BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031I04

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094426.1|  PREDICTED: enolase                                 385   8e-130   Sesamum indicum [beniseed]
ref|NP_001234080.1|  enolase                                            382   1e-128   Solanum lycopersicum
ref|XP_009623017.1|  PREDICTED: enolase                                 382   2e-128   Nicotiana tomentosiformis
ref|XP_006338945.1|  PREDICTED: enolase-like                            382   3e-128   Solanum tuberosum [potatoes]
ref|XP_004249573.1|  PREDICTED: enolase-like                            381   6e-128   
ref|XP_006341172.1|  PREDICTED: enolase-like                            380   7e-128   Solanum tuberosum [potatoes]
emb|CDP15353.1|  unnamed protein product                                379   2e-127   Coffea canephora [robusta coffee]
ref|NP_001275058.1|  enolase-like                                       379   3e-127   Solanum tuberosum [potatoes]
gb|ACR56690.1|  enolase                                                 377   2e-126   Nicotiana tabacum [American tobacco]
ref|XP_008241309.1|  PREDICTED: enolase                                 376   4e-126   Prunus mume [ume]
ref|XP_007202055.1|  hypothetical protein PRUPE_ppa005779mg             376   5e-126   Prunus persica
ref|XP_011101486.1|  PREDICTED: enolase-like                            375   7e-126   Sesamum indicum [beniseed]
gb|EYU35120.1|  hypothetical protein MIMGU_mgv1a006438mg                375   1e-125   Erythranthe guttata [common monkey flower]
ref|XP_009764205.1|  PREDICTED: enolase-like                            375   1e-125   Nicotiana sylvestris
ref|XP_009612088.1|  PREDICTED: enolase-like                            374   3e-125   Nicotiana tomentosiformis
ref|XP_009365316.1|  PREDICTED: enolase                                 374   4e-125   Pyrus x bretschneideri [bai li]
ref|XP_004303035.1|  PREDICTED: enolase                                 373   5e-125   Fragaria vesca subsp. vesca
ref|XP_008391739.1|  PREDICTED: enolase-like                            371   3e-124   Malus domestica [apple tree]
ref|XP_008386927.1|  PREDICTED: enolase                                 371   3e-124   
gb|KJB16686.1|  hypothetical protein B456_002G243100                    369   3e-124   Gossypium raimondii
gb|KJB16680.1|  hypothetical protein B456_002G243100                    370   4e-124   Gossypium raimondii
ref|XP_004143301.1|  PREDICTED: enolase-like                            371   4e-124   Cucumis sativus [cucumbers]
gb|AAQ18140.1|  enolase                                                 370   7e-124   Gossypium barbadense [Egyptian cotton]
gb|KJB16684.1|  hypothetical protein B456_002G243100                    370   9e-124   Gossypium raimondii
gb|ACG31732.1|  enolase                                                 370   9e-124   Zea mays [maize]
gb|KHG13187.1|  Enolase 1                                               370   1e-123   Gossypium arboreum [tree cotton]
gb|ACN26258.1|  unknown                                                 370   1e-123   Zea mays [maize]
gb|KDP22386.1|  hypothetical protein JCGZ_26217                         370   1e-123   Jatropha curcas
gb|KJB16682.1|  hypothetical protein B456_002G243100                    369   2e-123   Gossypium raimondii
gb|KJB36425.1|  hypothetical protein B456_006G158500                    367   2e-123   Gossypium raimondii
gb|KJB16679.1|  hypothetical protein B456_002G243100                    369   2e-123   Gossypium raimondii
ref|XP_008462531.1|  PREDICTED: enolase                                 369   2e-123   Cucumis melo [Oriental melon]
ref|XP_004962569.1|  PREDICTED: enolase 2-like isoform X2               369   2e-123   Setaria italica
ref|XP_002510911.1|  enolase, putative                                  369   4e-123   Ricinus communis
ref|XP_009353019.1|  PREDICTED: enolase-like                            368   5e-123   Pyrus x bretschneideri [bai li]
ref|XP_007027607.1|  Enolase                                            368   5e-123   
gb|KJB36423.1|  hypothetical protein B456_006G158500                    368   6e-123   Gossypium raimondii
sp|P42896.1|ENO_RICCO  RecName: Full=Enolase; AltName: Full=2-pho...    368   7e-123   Ricinus communis
ref|XP_004962568.1|  PREDICTED: enolase 2-like isoform X1               369   8e-123   
gb|KJB36420.1|  hypothetical protein B456_006G158500                    367   1e-122   Gossypium raimondii
gb|KJB16681.1|  hypothetical protein B456_002G243100                    365   1e-122   Gossypium raimondii
ref|XP_010558960.1|  PREDICTED: bifunctional enolase 2/transcript...    367   2e-122   Tarenaya hassleriana [spider flower]
gb|KHF99213.1|  Enolase 2                                               367   2e-122   Gossypium arboreum [tree cotton]
ref|XP_010094249.1|  hypothetical protein L484_001983                   366   2e-122   
ref|XP_003534043.1|  PREDICTED: enolase                                 367   2e-122   Glycine max [soybeans]
ref|NP_001105371.1|  enolase 2                                          366   3e-122   Zea mays [maize]
ref|XP_003548246.1|  PREDICTED: enolase-like                            366   3e-122   Glycine max [soybeans]
