSF  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R+DGGWDTA+IDQAHP+GVT+VSWAPS  PGALV
Sbjct  120  ACGSSDGNISVFTGRADGGWDTAKIDQAHPVGVTSVSWAPSTVPGALV  167



>ref|NP_001045820.1| Os02g0135800 [Oryza sativa Japonica Group]
 dbj|BAB83081.1| Sec13p [Oryza sativa]
 dbj|BAD10362.1| Sec13p [Oryza sativa Japonica Group]
 dbj|BAF07734.1| Os02g0135800 [Oryza sativa Japonica Group]
 gb|EAY84386.1| hypothetical protein OsI_05762 [Oryza sativa Indica Group]
 gb|EAZ21659.1| hypothetical protein OsJ_05292 [Oryza sativa Japonica Group]
 dbj|BAG99387.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   284 bits (726),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQAHTFIEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>ref|XP_009141033.1| PREDICTED: protein SEC13 homolog [Brassica rapa]
Length=301

 Score =   283 bits (725),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH GPVW
Sbjct  1    MPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NGGGSQHLATLTGHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELGL L
Sbjct  60   QVAWAHPKFGSVLASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELGLSL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+T R DGGWD A+IDQAHP+GVT+VSWAPS APGA+V
Sbjct  120  ACGSSDGNISVFTGRGDGGWDAAKIDQAHPVGVTSVSWAPSTAPGAIV  167


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 7/125 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFDG  413
            ++A+   D ++K+  +S+          L  H   V  V+WA P  G   S +AS S DG
Sbjct  177  KIASGGCDNTVKVWKLSDGLWKMDCFPALQKHSDWVRDVAWA-PNLGLPKSTIASGSQDG  235

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W  G + E  +  V  D  + V  +SW+    G  LA    + N++V+    DG W
Sbjct  236  KVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS--LTGNMLAVSDGNNNVTVWKEAVDGEW  293

Query  594  DTARI  608
            +   +
Sbjct  294  EQVTV  298



>ref|XP_004235651.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
 ref|XP_010318533.1| PREDICTED: protein transport protein SEC13 homolog B-like [Solanum 
lycopersicum]
Length=301

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +IKI GVSN S+SQ LAT++GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIKITGVSN-SSSQLLATISGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ A VF+DHK+SVN+ISWAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLARVFDDHKASVNAISWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNIS++TARS+  W+T+RIDQAHP+GVT+VSWAPS APG+LV
Sbjct  120  ACGSSDGNISIFTARSEDVWETSRIDQAHPVGVTSVSWAPSTAPGSLV  167



>ref|XP_011466267.1| PREDICTED: protein transport protein SEC13 homolog B-like [Fragaria 
vesca subsp. vesca]
Length=302

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIETGH D VHDV+MDYYGKR+A+ASSD +IKIIGV +N++SQHLATL+GH GPVW
Sbjct  1    MPGQKIETGHQDVVHDVAMDYYGKRLASASSDTTIKIIGVGSNASSQHLATLSGHRGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV WAHPKFG +LASCS+DG+VI+WKEGN NEW QAHVFN+H +SVNSI WAPHELGL L
Sbjct  61   QVGWAHPKFGPILASCSYDGQVIIWKEGNPNEWYQAHVFNEHSASVNSICWAPHELGLIL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV TAR+DGGWDT RIDQA  +GVT+VSWAPSMAPG+LV
Sbjct  121  ACGSSDGTISVCTARADGGWDTTRIDQADLVGVTSVSWAPSMAPGSLV  168



>gb|EPS72747.1| hypothetical protein M569_02010 [Genlisea aurea]
Length=301

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP QKIET H D+VHDVSMDYYGKRVATASSD +IKIIG+  +S+SQHLATL+ H GPVW
Sbjct  1    MPGQKIETDHRDSVHDVSMDYYGKRVATASSDTTIKIIGI-GSSSSQHLATLSAHRGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVIVWKEGNQNEW+Q  VF++HKSSVNSI+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSVLASCSYDGKVIVWKEGNQNEWSQFQVFDNHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG IS+Y A+ DG WDT++IDQAHP GVT+V+WAPS APGALV
Sbjct  120  ACGSSDGTISIYRAQPDGTWDTSKIDQAHPTGVTSVTWAPSTAPGALV  167


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 7/126 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++A+   D ++K+  + N          L  H   V  V+WA P  G   + +AS S D
Sbjct  176  QKIASGGCDNTVKVWKLYNGGWKMDCFPALQKHSDWVRDVAWA-PNLGLPKTTIASGSED  234

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            G V+VW   N+ +  +  V  D K++V  +SW+    G  LA  S D N+S++   +DG 
Sbjct  235  GTVVVWTVANEGDQWEGKVMKDFKAAVWRVSWS--LTGNLLAVASGDNNVSLWKEEADGD  292

Query  591  WDTARI  608
            W   ++
Sbjct  293  WQEVQM  298



>gb|KJB40797.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
 gb|KJB40798.1| hypothetical protein B456_007G077700 [Gossypium raimondii]
Length=301

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D +HDV+MDYYGKR+ATASSD +IKIIG++  S+SQ LA L GH GPVW
Sbjct  1    MPAQKIETGHEDALHDVAMDYYGKRLATASSDTTIKIIGITG-SSSQQLAVLHGHKGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
             V+WAHPKFGS+LASCS+DG+VI+WKE NQNEW QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   GVAWAHPKFGSILASCSYDGQVIIWKENNQNEWLQAHVFNDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR DG WDT RI+QAHP+GVT+VSWAPS A GA +
Sbjct  120  ACGSSDGNISVFTARDDGSWDTTRIEQAHPVGVTSVSWAPSTALGAFI  167



>gb|AFX66988.1| protein transport SEC13-like protein [Solanum tuberosum]
Length=326

 Score =   283 bits (723),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIE+GH+DTVHDV+MDYYGKR+ATASSD +IKI GVSN S+SQ LAT++GH GPVW
Sbjct  1    MPSQKIESGHTDTVHDVAMDYYGKRLATASSDCTIKITGVSN-SSSQQLATISGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS DGKVI+WKEG QNEW+ A VF+DHK+SVN+I+WAPHELGLCL
Sbjct  60   QVAWAHPKFGSLLASCSSDGKVIIWKEGTQNEWSLARVFDDHKASVNAIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNIS++TARS+  W+T+RIDQAHP+GVT+VSWAPS APG+LV
Sbjct  120  ACGSSDGNISIFTARSEDVWETSRIDQAHPVGVTSVSWAPSTAPGSLV  167



>gb|EMT07862.1| hypothetical protein F775_17938 [Aegilops tauschii]
Length=305

 Score =   281 bits (719),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGTS-HQQLATLSGHEGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            Q++WAHPK+GS+LASCS+DG+VI+WKEG++ +EW QAH FN+HKSSVNSI+WAPHELGLC
Sbjct  60   QIAWAHPKYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFNEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+ ARSDGGW+T RIDQAHP+GVT+VSWAPSMAPGAL+
Sbjct  120  LACGSSDGNISVFMARSDGGWETTRIDQAHPVGVTSVSWAPSMAPGALI  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++A+   D ++K+  ++N S        L  H   V  V+WA P  G   S +AS S
Sbjct  178  YVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVAWA-PNLGLPKSTIASAS  236

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W    + E  +  V ND ++ V  +SW+    G  LA    + N++++    D
Sbjct  237  QDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWS--LTGNILAVSDGNNNVTLWKEAVD  294

Query  585  GGW  593
            G W
Sbjct  295  GEW  297



>gb|EMT13956.1| hypothetical protein F775_31904 [Aegilops tauschii]
Length=320

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-QQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKE-GNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GS+LASCS+DG+VI+WKE G  +EWTQAH F +HKSSVNSI+WAPHELG+C
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEEGKPDEWTQAHTFTEHKSSVNSIAWAPHELGIC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGW+T RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWETTRIDQAHPVGVTSVSWAPAMAPGALI  168



>gb|AGT16309.1| SEC13-related protein [Saccharum hybrid cultivar R570]
 gb|AGT16328.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>ref|XP_002454939.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
 gb|EES00059.1| hypothetical protein SORBIDRAFT_03g001760 [Sorghum bicolor]
Length=305

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>gb|AGT17401.1| SEC13-related protein [Saccharum hybrid cultivar R570]
Length=305

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLCGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>ref|XP_003565584.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010230618.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=305

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 153/169 (91%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GS+LASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVTWAHPKYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGW+T RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWETTRIDQAHPVGVTSVSWAPAMAPGALI  168


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 60/123 (49%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSN-NSTSQHLATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++++   D ++K+  ++N N        L  H   V  V+WA P  G   S +AS S
Sbjct  178  YVQKLSSGGCDNTVKVWKLTNGNWRMDCFPALQMHRDWVRDVAWA-PNLGLPKSTIASAS  236

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W    + E  +  V ND ++ V  +SW+    G  LA    + N++++    D
Sbjct  237  QDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWS--LTGNILAVSDGNNNVTLWKEAVD  294

Query  585  GGW  593
            G W
Sbjct  295  GEW  297



>gb|EMS54340.1| Protein SEC13-like protein [Triticum urartu]
Length=305

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-QQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GS+LASCS+DG+VI+WKEG + +EWTQ H F +HKSSVNSI+WAPHELG+C
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWTQFHTFTEHKSSVNSIAWAPHELGIC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGW+T RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWETTRIDQAHPVGVTSVSWAPAMAPGALI  168


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++A+   D ++K+  ++N S        L  H   V  V+WA P  G   S +AS S
Sbjct  178  YVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVAWA-PNLGLPKSTIASAS  236

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W    + E  +  V ND ++ V  +SW+    G  LA    + N++++    D
Sbjct  237  QDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRLSWS--LTGNILAVSDGNNNVTLWKEAVD  294

Query  585  GGW  593
            G W
Sbjct  295  GEW  297



>gb|ACN59487.1| SEC13 [Triticum aestivum]
Length=306

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 153/168 (91%), Gaps = 2/168 (1%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ  356
            P  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S+ Q LATL+GH GPVWQ
Sbjct  3    PPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSG-SSQQQLATLSGHQGPVWQ  61

Query  357  VSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            V+WAHPK+GS+LASCS+DG+VI+WKEG + +EWTQAH F +HKSSVNSI+WAPHELG+CL
Sbjct  62   VAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWTQAHTFTEHKSSVNSIAWAPHELGICL  121

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TARSDGGW+T RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  122  ACGSSDGNISVFTARSDGGWETTRIDQAHPVGVTSVSWAPAMAPGALI  169


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++A+   D ++K+  ++N S        L  H   V  V+WA P  G   S +AS S
Sbjct  179  YVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVAWA-PNLGLPKSTIASAS  237

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W    + E  +  V ND ++ V  +SW+    G  LA    + N++++    D
Sbjct  238  QDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRVSWS--LTGNILAVSDGNNNVTLWKEAVD  295

Query  585  GGW  593
            G W
Sbjct  296  GEW  298



>gb|KHG02181.1| Protein SEC13 [Gossypium arboreum]
Length=301

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MPAQKIETGH D +HDV+MDYYGKR+ATASSD +IKIIG++  S+SQ LA L GH GPVW
Sbjct  1    MPAQKIETGHEDALHDVAMDYYGKRLATASSDTTIKIIGITG-SSSQQLAVLHGHKGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
             V+WAHPKFGS+LASCS+D +VI+WKE NQNEW QAHVFNDHKSSVNSI+WAPHELGLCL
Sbjct  60   GVAWAHPKFGSILASCSYDAQVIIWKENNQNEWLQAHVFNDHKSSVNSIAWAPHELGLCL  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+TAR DG WDT RI+QAHP+GVT+VSWAPS A GA +
Sbjct  120  ACGSSDGDISVFTARDDGSWDTTRIEQAHPVGVTSVSWAPSTALGAFI  167



>ref|XP_004968630.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGAS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGL 
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFVEHKSSVNSIAWAPHELGLS  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAPSMAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPSMAPGALI  168



>ref|XP_006646853.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   278 bits (712),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRMATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW Q H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQVHTFIEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDG WDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGVWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>ref|NP_001149004.1| SEC13-related protein [Zea mays]
 gb|ACG33776.1| SEC13-related protein [Zea mays]
Length=305

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDITMDYYGKRLATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW  AH F +HKSS NSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALAHTFAEHKSSANSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+ ARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFAARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>gb|ACG46695.1| SEC13-related protein [Zea mays]
 gb|ACL54360.1| unknown [Zea mays]
 gb|AFW61900.1| SEC13 protein [Zea mays]
 gb|AFW69101.1| SEC13 protein [Zea mays]
 tpg|DAA52845.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW  AH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALAHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+ ARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFAARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>ref|NP_001150249.1| SEC13-related protein [Zea mays]
 gb|ACG38366.1| SEC13-related protein [Zea mays]
 gb|AFW80398.1| SEC13 protein isoform 1 [Zea mays]
 gb|AFW80399.1| SEC13 protein isoform 2 [Zea mays]
Length=305

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHDV+MDYYGKR+AT+SSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDVAMDYYGKRLATSSSDNTIKIIGVSGTS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPKFGS+LASCS+DG+VI+WKEG++ +EW   H F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>dbj|BAJ89756.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIG+S  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGISGTS-QQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GS+LASCS+DG+VI+WKEG + +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct  60   QVAWAHPKYGSMLASCSYDGRVIIWKEGGKPDEWAQAHTFVEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+T RSDGGW+T RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTVRSDGGWETTRIDQAHPVGVTSVSWAPAMAPGALI  168


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++A+   D ++K+  ++N S        L  H   V  V+WA P  G   S +AS S
Sbjct  178  YVQKLASGGCDNTVKVWKLTNGSWRMDCFPALQMHRDWVRDVAWA-PNLGLPKSTIASAS  236

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W    + E  +  V ND ++ V  +SW+    G  LA    + N++++    D
Sbjct  237  QDGTVVIWTAPKEGEQWEGRVLNDFRTPVWRVSWS--LTGNILAVSDGNNNVTLWKEAVD  294

Query  585  GGW  593
            G W
Sbjct  295  GEW  297



>ref|XP_006646846.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=305

 Score =   277 bits (708),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHKDVVHDIAMDYYGKRMATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WA HELGLC
Sbjct  60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQAHTFIEHKSSVNSIAWAAHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TARSDG WDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARSDGVWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168



>emb|CDY29706.1| BnaA04g17210D [Brassica napus]
Length=690

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +3

Query  165  EGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG  344
            E  MP QKIETGH D VHDV MDYYGK+VATASSD +IKI GV N   SQHLATL GH G
Sbjct  387  ESNMPGQKIETGHEDMVHDVQMDYYGKKVATASSDCTIKITGV-NGGGSQHLATLTGHRG  445

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVWQV+WAHPKFGS+LASCS+DG+VI+WKEG+QN+WTQAHVF DHKSSVNSI+WAP+ELG
Sbjct  446  PVWQVAWAHPKFGSILASCSYDGQVILWKEGSQNQWTQAHVFTDHKSSVNSIAWAPYELG  505

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            L LACGSSDGNISV+T R DGGWD A+IDQAHP+GVT+VSWAPS APGA+V
Sbjct  506  LSLACGSSDGNISVFTGRGDGGWDAAKIDQAHPVGVTSVSWAPSTAPGAIV  556



>ref|XP_004169158.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
Length=301

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+GVS +S SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVGVSKDSGSQILATLNGHKGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+ ARSDGGWD   I+QAHP+GVT+VSW P+ APG+LV
Sbjct  121  ACGSSDGSISVFIARSDGGWDNNPIEQAHPVGVTSVSWGPTTAPGSLV  168



>ref|XP_008443459.1| PREDICTED: protein SEC13 homolog [Cucumis melo]
Length=301

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+ VS NS SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVSVSKNSGSQILATLNGHKGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+ ARSDGGWD   I+QAHP+GVT+VSW P+ APG+LV
Sbjct  121  ACGSSDGSISVFIARSDGGWDNNPIEQAHPVGVTSVSWGPTTAPGSLV  168



>ref|XP_004147452.1| PREDICTED: protein SEC13 homolog [Cucumis sativus]
 gb|KGN59617.1| hypothetical protein Csa_3G829070 [Cucumis sativus]
Length=301

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M +QKIETGH D VHDV MDYYGKR+ATASSD +IKI+GVS +S SQ LATL GH GPVW
Sbjct  1    MSSQKIETGHQDMVHDVQMDYYGKRIATASSDFTIKIVGVSKDSGSQILATLNGHKGPVW  60

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS++AS S+DG+VI+WKEGNQN+W+QAHVF+ HKSSVNSI+WAPHELGLCL
Sbjct  61   QVAWAHPKFGSMVASSSYDGQVIIWKEGNQNQWSQAHVFSAHKSSVNSIAWAPHELGLCL  120

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG+ISV+ ARSDGGWD   I+QAHP+GVT+VSW P  APG+LV
Sbjct  121  ACGSSDGSISVFIARSDGGWDNNPIEQAHPVGVTSVSWGPMTAPGSLV  168



>ref|XP_010249546.1| PREDICTED: protein transport protein SEC13 homolog B-like [Nelumbo 
nucifera]
Length=300

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 149/165 (90%), Gaps = 2/165 (1%)
 Frame = +3

Query  186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  365
            KIETGH DTVHDV+MDYYGKR+ATA SD +IKIIGV N S SQHLATL+GH GPVWQV+W
Sbjct  2    KIETGHQDTVHDVTMDYYGKRLATACSDNTIKIIGVCN-SASQHLATLSGHQGPVWQVAW  60

Query  366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF-NDHKSSVNSISWAPHELGLCLACG  542
            AHPKFGS+LASCS+DG VI+WKEGNQNEW+QAHVF +DHKSS++SI+WAPHELGL LACG
Sbjct  61   AHPKFGSILASCSYDGLVIIWKEGNQNEWSQAHVFSDDHKSSMDSIAWAPHELGLYLACG  120

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SSDGNISV+TAR+DGGWDTARIDQAH +GVT VSW PS +PG  V
Sbjct  121  SSDGNISVFTARADGGWDTARIDQAHAVGVTLVSWDPSTSPGVFV  165



>ref|XP_004956945.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=305

 Score =   273 bits (699),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 149/169 (88%), Gaps = 2/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHDV+MDYYGKR+ATASSD +IKI+GVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDVAMDYYGKRIATASSDNTIKIVGVSGTS-HQQLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            Q +WAHPKFGS+LASC +DG+VI+WKEG + +EW QAH F +HKSSV+SI+WAPHELGLC
Sbjct  60   QAAWAHPKFGSMLASCGYDGRVIIWKEGGKPDEWVQAHTFTEHKSSVSSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDGNISV+TAR+DG WDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  LACGSSDGNISVFTARADGVWDTTRIDQAHPVGVTSVSWAPAMAPGALI  168


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 59/123 (48%), Gaps = 7/123 (6%)
 Frame = +3

Query  237  YGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCS  404
            Y +++A+   D ++K+  + N S        L  H   V  V+WA P  G   S +AS S
Sbjct  178  YVQKLASGGCDNTVKVWKLQNGSWRMDCFPALQMHKDWVRDVAWA-PNLGLPKSTIASAS  236

Query  405  FDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
             DG V++W E  + E     + +D K+ V  +SW+    G  LA    + N++++    D
Sbjct  237  QDGTVVIWTEAKEGEQWVGRILHDFKTPVWRLSWS--LTGNILAASDGNNNVTLWKEAVD  294

Query  585  GGW  593
            G W
Sbjct  295  GEW  297



>ref|XP_010914535.1| PREDICTED: protein transport protein SEC13 homolog B-like [Elaeis 
guineensis]
Length=302

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 2/170 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSN-NSTSQHLATLAGHHGPV  350
            MP+QKIETGH D VHDV+MDYYGK +ATASSD++IK+I V N +S SQ LATL+GH GPV
Sbjct  1    MPSQKIETGHQDMVHDVAMDYYGKCLATASSDSTIKVITVGNASSPSQLLATLSGHQGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGL  527
            WQV WAHPKFGS+LASCS+D +VI+WKEG   N+W QAHVF DHKSSVNSI+WAP+ELGL
Sbjct  61   WQVVWAHPKFGSILASCSYDSRVIIWKEGTTPNQWVQAHVFTDHKSSVNSIAWAPYELGL  120

Query  528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            CLACGSSDG+ISV+TARSDGGWDT RI+ AHP+GVT+VSWAP+  PG+L+
Sbjct  121  CLACGSSDGSISVFTARSDGGWDTTRIEMAHPVGVTSVSWAPATPPGSLI  170



>ref|XP_006836221.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
 gb|ERM99074.1| hypothetical protein AMTR_s00101p00099400 [Amborella trichopoda]
Length=302

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+ KIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV+  S+ QHLATL+GH GPVW
Sbjct  1    MPSLKIETGHQDVVHDVAMDYYGKRLATASSDATIKIIGVAA-SSQQHLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DGKVI+WKEG  N+W+Q +VF+DHK+SVNSI+WAPHE+GLC+
Sbjct  60   QVAWAHPKFGSLLASCSYDGKVIIWKEGTSNDWSQFYVFSDHKASVNSIAWAPHEIGLCI  119

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG IS+ +A  DG WD +RI+QAHP+GVT+VSWAP+  PG+LV
Sbjct  120  ACGSSDGTISILSAGPDGSWDASRIEQAHPVGVTSVSWAPAGLPGSLV  167



>ref|XP_006854548.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
 gb|ERN16015.1| hypothetical protein AMTR_s00030p00063600 [Amborella trichopoda]
Length=306

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 5/172 (3%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+ KIETGH D VHDV+MDYYGKR+ATASSDA+IKIIGV+  S+ QHLATL+GH GPVW
Sbjct  1    MPSLKIETGHQDVVHDVAMDYYGKRLATASSDATIKIIGVAA-SSQQHLATLSGHQGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ----NEWTQAHVFNDHKSSVNSISWAPHEL  521
            QV+WAHPKFGSLLASCS+D KV++WKEG +    N W Q +VF+DHK+SVNSI+WAPHEL
Sbjct  60   QVAWAHPKFGSLLASCSYDSKVVIWKEGTKEGTSNGWLQFYVFSDHKASVNSIAWAPHEL  119

Query  522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            GLCLACGSSDG ISV +A  DG W+  RIDQAHP+GVT+VSWAP++ PG+LV
Sbjct  120  GLCLACGSSDGTISVLSAGPDGSWEATRIDQAHPVGVTSVSWAPAILPGSLV  171



>ref|XP_010098129.1| Protein SEC13-like protein [Morus notabilis]
 gb|EXB74566.1| Protein SEC13-like protein [Morus notabilis]
Length=355

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = +3

Query  159  DKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGH  338
            ++  KMPAQ+IE  H D VHD  MDY+G R+ATASSD +I +I V  NS S+H+ATL GH
Sbjct  50   ERSRKMPAQEIEINHQDLVHDAVMDYFGDRLATASSDHTINVIRVKKNSKSEHVATLRGH  109