gb|KDP22388.1|  hypothetical protein JCGZ_26219                         366   3e-122   Jatropha curcas
ref|XP_010096850.1|  hypothetical protein L484_003561                   365   7e-122   Morus notabilis
gb|EMS66544.1|  Enolase 1                                               365   8e-122   Triticum urartu
ref|XP_009374527.1|  PREDICTED: enolase                                 365   9e-122   Pyrus x bretschneideri [bai li]
ref|XP_010278245.1|  PREDICTED: enolase 1-like                          365   9e-122   Nelumbo nucifera [Indian lotus]
gb|KHN24421.1|  Enolase                                                 365   1e-121   Glycine soja [wild soybean]
ref|XP_002528580.1|  enolase, putative                                  365   1e-121   
gb|ABW21688.1|  enolase                                                 365   1e-121   Gossypium hirsutum [American cotton]
ref|XP_006481907.1|  PREDICTED: enolase-like                            365   1e-121   Citrus sinensis [apfelsine]
gb|AGH20062.1|  enolase                                                 365   1e-121   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006851831.1|  hypothetical protein AMTR_s00041p00062460          364   2e-121   Amborella trichopoda
ref|XP_004308163.1|  PREDICTED: enolase                                 364   2e-121   Fragaria vesca subsp. vesca
ref|XP_010243562.1|  PREDICTED: enolase 1                               364   2e-121   Nelumbo nucifera [Indian lotus]
sp|Q9LEJ0.1|ENO1_HEVBR  RecName: Full=Enolase 1; AltName: Full=2-...    364   3e-121   Hevea brasiliensis [jebe]
ref|XP_006430314.1|  hypothetical protein CICLE_v10011726mg             361   3e-121   
gb|KJB16683.1|  hypothetical protein B456_002G243100                    363   4e-121   Gossypium raimondii
gb|AEW69686.1|  enolase1                                                363   4e-121   Guzmania wittmackii x Guzmania lingulata
ref|XP_007152407.1|  hypothetical protein PHAVU_004G127500g             363   4e-121   Phaseolus vulgaris [French bean]
gb|KJB07831.1|  hypothetical protein B456_001G046400                    363   5e-121   Gossypium raimondii
ref|XP_010527847.1|  PREDICTED: bifunctional enolase 2/transcript...    364   6e-121   Tarenaya hassleriana [spider flower]
gb|ABR16178.1|  unknown                                                 360   6e-121   Picea sitchensis
gb|AIR93791.1|  enolase                                                 363   6e-121   Kalanchoe fedtschenkoi [lavender-scallops]
gb|EEC74867.1|  hypothetical protein OsI_10758                          363   6e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_007162849.1|  hypothetical protein PHAVU_001G186100g             363   7e-121   Phaseolus vulgaris [French bean]
sp|Q9LEI9.1|ENO2_HEVBR  RecName: Full=Enolase 2; AltName: Full=2-...    363   7e-121   Hevea brasiliensis [jebe]
ref|NP_001049556.1|  Os03g0248600                                       362   8e-121   
gb|KDO61018.1|  hypothetical protein CISIN_1g043137mg                   362   9e-121   Citrus sinensis [apfelsine]
ref|XP_003557232.1|  PREDICTED: enolase 1                               362   1e-120   Brachypodium distachyon [annual false brome]
gb|EMT10090.1|  Enolase 1                                               362   1e-120   
gb|KJB07830.1|  hypothetical protein B456_001G046400                    362   2e-120   Gossypium raimondii
ref|XP_006430313.1|  hypothetical protein CICLE_v10011726mg             362   2e-120   Citrus clementina [clementine]
ref|XP_002283632.1|  PREDICTED: enolase 1                               362   2e-120   Vitis vinifera
ref|XP_010050038.1|  PREDICTED: enolase-like                            362   2e-120   Eucalyptus grandis [rose gum]
gb|AGZ15373.1|  enolase                                                 362   2e-120   Phaseolus vulgaris [French bean]
ref|XP_010907928.1|  PREDICTED: enolase-like                            362   2e-120   Elaeis guineensis
dbj|BAJ90134.1|  predicted protein                                      361   3e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573806.1|  PREDICTED: enolase                                 361   3e-120   Brachypodium distachyon [annual false brome]
ref|XP_003558351.1|  PREDICTED: enolase 2                               361   3e-120   Brachypodium distachyon [annual false brome]
ref|XP_003521438.1|  PREDICTED: enolase-like                            361   3e-120   Glycine max [soybeans]
ref|XP_011041692.1|  PREDICTED: enolase                                 361   4e-120   Populus euphratica
ref|XP_002322420.1|  hypothetical protein POPTR_0015s14380g             361   4e-120   Populus trichocarpa [western balsam poplar]
gb|AGH20061.1|  enolase                                                 361   4e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004514974.1|  PREDICTED: enolase-like                            360   5e-120   Cicer arietinum [garbanzo]
emb|CBI24517.3|  unnamed protein product                                360   6e-120   Vitis vinifera
ref|XP_008376333.1|  PREDICTED: enolase                                 360   7e-120   Malus domestica [apple tree]
gb|ABR17990.1|  unknown                                                 360   7e-120   Picea sitchensis