Query  339  HGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHE  518
             GPVWQ+ WAHPKFGSLLASCS+DGKVI+W+E  +++W QAHVF+DHKSSVNSI+WAPHE
Sbjct  110  IGPVWQLDWAHPKFGSLLASCSYDGKVIIWEEATKDQWIQAHVFDDHKSSVNSIAWAPHE  169

Query  519  LGLCLACGSSDGNISVYTARSDG-GWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            LGLCLACGSSDGNISV+ ARSDG GWDT+RI++AHP+GVT+VSWA +  P AL
Sbjct  170  LGLCLACGSSDGNISVFIARSDGSGWDTSRIERAHPLGVTSVSWA-TPKPSAL  221



>gb|EPS72324.1| hypothetical protein M569_02435, partial [Genlisea aurea]
Length=284

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP ++IETGH D +HDV MDYYGKR+ATASSD +I+IIG+ N   SQHLA L GH GPVW
Sbjct  1    MPGKRIETGHQDVLHDVQMDYYGKRIATASSDNTIRIIGIGN---SQHLANLIGHRGPVW  57

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+DGKVI+WKE  + EW Q  VF+DHK+SVNSI WAPHE GL L
Sbjct  58   QVAWAHPKFGSMLASCSYDGKVIIWKEEKETEWIQLSVFDDHKASVNSICWAPHESGLSL  117

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS  656
            ACGSSDGNISV++AR DGGWD + I+Q+HP GVT+VSWAP+
Sbjct  118  ACGSSDGNISVFSARPDGGWDKSIIEQSHPAGVTSVSWAPT  158



>ref|NP_001059284.1| Os07g0246300 [Oryza sativa Japonica Group]
 dbj|BAC82934.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAD31963.1| putative Sec13p [Oryza sativa Japonica Group]
 dbj|BAF21198.1| Os07g0246300 [Oryza sativa Japonica Group]
 gb|EAZ03370.1| hypothetical protein OsI_25509 [Oryza sativa Indica Group]
 gb|EAZ39271.1| hypothetical protein OsJ_23698 [Oryza sativa Japonica Group]
 dbj|BAG99420.1| unnamed protein product [Oryza sativa Japonica Group]
Length=315

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKISSIGGKSAPSQLLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGTILASCSYDGRVIIWKEGAGGHWSQAHVFTDHKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            LACGSSDG ISV T R+DGGWDTARI++AHP+GVTA+SWAP+ A G+L
Sbjct  121  LACGSSDGTISVMTMRADGGWDTARIERAHPVGVTAISWAPATALGSL  168



>ref|XP_002460282.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
 gb|EER96803.1| hypothetical protein SORBIDRAFT_02g025945 [Sorghum bicolor]
Length=276

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 134/151 (89%), Gaps = 2/151 (1%)
 Frame = +3

Query  228  MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSF  407
            MDYYGKR+ATASSD +IKI+GVS  S  Q LATL+GH GPVWQV WAHPKFGS+LASC +
Sbjct  1    MDYYGKRIATASSDNTIKIVGVSGTS-HQQLATLSGHQGPVWQVVWAHPKFGSMLASCGY  59

Query  408  DGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
            DG VI+WKEG + +EW QAH F +HKSSVNSI+WAPHELGLCLACGSSDGNISV+TAR+D
Sbjct  60   DGCVIIWKEGGRPDEWVQAHTFTEHKSSVNSIAWAPHELGLCLACGSSDGNISVFTARAD  119

Query  585  GGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            G WDT RIDQAHP+GVT+VSWAP+MAPGAL+
Sbjct  120  GIWDTTRIDQAHPVGVTSVSWAPAMAPGALI  150



>ref|XP_003563373.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
 ref|XP_010240532.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=316

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI+ +   S  SQ LATL GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKIVNIGGASAPSQLLATLTGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V WAHPK+GS+LASCS+DG+VIVWKEG   +W+QAHVF++HKSSVNSI+WAP+ELGLC
Sbjct  61   WRVGWAHPKYGSILASCSYDGRVIVWKEGATGQWSQAHVFSNHKSSVNSIAWAPYELGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG+ISV + + DGGWDTA I++AHP+GVTAVSWAP+ A G++V
Sbjct  121  LACGSSDGSISVMSMQPDGGWDTATIERAHPVGVTAVSWAPATALGSMV  169



>gb|ABK22893.1| unknown [Picea sitchensis]
Length=322

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = +3

Query  171  KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV  350
            +M +QK E+GH D VHDV+MDYYGKR+AT S+D +IK+ G++ + T   LA+L GH GPV
Sbjct  7    QMGSQKFESGHQDVVHDVTMDYYGKRIATCSADRTIKLFGLNASDTPTLLASLTGHEGPV  66

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGL  527
            WQV+WAHPKFGS+LASCS+D +VI+W+EG Q N W+Q  VF +H++SVNS+SWAPHELGL
Sbjct  67   WQVAWAHPKFGSILASCSYDRRVIIWQEGQQENAWSQLQVFKEHEASVNSVSWAPHELGL  126

Query  528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            CLACGSSDG+I+V+T R D  WD  +IDQAH +GVTAVSWAP+ APG+LV
Sbjct  127  CLACGSSDGSITVFTRREDESWDKTKIDQAHQVGVTAVSWAPASAPGSLV  176


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 60/125 (48%), Gaps = 7/125 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++ +   D + K+    N S        L  H   V  V+WA P  G   S +ASCS D
Sbjct  184  QKLVSGGCDNTAKVWKFYNGSWKLDCFPPLQMHTDWVRDVAWA-PNLGLPKSTIASCSQD  242

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            GKV +W +G + +  +  + ND K+ V  +SW+    G  LA    + N++++    DG 
Sbjct  243  GKVAIWTQGKEGDKWEGKILNDFKTPVWRVSWSL--TGNILAVADGNNNVTLWKEAVDGE  300

Query  591  WDTAR  605
            W+  +
Sbjct  301  WNQVK  305



>ref|XP_002979018.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
 gb|EFJ19975.1| hypothetical protein SELMODRAFT_109958 [Selaginella moellendorffii]
Length=317

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +3

Query  171  KMPA-QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHG  344
            K+P+   IE+GH+D VHD  MDYYGKR+AT SSD SI++  V   S  +HL ATL+GH G
Sbjct  14   KLPSSHSIESGHTDIVHDAQMDYYGKRLATCSSDRSIRVFSVPQGSQGEHLLATLSGHDG  73

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVWQ+ W HPKFGS+LASCS+D KVI+WKEG +N+W QAHVF +H++SVNSI+WAPHE G
Sbjct  74   PVWQICWGHPKFGSILASCSYDAKVIIWKEGAENQWIQAHVFKEHEASVNSIAWAPHEFG  133

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LCLACGSSDG ISV T + DG WD  +I QAHP+GVT+VSWAPS +PG+L+
Sbjct  134  LCLACGSSDGTISVLTNKPDGSWDRVKIQQAHPVGVTSVSWAPSASPGSLL  184



>ref|XP_002988399.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
 gb|EFJ10489.1| hypothetical protein SELMODRAFT_128111 [Selaginella moellendorffii]
Length=317

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +3

Query  171  KMPA-QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHG  344
            K+P+   IE+GH+D VHD  MDYYGKR+AT SSD S+++  V   S  +HL ATL+GH G
Sbjct  14   KLPSSHSIESGHTDIVHDAQMDYYGKRLATCSSDRSVRVFSVPQGSQGEHLLATLSGHDG  73

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVWQ+ W HPKFGS+LASCS+D KVI+WKEG +N+W QAHVF +H++SVNSI+WAPHE G
Sbjct  74   PVWQICWGHPKFGSILASCSYDAKVIIWKEGAENQWIQAHVFKEHEASVNSIAWAPHEFG  133

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LCLACGSSDG ISV T + DG WD  +I QAHP+GVT+VSWAPS +PG+L+
Sbjct  134  LCLACGSSDGTISVLTNKPDGSWDRVKIQQAHPVGVTSVSWAPSASPGSLL  184



>ref|XP_006657588.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=315

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S   HL ATL+GH+GPV
Sbjct  1    MLSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKISTIGGKSAPSHLLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WCVAWAHPKYGTILASCSYDGRVIIWKEGAGGHWSQAHVFADHKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            LAC SSDG ISV T R+DGGWDTARI++AHP+GVTA+SWAP+ A G+L
Sbjct  121  LACASSDGTISVMTMRADGGWDTARIERAHPVGVTAISWAPATALGSL  168



>ref|XP_006650845.1| PREDICTED: protein SEC13 homolog [Oryza brachyantha]
Length=301

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++ IE  H D VHD + DYYGKR+ATASSD+++K+I +   ST SQ LATL+GH+GPV
Sbjct  1    MSSKNIELDHKDMVHDSAFDYYGKRLATASSDSTVKVINIGGASTPSQLLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPKFGSLLASC +DG+VIVWKEG   +W+QAHVF++HKSSVNSI+WAP++LGL 
Sbjct  61   WRVAWAHPKFGSLLASCGYDGRVIVWKEGAAGQWSQAHVFDNHKSSVNSIAWAPYDLGLS  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG+IS+ T R DGGWD+A I++AHP+GV AVSWAP+ A G++V
Sbjct  121  LACGSSDGSISMMTMRPDGGWDSATIERAHPVGVMAVSWAPANALGSIV  169



>ref|NP_001051797.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|AAO39855.1| putative coat protein complex II (COPII) component [Oryza sativa 
Japonica Group]
 gb|AAP46251.1| putative protein-transport protein [Oryza sativa Japonica Group]
 gb|ABF99713.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99714.1| SEC13-related protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13711.1| Os03g0831800 [Oryza sativa Japonica Group]
 gb|EAY92452.1| hypothetical protein OsI_14185 [Oryza sativa Indica Group]
 gb|EAZ29179.1| hypothetical protein OsJ_13238 [Oryza sativa Japonica Group]
 dbj|BAG96146.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M + KIE  H D VHD ++DYYGK +ATASSD++++I  +   S  SQ LATL+GH+GPV
Sbjct  1    MSSNKIELDHKDMVHDSAIDYYGKSLATASSDSTVQISSIGGASAPSQLLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPKFGS+LASC +DG+V+VWKEG   +W+QAHVF++HKSS+NSI+WAP+ELGLC
Sbjct  61   WRVAWAHPKFGSILASCGYDGRVVVWKEGAAGQWSQAHVFDNHKSSLNSIAWAPYELGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG+ISV T R DGGWD+  I+QAHP+GV AVSWAP+ A G++V
Sbjct  121  LACGSSDGSISVMTMRPDGGWDSTTIEQAHPVGVMAVSWAPATALGSIV  169



>ref|XP_001781370.1| predicted protein [Physcomitrella patens]
 gb|EDQ53817.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 136/168 (81%), Gaps = 3/168 (2%)
 Frame = +3

Query  183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS---NNSTSQHLATLAGHHGPVW  353
            Q +E+GH D VHDV++DYYGKR+AT SSD  IK+  +    + + +  L TLAGH GPVW
Sbjct  8    QFVESGHQDVVHDVAVDYYGKRLATCSSDRLIKVFALGPAGDAAVATALVTLAGHDGPVW  67

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGS+LASCS+D KVI+W+EG +NEW QA VF +H+SSVNSI WAP E GLCL
Sbjct  68   QVAWAHPKFGSILASCSYDRKVIIWREGAENEWQQAQVFQEHESSVNSICWAPQEFGLCL  127

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDG ISV T ++DG W+ A+I+QAHP+GVT+VSWAP+ APG+L+
Sbjct  128  ACGSSDGTISVLTQKADGSWEKAKIEQAHPVGVTSVSWAPASAPGSLI  175



>ref|XP_004955890.1| PREDICTED: protein SEC13 homolog [Setaria italica]
Length=301

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI+ + +  + SQ LATL GH+GPV
Sbjct  1    MASKKIELDHKDMVHDSAVDYYGKRLATASSDSTVKIVSIGAATAPSQVLATLTGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPK+G++LASC +DG+V++WKE  +  W+Q H F DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGTILASCGYDGRVVIWKEDARGNWSQVHAFMDHKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            LAC SSDG IS++T R+DGGWDTA I++AHP+G TA+SWAP+ A G+L
Sbjct  121  LACASSDGRISIFTMRADGGWDTATIERAHPVGATAISWAPATALGSL  168



>ref|XP_010228200.1| PREDICTED: protein transport protein SEC13 homolog B-like [Brachypodium 
distachyon]
Length=301

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D +HD ++DYYGKR+ATASSD ++K++ +   S  S+ LATL+GH+GPV
Sbjct  1    MLSKKIELDHKDMIHDSAIDYYGKRLATASSDYTVKVVSIGGASAPSKLLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEGTGGHWSQAHVFADHKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            LAC  SDGNI + T R+DGGWDTA I++AHP+G TA+SWAP+ A G L
Sbjct  121  LACACSDGNIYIMTIRADGGWDTATIERAHPVGATAISWAPATALGLL  168



>ref|NP_001146460.1| SEC13 protein [Zea mays]
 gb|ACL54052.1| unknown [Zea mays]
 tpg|DAA39762.1| TPA: SEC13 protein [Zea mays]
Length=305

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +3

Query  168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHG  344
            G M ++KIE  H D VHD ++DYYGKR+ATASSD+++KII + + N+ SQ LATL+GH+G
Sbjct  5    GNMSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKIINIGAANAPSQVLATLSGHYG  64

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVW+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+G
Sbjct  65   PVWRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVG  124

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS  656
            LCLAC SS G IS+ T R+DGGWDTA I++AHP+G TA+SWAP+
Sbjct  125  LCLACASSGGRISILTMRADGGWDTATIERAHPVGATAISWAPA  168



>ref|XP_006379798.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
 gb|ERP57595.1| hypothetical protein POPTR_0008s14080g [Populus trichocarpa]
Length=285

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 132/168 (79%), Gaps = 17/168 (10%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP+QKIET   + +                   S       NN+TSQHLA L GH GPVW
Sbjct  1    MPSQKIETADCNCLI-----------------GSFNQNNWVNNNTSQHLANLTGHQGPVW  43

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL  533
            QV+WAHPKFGSLLASCS+DG+VI+WKEGNQN+WTQAHVF+DHKSSVNSI+WAPHELGL L
Sbjct  44   QVAWAHPKFGSLLASCSYDGRVIIWKEGNQNDWTQAHVFDDHKSSVNSIAWAPHELGLSL  103

Query  534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            ACGSSDGNISV+TAR+DG WDT+RIDQAHP+GVT+VSWAPS APGALV
Sbjct  104  ACGSSDGNISVFTARADGNWDTSRIDQAHPVGVTSVSWAPSTAPGALV  151



>ref|NP_001149986.1| SEC13-related protein [Zea mays]
 ref|XP_008651487.1| PREDICTED: SEC13-related protein isoform X1 [Zea mays]
 gb|ACF84405.1| unknown [Zea mays]
 gb|ACG37410.1| SEC13-related protein [Zea mays]
Length=299

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA  662
            LAC SS G IS+ T ++DGGWDTA I++AHP+G TA+SWAP+ A
Sbjct  121  LACASSGGRISILTMQADGGWDTATIERAHPVGATAISWAPATA  164


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 7/123 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQHLATLAGHHGP-VWQVSWAHPKFG---SLLASCSFDG  413
            ++ +   D+ +K+ G +N S     A ++  H   V  V+WA P  G   S +AS S DG
Sbjct  175  KLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWA-PVLGLSKSTIASGSQDG  233

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KV++W +G   +  +  +  D  S V  +SW+     LC+A G  + NI+++   SDG W
Sbjct  234  KVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAG--ENNITLWKEGSDGQW  291

Query  594  DTA  602
            + A
Sbjct  292  EEA  294



>gb|ACN31668.1| unknown [Zea mays]
Length=299

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF D+KSSVNSI+WAP+E+GLC
Sbjct  61   WRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFTDNKSSVNSIAWAPYEVGLC  120

Query  531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA  662
            LAC SS G IS+ T ++DGGWDTA I++AHP+G TA+SWAP+ A
Sbjct  121  LACASSGGRISILTMQADGGWDTATIERAHPVGATAISWAPATA  164


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 7/123 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQHLATLAGHHGP-VWQVSWAHPKFG---SLLASCSFDG  413
            ++ +   D+ +K+ G +N S     A ++  H   V  V+WA P  G   S +AS S DG
Sbjct  175  KLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWA-PVLGLSKSTIASGSQDG  233

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KV++W +G   +  +  +  D  S V  +SW+     LC+A G  + NI+++   SDG W
Sbjct  234  KVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAG--ENNITLWKEGSDGQW  291

Query  594  DTA  602
            + A
Sbjct  292  EEA  294



>ref|XP_001768123.1| predicted protein [Physcomitrella patens]
 gb|EDQ66996.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   230 bits (586),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST---SQHLATLAGHHGPVWQV  359
            +E+GH D VHDV++DYYGKR+AT SSD  +K+  +  + +   S  LATL+GH GP+WQV
Sbjct  2    LESGHQDVVHDVAVDYYGKRLATCSSDRLVKVFALGASGSTPPSSALATLSGHEGPIWQV  61

Query  360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC  539
            +WAHPKFG++LASCS+D KVI+W+EG +NEW QA VF +H+SSVNSISWAP   GLCLAC
Sbjct  62   AWAHPKFGNILASCSYDRKVIIWREGAENEWHQAQVFQEHESSVNSISWAPEVFGLCLAC  121

Query  540  GSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            GS+DG ISV + ++DG W+ A+I+QAHP+GVT+VSWAP+ APG+L+
Sbjct  122  GSADGTISVLSLKADGSWEKAKIEQAHPVGVTSVSWAPATAPGSLI  167



>ref|XP_008651486.1| PREDICTED: SEC13-related protein isoform X2 [Zea mays]
Length=421

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = +3

Query  168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHG  344
            G M ++KIE  H D VHD ++DYYGKR+ATASSD ++KI+ + + N+ SQ LATL+GH+G
Sbjct  121  GNMSSKKIELDHKDMVHDSAIDYYGKRLATASSDFTVKIVNIGAANAPSQVLATLSGHYG  180

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVW+V+WAHPK+G++LASCS+DG+VI+WKE  +  W+Q HVF+D+KSSVNSI+WAP+E+G
Sbjct  181  PVWRVAWAHPKYGAILASCSYDGRVIIWKEDARGNWSQVHVFSDNKSSVNSIAWAPYEVG  240

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA  662
            LCLAC SS G IS+ T ++DGGWDTA I++AHP+G TA+SWAP+ A
Sbjct  241  LCLACASSGGRISILTMQADGGWDTATIERAHPVGATAISWAPATA  286


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 64/123 (52%), Gaps = 7/123 (6%)
 Frame = +3

Query  246  RVATASSDASIKIIGVSNNSTSQHLATLAGHHGP-VWQVSWAHPKFG---SLLASCSFDG  413
            ++ +   D+ +K+ G +N S     A ++  H   V  V+WA P  G   S +AS S DG
Sbjct  297  KLVSGGFDSVVKVWGFNNGSWKLESALISDMHTDCVRDVAWA-PVLGLSKSTIASGSQDG  355

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KV++W +G   +  +  +  D  S V  +SW+     LC+A G  + NI+++   SDG W
Sbjct  356  KVVIWTKGKDGDKWEGKLMRDFGSPVWRVSWSLTGNILCIAAG--ENNITLWKEGSDGQW  413

Query  594  DTA  602
            + A
Sbjct  414  EEA  416



>gb|EMS55260.1| Protein SEC13-like protein [Triticum urartu]
Length=327

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  11   MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITSIGGASAPSQLVATLTGHYGPV  70

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q HVF++HK+SVNSI+WAP+ELGLC
Sbjct  71   WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLHVFDNHKASVNSIAWAPYELGLC  130

Query  531  LACGSSDGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG ISV + R D GG D A I++AHP+GVTAVSWAP+ A G++V
Sbjct  131  LACGSSDGTISVISMRPDTGGCDAATIERAHPVGVTAVSWAPAAALGSMV  180



>dbj|BAJ95085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=317

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITNIGGASAPSQLVATLTGHYGPV  60

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q +VF++HK+SVNSI+WAP+ELGLC
Sbjct  61   WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLYVFDNHKASVNSIAWAPYELGLC  120

Query  531  LACGSSDGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG ISV + R D GG+D A I++AHP+GVTAVSWAP+   G++V
Sbjct  121  LACGSSDGTISVISMRLDAGGYDAATIERAHPVGVTAVSWAPAAPLGSMV  170



>ref|XP_001774339.1| predicted protein [Physcomitrella patens]
 gb|EDQ60841.1| predicted protein [Physcomitrella patens]
Length=311

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +3

Query  183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV-SNNSTSQHLATLAGHHGPVWQV  359
            Q +E+GH D VHDV++DYYGKR+A+ SSD  IK+  V S +  +  LA+L+GH GPVWQV
Sbjct  14   QVVESGHQDVVHDVAVDYYGKRMASCSSDRLIKVFAVGSGDVPTMPLASLSGHEGPVWQV  73

Query  360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWAPHELGLCLA  536
            +WAHPKFGS+LASCS+D KVIVW+EG +NEW +  V F +H+SSVNSI WAP E GLCLA
Sbjct  74   AWAHPKFGSILASCSYDRKVIVWREGAENEWQKDQVVFQEHESSVNSICWAPSEFGLCLA  133

Query  537  CGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            CGSSDG ISV T + DG W+  +I+QAHP+GVT+VSWAP+ APG+L+
Sbjct  134  CGSSDGTISVLTHKPDGSWEKVKIEQAHPVGVTSVSWAPASAPGSLI  180



>gb|EMT21065.1| hypothetical protein F775_28222 [Aegilops tauschii]
Length=387

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV  350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ +ATL GH+GPV
Sbjct  71   MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKITNIGGASAPSQLVATLTGHYGPV  130

Query  351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            W+V WAHPK+GS+LASC +DG+VIVWKE    +W+Q HVF++HK+SVNSI+WAP+ELGLC
Sbjct  131  WRVGWAHPKYGSILASCGYDGRVIVWKEAATGQWSQLHVFDNHKASVNSIAWAPYELGLC  190

Query  531  LACGSSDGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            LACGSSDG ISV + R D GG + A I++AHP+GVTAVSWAP+ A G++V
Sbjct  191  LACGSSDGTISVISMRLDTGGCEAATIERAHPVGVTAVSWAPAAALGSMV  240



>gb|ABK26393.1| unknown [Picea sitchensis]
Length=283

 Score =   221 bits (564),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  228  MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSF  407
            MDYYGKR+AT S+D +IK+ G++ + T   LA+L GH GPVWQV+WAHPKFGS+LASCS+
Sbjct  1    MDYYGKRIATCSADRTIKLFGLNASDTPTLLASLTGHEGPVWQVAWAHPKFGSILASCSY  60