gb|ABR16337.1|  unknown                                                 360   8e-120   Picea sitchensis
gb|ACN39925.1|  unknown                                                 360   8e-120   Picea sitchensis
ref|XP_010933076.1|  PREDICTED: enolase 2                               360   9e-120   Elaeis guineensis
ref|XP_004964466.1|  PREDICTED: enolase 1-like isoform X4               360   9e-120   Setaria italica
ref|XP_002267091.2|  PREDICTED: enolase                                 362   1e-119   Vitis vinifera
ref|XP_007038456.1|  Enolase isoform 1                                  359   1e-119   Theobroma cacao [chocolate]
dbj|BAJ85279.1|  predicted protein                                      359   1e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL16111.1|AF428279_1  At2g36530/F1O11.16                            355   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421751.1|  hypothetical protein CICLE_v10004965mg             359   2e-119   Citrus clementina [clementine]
ref|NP_001056727.1|  Os06g0136600                                       359   2e-119   
ref|XP_007218006.1|  hypothetical protein PRUPE_ppa005739mg             359   2e-119   Prunus persica
ref|XP_008234357.1|  PREDICTED: enolase                                 359   2e-119   Prunus mume [ume]
ref|XP_006661656.1|  PREDICTED: enolase-like                            359   2e-119   Oryza brachyantha
ref|XP_010277374.1|  PREDICTED: enolase-like                            359   2e-119   Nelumbo nucifera [Indian lotus]
ref|XP_006403745.1|  hypothetical protein EUTSA_v10010378mg             358   3e-119   
ref|XP_004964465.1|  PREDICTED: enolase 1-like isoform X3               359   3e-119   
gb|AFB35652.1|  enolase                                                 358   4e-119   Phytolacca americana [common pokeberry]
ref|XP_002984551.1|  hypothetical protein SELMODRAFT_120189             358   7e-119   Selaginella moellendorffii
ref|XP_009393022.1|  PREDICTED: enolase-like                            358   7e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237329.1|  enolase                                            357   7e-119   
ref|XP_006294225.1|  hypothetical protein CARUB_v10023223mg             357   8e-119   Capsella rubella
gb|AAS66001.1|  LOS2                                                    357   8e-119   Capsella bursa-pastoris
gb|KEH24119.1|  phosphopyruvate hydratase                               357   1e-118   Medicago truncatula
ref|XP_008791285.1|  PREDICTED: enolase isoform X2                      357   2e-118   
ref|XP_008791284.1|  PREDICTED: enolase isoform X1                      357   2e-118   Phoenix dactylifera
gb|ACN50180.1|  enolase                                                 357   2e-118   Annona cherimola [cherimoya]
gb|KJB16685.1|  hypothetical protein B456_002G243100                    356   2e-118   Gossypium raimondii
ref|XP_009401920.1|  PREDICTED: enolase-like                            356   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011018872.1|  PREDICTED: enolase 2                               356   2e-118   Populus euphratica
ref|XP_010050008.1|  PREDICTED: enolase 1                               356   2e-118   Eucalyptus grandis [rose gum]
emb|CAB96173.1|  enolase                                                356   2e-118   Spinacia oleracea
gb|KFK34543.1|  hypothetical protein AALP_AA5G159700                    356   3e-118   Arabis alpina [alpine rockcress]
ref|NP_181192.1|  bifunctional enolase 2/transcriptional activator      356   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381325.1|  phosphopyruvate hydratase family protein           356   3e-118   Populus trichocarpa [western balsam poplar]
gb|AAL59917.1|  putative enolase (2-phospho-D-glycerate hydroylase)     356   3e-118   Arabidopsis thaliana [mouse-ear cress]
gb|KDO65391.1|  hypothetical protein CISIN_1g013317mg                   356   3e-118   Citrus sinensis [apfelsine]
gb|KFK32725.1|  hypothetical protein AALP_AA6G281000                    356   3e-118   Arabis alpina [alpine rockcress]
ref|XP_009133088.1|  PREDICTED: bifunctional enolase 2/transcript...    355   5e-118   Brassica rapa
ref|XP_006490248.1|  PREDICTED: enolase-like                            355   5e-118   Citrus sinensis [apfelsine]
ref|XP_002965441.1|  hypothetical protein SELMODRAFT_167539             355   5e-118   Selaginella moellendorffii
ref|XP_008778664.1|  PREDICTED: enolase-like                            355   5e-118   Phoenix dactylifera
gb|AAL06912.1|  At2g36530/F1O11.16                                      355   6e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49173.1|  enolase                                                 355   6e-118   Oryza sativa Japonica Group [Japonica rice]
sp|Q42971.2|ENO_ORYSJ  RecName: Full=Enolase; AltName: Full=2-pho...    355   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010515776.1|  PREDICTED: bifunctional enolase 2/transcript...    355   8e-118   Camelina sativa [gold-of-pleasure]
gb|ABG65935.1|  Enolase, putative, expressed                            355   9e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002877895.1|  enolase                                            355   9e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_004964464.1|  PREDICTED: enolase 1-like isoform X2               357   1e-117   