Query  408  DGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD  584
            D +VI+W+EG Q N W+Q  VF +H++SVNS+SWAPHELGLCLACGSSDG+I+V+T R D
Sbjct  61   DRRVIIWQEGQQENAWSQLQVFKEHEASVNSVSWAPHELGLCLACGSSDGSITVFTRRED  120

Query  585  GGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
              WD  +IDQAH +GVTAVSWAP+ APG+LV
Sbjct  121  ESWDKTKIDQAHQVGVTAVSWAPASAPGSLV  151


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 59/122 (48%), Gaps = 7/122 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +++ +   D + K+    N S        L  H   V  V+WA P  G   S +ASCS D
Sbjct  159  QKLVSGGCDNTAKVWKFYNGSWKLDCFPPLQMHTDWVRDVAWA-PNLGLPKSTIASCSQD  217

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            GKV +W +G + +  +  + ND K+ V  +SW+    G  LA    + N++++    DG 
Sbjct  218  GKVAIWTQGKEGDKWEGKILNDFKTPVWRVSWS--LTGNILAVADGNNNVTLWKEAVDGE  275

Query  591  WD  596
            W+
Sbjct  276  WN  277



>ref|XP_001767345.1| predicted protein [Physcomitrella patens]
 gb|EDQ67836.1| predicted protein [Physcomitrella patens]
Length=296

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPVWQVSW  365
            +E+GH D VHDVS+DYYGKR+A+ SSD  IK+  +S+       LATLAGH GPVWQV+W
Sbjct  1    MESGHQDVVHDVSVDYYGKRLASCSSDRLIKVFAISSEDVLPNSLATLAGHEGPVWQVAW  60

Query  366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  545
            AHPKFGS+LASCS+D KVI+W+EG +NEW Q  VF +H+SSVNSISW+PHE GL LACGS
Sbjct  61   AHPKFGSILASCSYDRKVIIWREGAENEWHQDQVFQEHESSVNSISWSPHEFGLGLACGS  120

Query  546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWA  650
            SDG ISV T + DG W+ A+I QAHP+GVT+VSWA
Sbjct  121  SDGTISVLTLKPDGSWEKAKIQQAHPVGVTSVSWA  155


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 7/121 (6%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHPKFG---SLLASCSFD  410
            +R+A+   D ++K+    NNS        L+ H   V  V WA P FG   S +AS S D
Sbjct  172  QRLASGGCDNTVKVWKFENNSWKLDCFPPLSKHVDWVRDVGWA-PNFGLGRSTIASASQD  230

Query  411  GKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG  590
            G V++W + N  +  Q+   ND K+ V  +SW+    G  LA   S   ++++    DG 
Sbjct  231  GTVVIWTQKNDGDQWQSLTLNDFKTPVWRVSWSL--TGNILAVSDSSSKVTLWKEEVDGD  288

Query  591  W  593
            W
Sbjct  289  W  289



>gb|EMT33754.1| hypothetical protein F775_27473 [Aegilops tauschii]
Length=280

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 115/139 (83%), Gaps = 2/139 (1%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS  S  Q LATL+GH GPVW
Sbjct  1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGTS-HQQLATLSGHEGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC  530
            Q++WAHP +GS+LASCS+DG+VI+WKEG++ +EW QAH FN+HKSSVNSI+WAPHELGLC
Sbjct  60   QIAWAHPNYGSMLASCSYDGRVIIWKEGSKPDEWAQAHTFNEHKSSVNSIAWAPHELGLC  119

Query  531  LACGSSDGNISVYTARSDG  587
            LACG+S G    +    +G
Sbjct  120  LACGTSSGRHLCFLGSGNG  138



>ref|XP_001700438.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO98127.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=299

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = +3

Query  174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW  353
            M     E+GH D VHD  +DYYG+R+AT SSD ++K+  +  +  + HLA L GH GPVW
Sbjct  1    MTLANFESGHQDMVHDAQLDYYGRRLATCSSDRTVKVFDIVGDHHT-HLADLRGHEGPVW  59

Query  354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF--NDHKSSVNSISWAPHELGL  527
            QVSW HPKFGS+LASCSFD +VIVWKE   N+W QA++   N H +SVNSI WAP+ELGL
Sbjct  60   QVSWGHPKFGSILASCSFDHRVIVWKEAQGNQWQQAYITPGNLHTASVNSICWAPYELGL  119

Query  528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
             LAC SSDG +S+   ++DG W+T ++   H +G TAVSWAPS APG+LV
Sbjct  120  ILACASSDGTVSLIEYKADGTWETTKLPGGHSVGCTAVSWAPSTAPGSLV  169



>ref|XP_011407281.1| PREDICTED: protein SEC13 homolog [Amphimedon queenslandica]
Length=313

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG+R+AT SSD ++KI  VS   T   LATL GH GPVWQ+SWA
Sbjct  11   VDTGHEDMIHDSQMDYYGRRLATCSSDRTVKIFDVSGQQTVL-LATLTGHEGPVWQLSWA  69

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG++LASCS+D KVI+WKE    +W++ H F +HKSSVNSI WAPHELGL LACGSS
Sbjct  70   HPKFGNILASCSYDRKVIIWKE-TSGKWSKLHEFCEHKSSVNSIQWAPHELGLVLACGSS  128

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            D + S+     DG W  +R +  H +G  +VSWAPS+ PG+LV
Sbjct  129  DESFSILYTTGDGNWQYSRQEGVHTLGCNSVSWAPSVNPGSLV  171



>ref|XP_003384987.1| PREDICTED: protein SEC13 homolog [Amphimedon queenslandica]
Length=313

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG+R+AT SSD ++KI  VS   T   LATL GH GPVWQ+SWA
Sbjct  11   VDTGHEDMIHDSQMDYYGQRLATCSSDRTVKIFDVSGQQTVL-LATLTGHEGPVWQLSWA  69

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG++LASCS+D KVI+WKE    +W++ H F +HKSSVNSI WAPHELGL LACGSS
Sbjct  70   HPKFGNILASCSYDRKVIIWKE-TSGKWSKLHEFCEHKSSVNSIQWAPHELGLVLACGSS  128

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            D + S+     DG W  +R +  H +G  +VSWAPS+ PG+LV
Sbjct  129  DESFSILYRTGDGNWQYSRQEGVHTLGCNSVSWAPSVNPGSLV  171



>ref|XP_005834017.1| secretory protein Sec13 [Guillardia theta CCMP2712]
 gb|EKX47037.1| secretory protein Sec13 [Guillardia theta CCMP2712]
Length=320

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 3/179 (2%)
 Frame = +3

Query  144  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-  320
             +     +G MP   I+T H D +HDV +DYYGKR+AT SSD  IKI  VS + TS  L 
Sbjct  1    MVAQPQSQGPMPDSSIDTQHEDMIHDVQLDYYGKRLATCSSDRFIKIFDVSPDQTSHQLS  60

Query  321  ATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSI  500
            AT+A H GP+WQV+WAHPKFGS+LASCS+D KV VWKE    +WT+ + + DH+SSVNSI
Sbjct  61   ATIAAHEGPIWQVAWAHPKFGSILASCSYDRKVCVWKEVQLQQWTKIYEYADHQSSVNSI  120

Query  501  SWAPHELGLCLACGSSDGNISVYTAR--SDGGWDTARIDQAHPIGVTAVSWAPSMAPGA  671
            ++APHELGL LA  S+DG IS+ + R   D  WD   +  AH IG  AVSWAP+ APG+
Sbjct  121  AFAPHELGLKLAAASADGTISILSWRGQGDNSWDERVVHDAHQIGCNAVSWAPAAAPGS  179



>ref|XP_002949031.1| hypothetical protein VOLCADRAFT_80440 [Volvox carteri f. nagariensis]
 gb|EFJ49966.1| hypothetical protein VOLCADRAFT_80440 [Volvox carteri f. nagariensis]
Length=301

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
             E+GH+D VHD  +DYYG+R+AT SSD ++K+  +  +  + HLA L GH GPVWQV W 
Sbjct  7    FESGHADMVHDAQLDYYGRRLATCSSDRTVKVFDIVGDRHT-HLADLRGHEGPVWQVCWG  65

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF--NDHKSSVNSISWAPHELGLCLACG  542
            HPKFGS+LASCSFD +VI+WKEG  N+W QA++   N H +SVNSI WAP+ELGL LAC 
Sbjct  66   HPKFGSILASCSFDHRVIIWKEGQGNQWQQAYISPGNLHTASVNSICWAPYELGLILACA  125

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SSDG++S    ++DG W+  ++   H +G TAVSWAP+ APG+LV
Sbjct  126  SSDGSVSFLEYKADGTWEINKLPGGHNVGCTAVSWAPATAPGSLV  170



>emb|CDH60247.1| wd40 repeat-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=310

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  362
            Q +ET H D +HD  +DYY +R+ATASSD +IKI  +  +S  + + TL GH  PVWQV+
Sbjct  7    QTVETHHEDMIHDAQLDYYSRRLATASSDHTIKIFDIDGDS-QRLVETLTGHEAPVWQVA  65

Query  363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  542
            WAHPKFGS+LASCS+DG+V +WKE N N WT+    N H +SVNS++WAPHELG  LAC 
Sbjct  66   WAHPKFGSILASCSYDGRVFIWKEQN-NVWTRIKEHNVHTASVNSVAWAPHELGAMLACA  124

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SSDG ISV   R DG W+T  I +AH IG  AV+WAPS  PG+LV
Sbjct  125  SSDGKISVLEYREDGSWETYMI-EAHGIGCNAVTWAPSAMPGSLV  168



>emb|CDS08364.1| hypothetical protein LRAMOSA02312 [Absidia idahoensis var. thermophila]
Length=310

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 3/165 (2%)
 Frame = +3

Query  183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  362
            Q +ET H D +HD  +DYY +R+ATASSD +IKI  +  +S  + + TL GH  PVWQV+
Sbjct  7    QTVETHHEDMIHDAQLDYYSRRLATASSDHTIKIFDIDGDS-QRLVETLTGHEAPVWQVA  65

Query  363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  542
            WAHPKFGS+LASCS+DG+V +WKE N N WT+    N H +SVNS++WAPHELG  LAC 
Sbjct  66   WAHPKFGSILASCSYDGRVFIWKEQN-NVWTRIKEHNVHTASVNSVAWAPHELGAMLACA  124

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SSDG ISV   R DG W+T  I +AH IG  AV+WAPS  PG+LV
Sbjct  125  SSDGKISVLEYREDGSWETYMI-EAHGIGCNAVTWAPSAMPGSLV  168



>ref|XP_004345908.1| SEC13, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR21364.1| SEC13, putative [Acanthamoeba castellanii str. Neff]
Length=310

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = +3

Query  186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  365
            ++ T H+D VHD   DYYGKRVAT SSD +IKI   SN S    +A L GH GPVWQV W
Sbjct  6    QVNTEHTDMVHDAQPDYYGKRVATCSSDRTIKIFEGSNESNYTQVAELKGHEGPVWQVCW  65

Query  366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  545
             HPKFG +LASC +D KVIVWKE  +N W + HV+  H+ SVNS+++APHE GL LAC S
Sbjct  66   GHPKFGVILASCGYDRKVIVWKEAAKNIWEKIHVYEGHELSVNSLAFAPHEFGLALACAS  125

Query  546  SDGNISVYT-ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SDG++SV + + ++  WD  R  QAH IGV ++SWAP++APGAL+
Sbjct  126  SDGHVSVLSYSPAEAKWDAQRF-QAHQIGVNSISWAPAVAPGALL  169



>gb|EFX87077.1| hypothetical protein DAPPUDRAFT_221812 [Daphnia pulex]
Length=311

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG R+AT SSD S++I  V  N T    A L GH GPVWQ++WA
Sbjct  8    VDTGHEDMIHDAQMDYYGCRLATCSSDRSVRIYDV-KNGTQTLAADLRGHEGPVWQIAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG++LASCS+D KVI+WKE N  +W + + + +H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPKFGNILASCSYDHKVIIWKEMN-GQWVKFYEYANHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA  671
            DG+IS+ +A + GGW+  +I+ AH IG  AVSWAP++ P A
Sbjct  126  DGSISILSATAAGGWEAKKINNAHTIGCNAVSWAPAIGPNA  166



>gb|EMD31608.1| hypothetical protein CERSUDRAFT_119652 [Ceriporiopsis subvermispora 
B]
Length=323

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 1/162 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            +ET H D +HD  +DYYGKR+AT SSD ++K+  + +  T +  ATL GH GPVWQV+WA
Sbjct  13   VETAHEDMIHDAQLDYYGKRLATCSSDRTVKVFDIVDGETQRTGATLKGHTGPVWQVAWA  72

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPK+GS+LASCS+DGKV++WKE     W +      HK+SVNS+SWAPHELG  LAC SS
Sbjct  73   HPKYGSILASCSYDGKVLIWKEQQPGAWARIKEHTLHKASVNSVSWAPHELGAILACASS  132

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL  674
            DG ISV T ++DG W  A + + H IG  AVSW+P++ PGAL
Sbjct  133  DGTISVLTFKNDGQWG-ADVFEGHAIGCNAVSWSPAVHPGAL  173



>ref|XP_002127937.1| PREDICTED: protein SEC13 homolog [Ciona intestinalis]
Length=312

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG ++AT SSD +I+I  V N  T + L+TL GH GPVWQ++W+
Sbjct  8    VDTLHEDMIHDAQMDYYGLQLATCSSDRTIRIFEVKN-GTQRLLSTLQGHDGPVWQIAWS  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPK+  +LASCS+D KVI+WKE +  +W + H +NDH SSVNS+ WAPHELGL LACGSS
Sbjct  67   HPKYDKMLASCSYDRKVIIWKEQD-GQWNKLHEYNDHDSSVNSVCWAPHELGLMLACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG++SV     D  W+  +I+ AH  G  AVSWAP++ PG+L+
Sbjct  126  DGSVSVLKHHGDNQWEATKINNAHTGGCNAVSWAPAVVPGSLI  168



>ref|NP_988967.1| SEC13 homolog [Xenopus (Silurana) tropicalis]
 gb|AAH61419.1| hypothetical protein MGC76017 [Xenopus (Silurana) tropicalis]
 emb|CAJ82574.1| SEC13-like 1 (S. cerevisiae) [Xenopus (Silurana) tropicalis]
Length=320

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+LGL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDLGLVLACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV
Sbjct  126  DGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLV  168



>ref|XP_006173389.1| PREDICTED: protein SEC13 homolog [Camelus ferus]
Length=368

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 132/214 (62%), Gaps = 7/214 (3%)
 Frame = +3

Query  42   FPGSDCFSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPA--QKIETGHSDTV  215
             P    F L CS   P++     ++  L  G    +   D+ G+M +    ++T H D +
Sbjct  6    LPSYIPFELLCSHPLPVSTFLKSQVLFLPAG---LVLGKDEMGEMVSVINTVDTSHEDMI  62

Query  216  HDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLA  395
            HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WAHP +G++LA
Sbjct  63   HDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWAHPMYGNILA  121

Query  396  SCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTA  575
            SCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T 
Sbjct  122  SCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTY  180

Query  576  RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
               G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  181  TGLGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|XP_001631519.1| predicted protein [Nematostella vectensis]
 gb|EDO39456.1| predicted protein [Nematostella vectensis]
Length=312

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D VHD  MDYYGK++AT SSD +I+I   +    +  +ATL GH GPVWQVSW+
Sbjct  8    VDTSHEDMVHDAQMDYYGKKLATCSSDKTIRIFETTGQQQTL-VATLRGHDGPVWQVSWS  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP FG+LLASCS+D KVI+WKE +   W +   F +H SSVNSI WAPHE GL LACG+S
Sbjct  67   HPMFGNLLASCSYDRKVIIWKESSSG-WVKLQEFCNHDSSVNSICWAPHEYGLMLACGAS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG++S+ ++  DG W+T +I  AH IG  AVSWAP++ PG+++
Sbjct  126  DGSVSIISSPGDGTWETKKISNAHTIGCNAVSWAPAVTPGSIL  168



>ref|XP_002599724.1| hypothetical protein BRAFLDRAFT_287194 [Branchiostoma floridae]
 gb|EEN55736.1| hypothetical protein BRAFLDRAFT_287194 [Branchiostoma floridae]
Length=318

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 120/164 (73%), Gaps = 4/164 (2%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSW  365
            ++TGH D +HD  MDYYG R+AT SSD ++KI  + N    Q LA  L GH GPVWQ++W
Sbjct  8    VDTGHEDMIHDAQMDYYGVRLATCSSDKTVKIFDIKNGG--QILAAELRGHEGPVWQLAW  65

Query  366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  545
            AHP +G++LASCS+D KVI+WKE N  +W + + + +H SSVNS+ WAPHE GL L CGS
Sbjct  66   AHPMYGNILASCSYDRKVIIWKETN-GQWDRLYEYANHDSSVNSVCWAPHEFGLMLVCGS  124

Query  546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SDG +S+ ++ +DG WDT +I+ AH IG  AVSW P++A G+LV
Sbjct  125  SDGAVSIISSTADGQWDTKKINNAHTIGCNAVSWCPAVAAGSLV  168



>gb|ABO65080.1| SEC13-like 1 isoform [Homo sapiens]
Length=177

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_007251556.1| PREDICTED: protein SEC13 homolog [Astyanax mexicanus]
Length=320

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNSI W P+E GL LACGSS
Sbjct  67   HPTYGNILASCSYDRKVIIWKEEN-GTWDKMYKYTGHNSSVNSICWGPYEFGLTLACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   DG WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISILTYTGDGQWDIKKINNAHTIGCNAVSWAPAVVPGSLI  168



>gb|AAH73381.1| Unknown (protein for MGC:80813) [Xenopus laevis]
Length=320

 Score =   192 bits (487),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGIRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDFGLLLACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV
Sbjct  126  DGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLV  168



>ref|XP_003395453.1| PREDICTED: protein SEC13 homolog [Bombus terrestris]
 ref|XP_003488802.1| PREDICTED: protein SEC13 homolog [Bombus impatiens]
Length=311

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG R+AT SSD S+KI  + N S S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSVKIFDLKNGSQSL-VADLKGHVGPVWQVTWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG+LLASCS+D KVI+WKE    EWT+ +  N H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHNGHDSSVNSVAWAPHEFGLILACGSS  124

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP  665
            DG++S+     D  WDT +I  AH IG  AVSW P++ P
Sbjct  125  DGSVSILINNGD-TWDTQKITNAHTIGCNAVSWCPAIEP  162



>ref|XP_393516.3| PREDICTED: protein SEC13 homolog isoform X2 [Apis mellifera]
 ref|XP_003696225.1| PREDICTED: protein SEC13 homolog [Apis florea]
 ref|XP_006564241.1| PREDICTED: protein SEC13 homolog isoform X1 [Apis mellifera]
 ref|XP_006611385.1| PREDICTED: protein SEC13 homolog isoform X1 [Apis dorsata]
 ref|XP_006611386.1| PREDICTED: protein SEC13 homolog isoform X2 [Apis dorsata]
Length=311

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG R+AT SSD SIKI  + N + S  +A L GH GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDNSIKIFDLKNGTQSL-VADLKGHVGPVWQVTWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG+LLASCS+D KVI+WKE    EWT+ +  N H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKFGNLLASCSYDRKVIIWKE--LGEWTKIYEHNGHDSSVNSVAWAPHEFGLILACGSS  124

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP  665
            DG++S+     D  WDT +I  AH IG  AVSW P++ P
Sbjct  125  DGSVSILINNGD-TWDTQKITNAHSIGCNAVSWCPAIEP  162



>emb|CCG81563.1| Protein transport protein sec13 [Taphrina deformans PYCC 5710]
Length=306

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 119/165 (72%), Gaps = 2/165 (1%)
 Frame = +3

Query  183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS  362
            Q IET H++T+HD  +DYYGKR+AT SSD +IKI  VS++ T   + TL GH GPVWQ+S
Sbjct  6    QTIETQHTETLHDAILDYYGKRLATCSSDQTIKIFDVSSSGTQTLIETLRGHEGPVWQLS  65

Query  363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG  542
            WAHPKFG++LAS  +DGKVIVW+E N ++W++      H +SVNS+SWAPHE G  LAC 
Sbjct  66   WAHPKFGNILASAGYDGKVIVWREQN-HQWSKLTEHAIHSASVNSVSWAPHESGAVLACA  124

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            S+DG +S+   R DG WDT     AH +GV A+SWAPS   G+L+
Sbjct  125  SADGKVSILEFREDGSWDTKSF-VAHALGVNAISWAPSTVAGSLI  168



>ref|XP_005650517.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25973.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=305

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = +3

Query  186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW  365
            +I+TGHSDTVHDV  DYYG+R+AT SSD +IK+   + +  ++ ++ L GH GPVWQV+W
Sbjct  10   QIDTGHSDTVHDVQFDYYGRRLATCSSDRTIKVFETAGDQMAE-VSQLVGHEGPVWQVTW  68

Query  366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS  545
            AHPKFGSLLASC FD KVIVWKE  +++W QA+    H +SVNS+++APHELGL LA  S
Sbjct  69   AHPKFGSLLASCGFDHKVIVWKEAQESQWVQAYSAPVHSASVNSVAFAPHELGLILAAAS  128

Query  546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SDG+IS+ T   +G W   ++  AH +G TAVSW+P+   G+LV
Sbjct  129  SDGSISILTYH-EGAWTPYKVADAHSLGATAVSWSPAAPAGSLV  171


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 11/124 (9%)
 Frame = +3

Query  243  KRVATASSDASIKIIGVSNNSTS--QHLATLAGHHGPVWQVSWAHPKFG---SLLASCSF  407
            KR+A++ +D ++++  ++  +    Q    L GH   V  V+WA P  G   + LAS   
Sbjct  181  KRLASSGADNTVRVWRLNEKTGEWQQEGPALTGHSDWVRDVAWA-PNLGLPSNTLASAGQ  239

Query  408  DGKVIVWKEGNQ--NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARS  581
            DGKV++W EG      WT   + +D K+ V  +SW+    G  LA   S GN++ +    
Sbjct  240  DGKVLIWSEGRDAPGTWTPT-LLHDFKAPVWRVSWS--VTGSILAVSDSQGNVTTWKESL  296

Query  582  DGGW  593
            DG W
Sbjct  297  DGSW  300



>ref|XP_005846000.1| hypothetical protein CHLNCDRAFT_31922 [Chlorella variabilis]
 gb|EFN53898.1| hypothetical protein CHLNCDRAFT_31922 [Chlorella variabilis]
Length=287

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +3

Query  213  VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLL  392
            VHD + DYYGKR+AT SSD SIK+  V+    + HLA L GH GPVWQVSWAHPKFGSLL
Sbjct  2    VHDAAFDYYGKRLATCSSDRSIKVFEVAGEQVT-HLADLNGHEGPVWQVSWAHPKFGSLL  60

Query  393  ASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYT  572
            ASCSFD +V+VWKE + N W Q +    H +SVNS+ WAP+ELGL LA  SSDG +SV T
Sbjct  61   ASCSFDNRVVVWKEVSDNVWQQVYQSPLHTASVNSLCWAPYELGLSLAAASSDGAVSVLT  120