ref|XP_006403746.1|  hypothetical protein EUTSA_v10010379mg             354   2e-117   Eutrema salsugineum [saltwater cress]
gb|ABB46862.2|  Enolase, putative, expressed                            355   2e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002881452.1|  hypothetical protein ARALYDRAFT_902771             353   2e-117   Arabidopsis lyrata subsp. lyrata
ref|XP_010505199.1|  PREDICTED: bifunctional enolase 2/transcript...    353   3e-117   Camelina sativa [gold-of-pleasure]
gb|AEM97875.1|  enolase                                                 353   3e-117   Corylus heterophylla
ref|XP_009384633.1|  PREDICTED: enolase                                 353   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010509461.1|  PREDICTED: bifunctional enolase 2/transcript...    353   3e-117   Camelina sativa [gold-of-pleasure]
gb|AAM12985.1|  enolase (2-phospho-D-glycerate hydroylase)              353   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004964463.1|  PREDICTED: enolase 1-like isoform X1               357   4e-117   
gb|ABD92697.1|  los                                                     353   4e-117   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010516879.1|  PREDICTED: bifunctional enolase 2/transcript...    353   4e-117   Camelina sativa [gold-of-pleasure]
gb|AAQ77240.1|  enolase                                                 353   5e-117   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|NP_001064223.1|  Os10g0167300                                       353   6e-117   
ref|XP_010050020.1|  PREDICTED: enolase-like isoform X1                 354   6e-117   Eucalyptus grandis [rose gum]
ref|XP_009143574.1|  PREDICTED: bifunctional enolase 2/transcript...    353   6e-117   Brassica rapa
ref|XP_006291136.1|  hypothetical protein CARUB_v10017251mg             352   8e-117   Capsella rubella
gb|AFW85964.1|  enolase1                                                352   8e-117   
gb|AFW85965.1|  enolase1                                                351   9e-117   
gb|ACL53816.1|  unknown                                                 352   1e-116   Zea mays [maize]
ref|NP_001105896.1|  enolase 1                                          352   1e-116   Zea mays [maize]
ref|XP_010050029.1|  PREDICTED: enolase-like isoform X2                 353   1e-116   Eucalyptus grandis [rose gum]
gb|KHG20587.1|  Enolase 2                                               352   1e-116   Gossypium arboreum [tree cotton]
gb|KHN02262.1|  Enolase                                                 352   1e-116   Glycine soja [wild soybean]
ref|XP_007038457.1|  Enolase isoform 2                                  350   2e-116   
emb|CAB75428.1|  enolase                                                352   2e-116   Lupinus luteus
gb|ABB46861.2|  Enolase, putative, expressed                            353   2e-116   Oryza sativa Japonica Group [Japonica rice]
gb|AAN04181.1|  Putative enolase (2-phospho-D-glycerate hydroylase)     351   2e-116   Oryza sativa Japonica Group [Japonica rice]
gb|KHN18726.1|  Enolase                                                 352   2e-116   Glycine soja [wild soybean]
ref|XP_009141601.1|  PREDICTED: bifunctional enolase 2/transcript...    351   3e-116   Brassica rapa
ref|XP_004494139.1|  PREDICTED: enolase-like                            350   4e-116   
gb|EEC66609.1|  hypothetical protein OsI_32842                          351   4e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_007038458.1|  Enolase isoform 3                                  350   4e-116   
ref|XP_010504049.1|  PREDICTED: bifunctional enolase 2/transcript...    350   1e-115   Camelina sativa [gold-of-pleasure]
gb|EEE65047.1|  hypothetical protein OsJ_20044                          350   1e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751337.1|  predicted protein                                  349   2e-115   
ref|XP_010683886.1|  PREDICTED: enolase                                 349   2e-115   Beta vulgaris subsp. vulgaris [field beet]
sp|Q43321.1|ENO_ALNGL  RecName: Full=Enolase; AltName: Full=2-pho...    348   3e-115   Alnus glutinosa
gb|AAA21277.1|  2-phospho-D-glycerate hydrolase                         348   6e-115   Mesembryanthemum crystallinum
ref|XP_001751336.1|  predicted protein                                  348   6e-115   
sp|Q43130.1|ENO_MESCR  RecName: Full=Enolase; AltName: Full=2-pho...    347   6e-115   Mesembryanthemum crystallinum
emb|CDX73592.1|  BnaC08g24110D                                          347   1e-114   
gb|AFW85966.1|  enolase1                                                346   3e-114   
gb|AAQ77241.1|  enolase                                                 345   5e-114   Brassica napus [oilseed rape]
ref|XP_010426928.1|  PREDICTED: bifunctional enolase 2/transcript...    341   3e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006656609.1|  PREDICTED: enolase 1-like                          321   1e-104   
emb|CDX84555.1|  BnaA03g16750D                                          316   1e-102   