Query  573  ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
             + DG W   ++D AHPIG TAVSW+P+   G+LV
Sbjct  121  YQPDGTWHADKMDGAHPIGCTAVSWSPAAPKGSLV  155



>ref|XP_006957939.1| WD40 repeat-like protein [Wallemia sebi CBS 633.66]
 gb|EIM22139.1| WD40 repeat-like protein [Wallemia sebi CBS 633.66]
Length=313

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 122/175 (70%), Gaps = 12/175 (7%)
 Frame = +3

Query  177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGV----SNNSTSQHLATLAGHHG  344
            P Q IETGH D +HD  +DYYGKR+ATASSD +IKI  +    S+  T+ +   L GH G
Sbjct  8    PPQSIETGHQDVIHDAQLDYYGKRLATASSDRTIKITDITDAPSSTYTNSNAVILQGHQG  67

Query  345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG  524
            PVWQV+WAHPK+GS+LAS S+DGKV +WK+   N WT+      H SSVNSISWAPHELG
Sbjct  68   PVWQVAWAHPKYGSILASSSYDGKVFIWKQEGAN-WTRIKDHTLHTSSVNSISWAPHELG  126

Query  525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS------MAPGA  671
              LAC SSDGN+SV T  +DG WD + +  AH +GVT+VSWAP+       APG+
Sbjct  127  PTLACASSDGNVSVLTFHNDGTWDASML-AAHKLGVTSVSWAPASSNSNITAPGS  180



>ref|XP_006807456.1| PREDICTED: protein SEC13 homolog [Neolamprologus brichardi]
Length=271

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD ++KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRTVKIFDVRNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP FG++LASCS+D KVI+WKE N   W + + +  H+SSVNS+ W P+E GL LACGSS
Sbjct  67   HPMFGNILASCSYDRKVIIWKEEN-GSWDKMYEYTGHESSVNSVCWGPYEFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   D  WD  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTFTGDQQWDVKKISNAHTIGCNAVSWAPAIVPGSLI  168



>ref|XP_003826330.1| PREDICTED: protein SEC13 homolog isoform X1 [Pan paniscus]
Length=368

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = +3

Query  60   FSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPA--QKIETGHSDTVHDVSMD  233
              L CS   PL+     ++  L+   +      D+ GKM +    ++T H D +HD  MD
Sbjct  12   LELLCSHPLPLSAFLKTQV-KLYT--YRACAGKDEMGKMVSVINTVDTSHEDMIHDAQMD  68

Query  234  YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDG  413
            YYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WAHP +G++LASCS+D 
Sbjct  69   YYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWAHPMYGNILASCSYDR  127

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W+E N   W ++H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W
Sbjct  128  KVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW  186

Query  594  DTARIDQAHPIGVTAVSWAPSMAPGALV  677
            +  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  187  EVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|NP_001080442.1| SEC13 homolog [Xenopus laevis]
 gb|AAH43755.1| Sec13l1-prov protein [Xenopus laevis]
 gb|AAI24856.1| Sec13l1 protein [Xenopus laevis]
Length=320

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGIRLATCSSDRSVKIFDVKNGGQIL-IADLRGHDGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDFGLVLACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV
Sbjct  126  DGAISILTFTGDGPWEVKKISNAHTIGCNAVSWAPSVIPGSLV  168



>ref|XP_002509166.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70424.1| predicted protein [Micromonas sp. RCC299]
Length=306

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 116/165 (70%), Gaps = 3/165 (2%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
             E+GH+D +HD   DYYG+RVAT SSD +IK+  V+    +  LA L GH GPVW  +WA
Sbjct  9    FESGHTDQIHDCQYDYYGRRVATCSSDRTIKVFDVAGEQQTL-LANLTGHDGPVWMCAWA  67

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLACG  542
            HPKFG+LLASCSFD KVI+WKE  Q  ++  +      H +SVN+ISWAPHE GL LAC 
Sbjct  68   HPKFGTLLASCSFDHKVIIWKESEQGVFSAIYTSPATLHDASVNAISWAPHEFGLSLACA  127

Query  543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            SSDG +SV T R+DG WD  +I  AH IG T+VSWAP+  PG+LV
Sbjct  128  SSDGCVSVITHRADGTWDAQKIQGAHSIGCTSVSWAPAPPPGSLV  172



>ref|XP_005265434.1| PREDICTED: protein SEC13 homolog isoform X1 [Homo sapiens]
Length=344

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = +3

Query  60   FSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPA--QKIETGHSDTVHDVSMD  233
              L CS   PL+     ++  L+   +      D+ GKM +    ++T H D +HD  MD
Sbjct  12   LELLCSHPLPLSAFLKSQV-KLYT--YRACAGKDEMGKMVSVINTVDTSHEDMIHDAQMD  68

Query  234  YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDG  413
            YYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WAHP +G++LASCS+D 
Sbjct  69   YYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWAHPMYGNILASCSYDR  127

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W+E N   W ++H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W
Sbjct  128  KVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW  186

Query  594  DTARIDQAHPIGVTAVSWAPSMAPGALV  677
            +  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  187  EVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|XP_005066189.1| PREDICTED: protein SEC13 homolog isoform X2 [Mesocricetus auratus]
Length=322

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPHE GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHEYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_006083906.1| PREDICTED: protein SEC13 homolog [Myotis lucifugus]
Length=322

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWDVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_008150256.1| PREDICTED: protein SEC13 homolog [Eptesicus fuscus]
Length=322

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWDVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_004901951.1| PREDICTED: protein SEC13 homolog [Heterocephalus glaber]
 ref|XP_004835394.1| PREDICTED: protein SEC13 homolog [Heterocephalus glaber]
 gb|EHB13881.1| SEC13-like protein [Heterocephalus glaber]
Length=322

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWDVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|NP_001187522.1| protein SEC13 homolog [Ictalurus punctatus]
 gb|ADO28757.1| sec13-like [Ictalurus punctatus]
Length=320

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNSI W P++ GL LACGSS
Sbjct  67   HPTYGNILASCSYDRKVIIWKEEN-GTWDKMYKYTGHNSSVNSICWGPYDFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   DG WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISILTYTGDGQWDIKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005066188.1| PREDICTED: protein SEC13 homolog isoform X1 [Mesocricetus auratus]
Length=325

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  11   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  69

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPHE GL LACGSS
Sbjct  70   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHEYGLILACGSS  128

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  129  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  171



>ref|NP_001129498.1| protein SEC13 homolog isoform 3 [Homo sapiens]
 ref|XP_006713349.1| PREDICTED: protein SEC13 homolog isoform X4 [Homo sapiens]
 dbj|BAG63403.1| unnamed protein product [Homo sapiens]
 dbj|BAI46814.1| SEC13 homolog [synthetic construct]
Length=368

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = +3

Query  60   FSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPA--QKIETGHSDTVHDVSMD  233
              L CS   PL+     ++  L+   +      D+ GKM +    ++T H D +HD  MD
Sbjct  12   LELLCSHPLPLSAFLKSQV-KLYT--YRACAGKDEMGKMVSVINTVDTSHEDMIHDAQMD  68

Query  234  YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDG  413
            YYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WAHP +G++LASCS+D 
Sbjct  69   YYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWAHPMYGNILASCSYDR  127

Query  414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW  593
            KVI+W+E N   W ++H    H SSVNS+ WAPH+ GL LACGSSDG IS+ T   +G W
Sbjct  128  KVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQW  186

Query  594  DTARIDQAHPIGVTAVSWAPSMAPGALV  677
            +  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  187  EVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|NP_998500.1| protein SEC13 homolog [Danio rerio]
 gb|AAH54585.1| SEC13 homolog (S. cerevisiae) [Danio rerio]
 emb|CAK11154.1| SEC13-like 1 (S. cerevisiae) [Danio rerio]
 gb|AAI53484.1| SEC13 homolog (S. cerevisiae) [Danio rerio]
Length=320

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ W P++ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEENST-WDKMYEYTGHDSSVNSVCWGPYDFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG ISV T   DG WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISVLTCSGDGHWDIKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_011368966.1| PREDICTED: protein SEC13 homolog [Pteropus vampyrus]
Length=325

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V  NS    +A L GH GPVWQV+WA
Sbjct  11   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDV-RNSGQILIADLRGHEGPVWQVAWA  69

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  70   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  128

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  129  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  171



>ref|XP_003464126.1| PREDICTED: protein SEC13 homolog [Cavia porcellus]
Length=322

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +GS+LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGSILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_006917678.1| PREDICTED: protein SEC13 homolog [Pteropus alecto]
Length=322

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V  NS    +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDV-RNSGQILIADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005265435.1| PREDICTED: protein SEC13 homolog isoform X2 [Homo sapiens]
 ref|XP_006713350.1| PREDICTED: protein SEC13 homolog isoform X5 [Homo sapiens]
 gb|EAW64078.1| SEC13-like 1 (S. cerevisiae), isoform CRA_b [Homo sapiens]
Length=340

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +3

Query  159  DKEGKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA  332
            D+ GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L 
Sbjct  14   DEMGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLR  72

Query  333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP  512
            GH GPVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAP
Sbjct  73   GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAP  131

Query  513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            H+ GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  132  HDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  186



>gb|KDR17793.1| SEC13-like protein [Zootermopsis nevadensis]
Length=316

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 116/160 (73%), Gaps = 4/160 (3%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG R+AT SSD S+KI  +  N T    A L GH+GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDHSVKIYDI-KNGTQTLTADLKGHYGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPK+G+LLASCS+D +VIVWKE    EW + + ++ H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKYGNLLASCSYDRRVIVWKE--VGEWVKLYEYSSHDSSVNSVAWAPHEFGLMLACGSS  124

Query  549  DGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAP  665
            DG++S+ T+  D G W+  +I  AH IG  AVSW P+ AP
Sbjct  125  DGSLSILTSNPDTGNWEAKKIPNAHTIGCNAVSWCPATAP  164



>ref|XP_004358973.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
 gb|EGG21123.1| WD40 repeat-containing protein [Dictyostelium fasciculatum]
Length=301

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = +3

Query  168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP  347
             ++ +  I+T H D VHD   DYYGK +AT SSD SIKI  VS  +   HL  L GH GP
Sbjct  2    AQVASNPIDTAHEDMVHDAQFDYYGKYLATCSSDRSIKIFDVSGENHV-HLTDLKGHEGP  60

Query  348  VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL  527
            VWQV+WAHPKFG +LAS S+D KVI+WKE + N+W+  + F+ H+ SVNSISWAPHE GL
Sbjct  61   VWQVAWAHPKFGKILASASYDRKVIIWKETSNNQWSNIYQFSGHELSVNSISWAPHEFGL  120

Query  528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            CLAC SSDG +S+   + D  W+  +I+ +  IGV +VSWAP+  P ALV
Sbjct  121  CLACASSDGTVSILNYK-DNQWEQQKINVSQ-IGVNSVSWAPASTPAALV  168



>ref|XP_007944008.1| PREDICTED: protein SEC13 homolog [Orycteropus afer afer]
Length=322

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPHE GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHEYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGNLI  168



>gb|EPQ10095.1| Protein SEC13 like protein [Myotis brandtii]
Length=363

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  49   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  107

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  108  HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  166

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  167  DGAISLLTYTGEGQWDVKKINNAHTIGCNAVSWAPAVVPGSLI  209



>gb|KFP30820.1| Protein SEC13, partial [Colius striatus]
Length=320

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+LV
Sbjct  126  DGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLV  168



>gb|AGM32573.1| WD40 domain containing protein, partial [Coptotermes formosanus]
Length=276