emb|CDY65842.1|  BnaAnng21140D                                          315   2e-102   Brassica napus [oilseed rape]
emb|CDX79684.1|  BnaC03g20200D                                          315   3e-102   
emb|CDY33161.1|  BnaC04g08780D                                          313   1e-101   Brassica napus [oilseed rape]
gb|AES75861.2|  phosphopyruvate hydratase                               311   4e-101   Medicago truncatula
gb|KDO32627.1|  enolase 2                                               311   9e-101   Saprolegnia parasitica CBS 223.65
ref|XP_008619366.1|  enolase 2                                          311   1e-100   Saprolegnia diclina VS20
gb|ETK83693.1|  enolase                                                 302   2e-100   Phytophthora parasitica
gb|ETL37108.1|  enolase                                                 302   2e-100   Phytophthora parasitica
gb|ETL90278.1|  phosphopyruvate hydratase                               304   2e-99    Phytophthora parasitica
ref|XP_003619643.1|  Enolase                                            306   7e-99    
gb|ETO99514.1|  enolase                                                 305   2e-98    Phytophthora parasitica CJ01A1
gb|ETI29888.1|  enolase                                                 305   3e-98    Phytophthora parasitica P1569
gb|ETP27738.1|  enolase                                                 305   3e-98    Phytophthora parasitica P10297
ref|XP_009834734.1|  enolase                                            305   5e-98    Aphanomyces astaci
gb|ETM43595.1|  enolase                                                 305   6e-98    Phytophthora parasitica
gb|ETI47488.1|  enolase                                                 305   7e-98    Phytophthora parasitica P1569
gb|ETM43582.1|  enolase                                                 305   1e-97    Phytophthora parasitica
ref|XP_008907532.1|  enolase                                            305   1e-97    Phytophthora parasitica INRA-310
gb|EPS60909.1|  enolase                                                 297   2e-97    Genlisea aurea
ref|XP_002906751.1|  enolase                                            302   5e-97    Phytophthora infestans T30-4
ref|XP_002906750.1|  enolase                                            301   7e-97    Phytophthora infestans T30-4
emb|CCI48932.1|  unnamed protein product                                301   8e-97    Albugo candida
emb|CCA14125.1|  unnamed protein product                                298   9e-96    Albugo laibachii Nc14
gb|AAN31479.1|  enolase                                                 297   3e-95    Phytophthora infestans [potato late blight]
ref|XP_011133483.1|  enolase                                            291   2e-94    Gregarina niphandrodes
ref|XP_009515820.1|  hypothetical protein PHYSODRAFT_284295             295   3e-94    Phytophthora sojae
ref|XP_009515818.1|  phosphopyruvate hydratase                          295   7e-94    Phytophthora sojae
ref|XP_001415437.1|  predicted protein                                  294   1e-93    Ostreococcus lucimarinus CCE9901
ref|XP_005791836.1|  hypothetical protein EMIHUDRAFT_420746             294   2e-93    Emiliania huxleyi CCMP1516
ref|XP_002772277.1|  Enolase, putative                                  289   3e-93    Perkinsus marinus ATCC 50983
ref|XP_002771110.1|  Enolase, putative                                  292   3e-93    Perkinsus marinus ATCC 50983
emb|CEF96573.1|  Enolase, N-terminal                                    291   2e-92    Ostreococcus tauri
ref|XP_003884000.1|  unnamed protein product                            288   2e-91    Neospora caninum Liverpool
gb|AAR97546.1|  enolase 1                                               286   2e-91    Apodachlya brachynema
ref|XP_002365578.1|  enolase 2                                          288   3e-91    Toxoplasma gondii ME49
ref|XP_008882278.1|  enolase 2                                          287   6e-91    
sp|Q9BPL7.1|ENO2_TOXGO  RecName: Full=Enolase 2; AltName: Full=2-...    284   5e-90    Toxoplasma gondii
ref|XP_001014643.1|  enolase family protein                             283   2e-89    Tetrahymena thermophila SB210
gb|AAB35826.2|  enolase                                                 272   5e-89    Echinochloa phyllopogon
ref|XP_002507278.1|  enolase                                            280   2e-88    Micromonas commoda
ref|XP_002948092.1|  hypothetical protein VOLCADRAFT_79991              280   3e-88    Volvox carteri f. nagariensis
ref|XP_002788374.1|  enolase 2, putative                                272   6e-88    Perkinsus marinus ATCC 50983
gb|EJY82089.1|  Enolase                                                 279   6e-88    Oxytricha trifallax
dbj|BAE07171.1|  enolase 3                                              278   7e-88    Karenia mikimotoi
emb|CDW73138.1|  enolase                                                279   7e-88    Stylonychia lemnae
ref|XP_007515230.1|  enolase                                            280   1e-87    Bathycoccus prasinos
dbj|BAE07165.1|  enolase 3                                              277   1e-87    Karenia brevis
gb|AAR97553.1|  enolase                                                 276   2e-87    Prymnesium parvum
gb|AAL05454.1|AF348915_1  enolase                                       274   3e-87    Nitella opaca
ref|XP_002785646.1|  enolase 2, putative                                277   3e-87    Perkinsus marinus ATCC 50983
dbj|BAE07174.1|  polyprotein                                            283   2e-86    Heterocapsa triquetra
ref|XP_003056091.1|  predicted protein                                  275   2e-86    Micromonas pusilla CCMP1545
gb|AAM69295.1|  enolase                                                 264   3e-86    Musa acuminata AAA Group [Cavendish banana]
ref|XP_011129750.1|  enolase                                            273   4e-86    Gregarina niphandrodes
ref|XP_003074214.1|  enolase (ISS)                                      287   6e-86    
ref|XP_004337411.1|  Enolase, Cterminal TIM barrel domain contain...    273   7e-86    Acanthamoeba castellanii str. Neff
ref|XP_001452406.1|  hypothetical protein                               272   1e-85    Paramecium tetraurelia strain d4-2
ref|XP_002772948.1|  enolase 2, putative                                272   2e-85    Perkinsus marinus ATCC 50983
ref|XP_001423791.1|  hypothetical protein                               271   2e-85    Paramecium tetraurelia strain d4-2
emb|CAI39008.1|  enolase, putative                                      272   2e-85    Paramecium tetraurelia
ref|XP_011131468.1|  enolase                                            271   3e-85    Gregarina niphandrodes
ref|XP_002771109.1|  enolase 2, putative                                266   4e-85    Perkinsus marinus ATCC 50983
ref|XP_008903925.1|  enolase                                            271   7e-85    Phytophthora parasitica INRA-310
gb|EMT25998.1|  Enolase                                                 271   8e-85    
gb|ETO77406.1|  enolase                                                 271   8e-85    Phytophthora parasitica P1976
ref|XP_001702971.1|  enolase                                            271   1e-84    Chlamydomonas reinhardtii
ref|XP_002783667.1|  enolase 2, putative                                270   1e-84    Perkinsus marinus ATCC 50983
gb|AAR97552.1|  enolase                                                 268   1e-84    Phytophthora palmivora
ref|XP_002962785.1|  hypothetical protein SELMODRAFT_165356             271   1e-84    Selaginella moellendorffii
ref|XP_002962502.1|  hypothetical protein SELMODRAFT_78644              271   1e-84    
gb|ABU99625.1|  enolase                                                 268   2e-84    Phytophthora macrochlamydospora
gb|ABU99575.1|  enolase                                                 268   2e-84    Phytophthora nicotianae [buckeye rot agent]
gb|ABU99606.1|  enolase                                                 268   2e-84    Phytophthora clandestina
gb|ABU99620.1|  enolase                                                 268   2e-84    Phytophthora nicotianae [buckeye rot agent]
gb|ABU99560.1|  enolase                                                 268   2e-84    Phytophthora nicotianae [buckeye rot agent]
ref|XP_001963312.1|  GF15876                                            271   2e-84    Drosophila ananassae
gb|ABU99680.1|  enolase                                                 267   2e-84    Phytophthora pseudotsugae
gb|ABU99699.1|  enolase                                                 267   2e-84    Phytophthora nicotianae [buckeye rot agent]
ref|XP_011436227.1|  PREDICTED: enolase-like isoform X1                 268   2e-84    
gb|ABU99708.1|  enolase                                                 267   3e-84    Phytophthora nicotianae [buckeye rot agent]
gb|AIS82610.1|  enolase                                                 268   3e-84    Haemaphysalis flava
gb|ABU99641.1|  enolase                                                 267   3e-84    Phytophthora idaei
gb|ABU99661.1|  enolase                                                 267   3e-84    Phytophthora cactorum
gb|ABU99638.1|  enolase                                                 267   3e-84    Phytophthora iranica
gb|ABU99660.1|  enolase                                                 267   3e-84    Phytophthora cactorum
ref|XP_009015226.1|  hypothetical protein HELRODRAFT_184900             268   3e-84    Helobdella robusta
gb|ABU99634.1|  enolase                                                 267   3e-84    Phytophthora hedraiandra
dbj|GAA51601.1|  enolase                                                268   3e-84    Clonorchis sinensis [oriental liver fluke]
ref|XP_009174927.1|  hypothetical protein T265_10327                    268   5e-84    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_008547917.1|  PREDICTED: enolase isoform X2                      268   5e-84    Microplitis demolitor
dbj|BAN65021.1|  enolase (2-phosphoglycerate dehydratase)               265   6e-84    Babesia bovis
ref|XP_011436228.1|  PREDICTED: enolase-like isoform X2                 268   6e-84    Crassostrea gigas
ref|XP_008547916.1|  PREDICTED: enolase isoform X1                      268   6e-84    
gb|AHK26792.1|  enolase                                                 268   6e-84    