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 114/160 (71%), Gaps = 4/160 (3%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++TGH D +HD  MDYYG R+AT SSD S+KI  +  N T    A L GH+GPVWQV+WA
Sbjct  8    VDTGHEDMIHDAEMDYYGLRLATCSSDHSVKIYDI-KNGTQTLTADLKGHYGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPK+G+LLASCS+D KVI+WKE    EW + + ++ H SSVNS++WAPHE GL LACGSS
Sbjct  67   HPKYGNLLASCSYDRKVIIWKEA--GEWVKLYEYSSHDSSVNSVAWAPHEFGLMLACGSS  124

Query  549  DGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAP  665
            DG++SV T   D G WD  +I  AH IG  A SW P+ +P
Sbjct  125  DGSLSVLTNNPDTGNWDAKKIPNAHTIGCNAASWCPATSP  164



>ref|XP_010617575.1| PREDICTED: protein SEC13 homolog [Fukomys damarensis]
 gb|KFO38351.1| Protein SEC13 like protein [Fukomys damarensis]
Length=322

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWDMKKISNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_004625281.1| PREDICTED: protein SEC13 homolog [Octodon degus]
Length=376

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  32   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  90

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  91   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  149

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  150  DGAISLLTYTGEGQWDVKKINNAHTIGCNAVSWAPAVVPGSLI  192



>gb|ABM55656.1| putative SEC13-like protein 1 [Maconellicoccus hirsutus]
Length=308

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 115/160 (72%), Gaps = 5/160 (3%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            +ETGH D +HD  MDYYG R+AT SSD SIKI  + N + S  +A L GH+GPVWQV+WA
Sbjct  8    VETGHEDVIHDAEMDYYGLRLATCSSDQSIKIYNLKNGTQSL-VADLKGHYGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG+ LASCS+D KVI+WKE N NEW + H + +H SSVNS++WAPHE GL LACGS 
Sbjct  67   HPKFGNFLASCSYDRKVIIWKETN-NEWVKFHEYTNHDSSVNSVAWAPHEYGLILACGSL  125

Query  549  DGNISV--YTARSDGGWDTARIDQAHPIGVTAVSWAPSMA  662
            DG IS+  YT  ++  W+  RI  AH  G  AVSW P+ A
Sbjct  126  DGTISIISYTPENN-SWEPKRIMNAHTSGCNAVSWCPASA  164



>gb|KFZ64786.1| Protein SEC13, partial [Caprimulgus carolinensis]
Length=320

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005997883.1| PREDICTED: protein SEC13 homolog [Latimeria chalumnae]
Length=320

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWDKMYEYTGHDSSVNSVCWAPHDFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG +S+ T   DG W+  +I  AH IG  AVSWAP++ PG+LV
Sbjct  126  DGAVSLLTHTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLV  168



>ref|XP_004033647.1| PREDICTED: protein SEC13 homolog isoform 3 [Gorilla gorilla gorilla]
Length=368

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +3

Query  159  DKEGKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA  332
            D+ GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L 
Sbjct  42   DEMGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLR  100

Query  333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP  512
            GH GPVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAP
Sbjct  101  GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAP  159

Query  513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            H+ GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  160  HDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|XP_006902250.1| PREDICTED: protein SEC13 homolog [Elephantulus edwardii]
Length=322

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + H    H SSVNSI WAPH+ GL LACGSS
Sbjct  67   HPMYGNVLASCSYDRKVIVWKEEN-GIWEKTHEHTGHDSSVNSICWAPHDFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I  AH IG  AVSWAP++ PG L+
Sbjct  126  DGAISLLTYTGEGQWDVKKISNAHTIGCNAVSWAPAVVPGNLI  168



>ref|XP_007983410.1| PREDICTED: protein SEC13 homolog isoform X1 [Chlorocebus sabaeus]
Length=368

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +3

Query  159  DKEGKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA  332
            D+ GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L 
Sbjct  42   DEMGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLR  100

Query  333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP  512
            GH GPVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAP
Sbjct  101  GHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAP  159

Query  513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            H+ GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  160  HDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|XP_005186970.1| PREDICTED: protein SEC13 homolog [Musca domestica]
Length=316

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            I+TGH D +H+  +DYYG  +AT SSD S+KI  V N +    +A L GH GPVWQV+WA
Sbjct  8    IDTGHEDMIHNAVLDYYGMHLATCSSDGSVKIFDVKNRNQVL-VADLKGHQGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HPKFG++LASCS+D KVIVWKEG  N+WT+ + +++H SSVNS+++AP E GL LACGSS
Sbjct  67   HPKFGNILASCSYDRKVIVWKEGGANDWTKLYEYSNHDSSVNSVAFAPSEYGLMLACGSS  126

Query  549  DGNISVYTARSDGG-WDTARIDQAHPIGVTAVSWAPSMAP  665
            DG+IS+ T  ++ G WD  +I  AH IG  AV+W PS  P
Sbjct  127  DGSISILTCNTEYGVWDCKKIPNAHTIGCNAVTWCPSTVP  166



>ref|XP_004084891.1| PREDICTED: protein SEC13 homolog [Oryzias latipes]
Length=320

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD ++KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRTVKIFDVRNGGQIL-VADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP FG++LASCS+D KVIVWKE N   W + + +  H+SSVNS+ W P+E GL LACGSS
Sbjct  67   HPMFGNILASCSYDRKVIVWKEEN-GAWDKMYEYTGHESSVNSVCWGPYEFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   D  WD  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTLTGDQQWDVKKISNAHTIGCNAVSWAPAVVPGSLI  168



>gb|KFQ30001.1| Protein SEC13, partial [Mesitornis unicolor]
 gb|KFU97303.1| Protein SEC13, partial [Pterocles gutturalis]
Length=320

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005145852.1| PREDICTED: protein SEC13 homolog [Melopsittacus undulatus]
Length=320

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLI  168



>ref|NP_077168.2| protein SEC13 homolog [Mus musculus]
 sp|Q9D1M0.3|SEC13_MOUSE RecName: Full=Protein SEC13 homolog; AltName: Full=SEC13-like 
protein 1; AltName: Full=SEC13-related protein [Mus musculus]
 dbj|BAB22732.1| unnamed protein product [Mus musculus]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005365083.1| PREDICTED: protein SEC13 homolog [Microtus ochrogaster]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_006994752.1| PREDICTED: protein SEC13 homolog [Peromyscus maniculatus bairdii]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_005413135.1| PREDICTED: protein SEC13 homolog [Chinchilla lanigera]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GSWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_004452753.1| PREDICTED: protein SEC13 homolog [Dasypus novemcinctus]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>gb|AAH02128.1| Sec13 protein [Mus musculus]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_010085319.1| PREDICTED: protein SEC13 homolog, partial [Pterocles gutturalis]
 ref|XP_010176870.1| PREDICTED: protein SEC13 homolog, partial [Mesitornis unicolor]
Length=319

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  7    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  65

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  66   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  124

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+L+
Sbjct  125  DGAISLLSYTGDGQWEVKKISNAHTIGCNAVSWAPAVVPGSLI  167



>ref|XP_005333860.1| PREDICTED: protein SEC13 homolog [Ictidomys tridecemlineatus]
Length=322

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>gb|EDK99502.1| SEC13-like 1 (S. cerevisiae), isoform CRA_b [Mus musculus]
Length=318

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  4    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  62

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  63   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  121

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  122  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  164



>ref|XP_008057837.1| PREDICTED: protein SEC13 homolog [Tarsius syrichta]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHAIGCNAVSWAPAVVPGSLI  168



>ref|XP_004443648.1| PREDICTED: protein SEC13 homolog isoform 1 [Ceratotherium simum 
simum]
 ref|XP_004443649.1| PREDICTED: protein SEC13 homolog isoform 2 [Ceratotherium simum 
simum]
 ref|XP_004443650.1| PREDICTED: protein SEC13 homolog isoform 3 [Ceratotherium simum 
simum]
 ref|XP_001493649.3| PREDICTED: protein SEC13 homolog isoformX1 [Equus caballus]
 ref|XP_008534303.1| PREDICTED: protein SEC13 homolog isoform X1 [Equus przewalskii]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|NP_001006979.1| protein SEC13 homolog [Rattus norvegicus]
 ref|XP_003496913.1| PREDICTED: protein SEC13 homolog [Cricetulus griseus]
 ref|XP_007631522.1| PREDICTED: protein SEC13 homolog [Cricetulus griseus]
 sp|Q5XFW8.1|SEC13_RAT RecName: Full=Protein SEC13 homolog; AltName: Full=SEC13-like 
protein 1 [Rattus norvegicus]
 gb|AAH84705.1| SEC13 homolog (S. cerevisiae) [Rattus norvegicus]
 gb|EDL91560.1| SEC13-like 1 (S. cerevisiae), isoform CRA_b [Rattus norvegicus]
 gb|EGW06218.1| Protein SEC13-like [Cricetulus griseus]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_007075531.1| PREDICTED: protein SEC13 homolog isoform X1 [Panthera tigris 
altaica]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_850437.1| PREDICTED: protein SEC13 homolog isoformX1 [Canis lupus familiaris]
 ref|XP_004738582.1| PREDICTED: protein SEC13 homolog isoform X2 [Mustela putorius 
furo]
 ref|XP_004793378.1| PREDICTED: protein SEC13 homolog isoform X2 [Mustela putorius 
furo]
 ref|XP_008696110.1| PREDICTED: protein SEC13 homolog isoform X1 [Ursus maritimus]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_004392737.1| PREDICTED: protein SEC13 homolog isoform 1 [Odobenus rosmarus 
divergens]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_006900603.1| PREDICTED: protein SEC13 homolog [Elephantulus edwardii]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNVLASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDFGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G WD  +I  AH IG  AVSWAP++ PG L+
Sbjct  126  DGAISLLTYTGEGQWDVKKISNAHTIGCNAVSWAPAVVPGNLI  168



>ref|XP_003982518.1| PREDICTED: protein SEC13 homolog [Felis catus]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H    H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_007060002.1| PREDICTED: protein SEC13 homolog [Chelonia mydas]
Length=320

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVIVWKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIVWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ +   DG W+  +I  AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLSYTGDGQWEIKKISNAHTIGCNAVSWAPAVVPGSLI  168



>ref|XP_003265017.1| PREDICTED: protein SEC13 homolog [Nomascus leucogenys]
Length=368

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 121/175 (69%), Gaps = 4/175 (2%)
 Frame = +3

Query  159  DKEGKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA  332
            D+ GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L 
Sbjct  42   DEMGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLR  100

Query  333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP  512
            GH GPVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAP
Sbjct  101  GHEGPVWQVAWAHPMYGNVLASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAP  159

Query  513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            H+ GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  160  HDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLI  214



>ref|XP_003785488.1| PREDICTED: protein SEC13 homolog isoform 2 [Otolemur garnettii]
 ref|XP_003785489.1| PREDICTED: protein SEC13 homolog isoform 3 [Otolemur garnettii]
Length=325

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 119/172 (69%), Gaps = 4/172 (2%)
 Frame = +3

Query  168  GKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH  341
            GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH 
Sbjct  2    GKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHE  60

Query  342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL  521
            GPVWQV+WAHP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ 
Sbjct  61   GPVWQVAWAHPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDY  119

Query  522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  120  GLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLL  171



>ref|XP_008853099.1| PREDICTED: protein SEC13 homolog isoform X1 [Nannospalax galili]
Length=322

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA  368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct  8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA  66

Query  369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS  548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct  67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS  125

Query  549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV  677
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+
Sbjct  126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVIPGSLI  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420