gb|ELU17402.1|  hypothetical protein CAPTEDRAFT_159854                  268   6e-84    
gb|EAW90376.1|  enolase 3 (beta, muscle), isoform CRA_b                 264   7e-84    
emb|CBK20125.2|  unnamed protein product                                268   8e-84    
gb|AHB33499.1|  enolase                                                 267   8e-84    
gb|ABU99643.1|  enolase                                                 266   1e-83    
gb|ETW56576.1|  enolase                                                 268   1e-83    
gb|ABU99702.1|  enolase                                                 266   1e-83    
ref|XP_001347440.1|  enolase                                            267   1e-83    
gb|ABI26619.1|  enolase                                                 267   1e-83    
ref|XP_002408379.1|  enolase, putative                                  259   1e-83    
gb|ABU99624.1|  enolase                                                 266   1e-83    
gb|ABU99664.1|  enolase                                                 266   1e-83    
ref|XP_008206479.1|  PREDICTED: enolase isoform X2                      268   1e-83    
ref|XP_008604438.1|  enolase                                            267   1e-83    
gb|KDO32432.1|  enolase                                                 267   1e-83    
sp|Q9UAL5.1|ENO_PLAFG  RecName: Full=Enolase; AltName: Full=2-pho...    267   1e-83    
gb|ABU99608.1|  enolase                                                 265   1e-83    
gb|AAL05453.1|AF348914_1  enolase                                       264   2e-83    
gb|ABU99652.1|  enolase                                                 265   2e-83    
gb|ABU99636.1|  enolase                                                 265   2e-83    
gb|ABU99648.1|  enolase                                                 263   2e-83    
ref|XP_007935723.1|  PREDICTED: beta-enolase isoform X1                 266   2e-83    
ref|XP_005337413.1|  PREDICTED: beta-enolase isoform X1                 266   2e-83    
gb|ABU99707.1|  enolase                                                 265   2e-83    
ref|XP_006060126.1|  PREDICTED: beta-enolase isoform X1                 266   2e-83    
ref|XP_005882629.1|  PREDICTED: beta-enolase isoform X3                 266   3e-83    
ref|XP_009829255.1|  enolase                                            267   3e-83    
sp|Q967Y8.1|ENO_EIMTE  RecName: Full=Enolase; AltName: Full=2-pho...    266   3e-83    
gb|ABU99673.1|  enolase                                                 264   3e-83    
ref|XP_006771957.1|  PREDICTED: beta-enolase isoform X3                 266   3e-83    
ref|XP_007625118.1|  PREDICTED: beta-enolase isoform X2                 267   3e-83    
gb|ABU99619.1|  enolase                                                 265   3e-83    
gb|AHB39779.1|  enolase                                                 264   3e-83    
sp|Q27727.1|ENO_PLAFA  RecName: Full=Enolase; AltName: Full=2-pho...    266   3e-83    
ref|XP_005399679.1|  PREDICTED: beta-enolase isoform X1                 266   3e-83    
gb|ABU99571.1|  enolase                                                 265   3e-83    
pdb|2XSX|A  Chain A, Crystal Structure Of Human Beta Enolase Enob       266   3e-83    
ref|XP_002785647.1|  enolase 2, putative                                266   3e-83    
gb|AHB39780.1|  enolase                                                 264   3e-83    
ref|XP_002258802.1|  enolase (2-phosphoglycerate dehydratase)           266   3e-83    
ref|XP_004684783.1|  PREDICTED: beta-enolase isoform X1                 266   4e-83    
ref|XP_006060127.1|  PREDICTED: beta-enolase isoform X2                 266   4e-83    
ref|NP_001187631.1|  enolase                                            266   4e-83    
ref|XP_008154940.1|  PREDICTED: beta-enolase isoform X1                 266   4e-83    
ref|XP_011358026.1|  PREDICTED: beta-enolase isoform X1                 266   4e-83    
gb|ABU99679.1|  enolase                                                 264   4e-83    
gb|ABU99569.1|  enolase                                                 264   4e-83    
ref|XP_011313106.1|  PREDICTED: enolase                                 265   5e-83    
gb|ABU99731.1|  enolase                                                 264   5e-83    
ref|XP_006922310.1|  PREDICTED: beta-enolase                            266   5e-83    
gb|ABU99654.1|  enolase                                                 264   5e-83    
gb|ABU99588.1|  enolase                                                 264   5e-83    
gb|ABU99732.1|  enolase                                                 264   5e-83    
gb|ABU99677.1|  enolase                                                 264   5e-83    
gb|AHB39781.1|  enolase                                                 264   5e-83    
ref|XP_008154941.1|  PREDICTED: beta-enolase isoform X2                 265   5e-83    
sp|O02654.1|ENO_DORPE  RecName: Full=Enolase; AltName: Full=2-pho...    265   5e-83    
gb|ABU99674.1|  enolase                                                 264   5e-83    
gb|ABU99734.1|  enolase                                                 264   5e-83    
gb|ABU99572.1|  enolase                                                 264   5e-83    
gb|ABU99675.1|  enolase                                                 264   5e-83    
gb|KJB36422.1|  hypothetical protein B456_006G158500                    263   5e-83    
ref|XP_002430191.1|  Enolase, putative                                  267   5e-83    
gb|ABU99656.1|  enolase                                                 264   5e-83    
gb|ABU99559.1|  enolase                                                 264   5e-83    
ref|XP_002736959.2|  PREDICTED: alpha-enolase-like                      262   5e-83    
gb|AHB39782.1|  enolase                                                 264   6e-83    
gb|ABU99570.1|  enolase                                                 264   6e-83    
gb|AHB39784.1|  enolase                                                 264   6e-83    
gb|ABU99691.1|  enolase                                                 264   6e-83    
gb|ABU99564.1|  enolase                                                 264   6e-83    
gb|AHB39783.1|  enolase                                                 263   6e-83    
gb|AAH17249.1|  Enolase 3 (beta, muscle)                                265   6e-83    
gb|ABU99640.1|  enolase                                                 264   6e-83    
gb|ABU99612.1|  enolase                                                 264   6e-83    
gb|ABU99607.1|  enolase                                                 264   7e-83    
gb|ABU99556.1|  enolase                                                 264   7e-83    
ref|XP_008568320.1|  PREDICTED: beta-enolase                            265   7e-83    
gb|ABU99632.1|  enolase                                                 264   7e-83    
ref|XP_004604990.1|  PREDICTED: beta-enolase isoform X1                 265   7e-83    
ref|XP_004716191.1|  PREDICTED: beta-enolase isoform X1                 265   7e-83    
ref|XP_003426353.2|  PREDICTED: enolase isoform X1                      267   7e-83    
ref|XP_011358029.1|  PREDICTED: beta-enolase isoform X2                 265   8e-83    
gb|ABU99639.1|  enolase                                                 263   8e-83    
ref|XP_005882628.1|  PREDICTED: beta-enolase isoform X2                 266   8e-83    
ref|XP_010744631.1|  PREDICTED: enolase-like isoform X2                 265   8e-83    
ref|XP_003791260.1|  PREDICTED: beta-enolase isoform 1                  265   9e-83    
gb|KFP49252.1|  Alpha-enolase                                           258   9e-83    
ref|XP_006771956.1|  PREDICTED: beta-enolase isoform X2                 266   9e-83    
ref|XP_004716192.1|  PREDICTED: beta-enolase isoform X2                 265   1e-82    
emb|CAG32389.1|  hypothetical protein RCJMB04_24e12                     258   1e-82    
ref|XP_007521410.1|  PREDICTED: beta-enolase isoform X1                 265   1e-82    
gb|ABU99647.1|  enolase                                                 263   1e-82    
ref|XP_004684784.1|  PREDICTED: beta-enolase isoform X2                 265   1e-82    
ref|XP_007483315.1|  PREDICTED: beta-enolase isoform X2                 265   1e-82    
ref|XP_005337414.1|  PREDICTED: beta-enolase isoform X2                 265   1e-82    
gb|ABU99613.1|  enolase                                                 263   1e-82    
gb|ABU99628.1|  enolase                                                 263   1e-82    
gb|ABU99729.1|  enolase                                                 263   1e-82    
gb|ABU99676.1|  enolase                                                 263   1e-82    
ref|XP_001611923.1|  enolase  (2-phosphoglycerate dehydratase)          265   1e-82    
gb|ABU99651.1|  enolase                                                 263   1e-82    
gb|ABU99730.1|  enolase                                                 263   1e-82    
gb|ABU99689.1|  enolase                                                 263   1e-82    
ref|XP_006863373.1|  PREDICTED: beta-enolase isoform X1                 265   1e-82    
gb|ABU99597.1|  enolase                                                 263   1e-82    
gb|ABU99578.1|  enolase                                                 263   1e-82    
ref|XP_003416918.2|  PREDICTED: beta-enolase isoform X1                 264   1e-82    
gb|ABU99645.1|  enolase                                                 263   2e-82    
gb|ABU99565.1|  enolase                                                 263   2e-82    
ref|XP_004376151.1|  PREDICTED: beta-enolase isoform 2                  264   2e-82    
emb|CAK47551.3|  enolase                                                264   2e-82    
gb|ABU99718.1|  enolase                                                 263   2e-82    
ref|XP_004376150.1|  PREDICTED: beta-enolase isoform 1                  264   2e-82    
ref|XP_001366144.2|  PREDICTED: beta-enolase isoform X1                 265   2e-82    
gb|ABU99614.1|  enolase                                                 263   2e-82    
gb|ABU99604.1|  enolase                                                 263   2e-82    
gb|ABU99650.1|  enolase                                                 263   2e-82    
gb|ABU99617.1|  enolase                                                 263   2e-82    
gb|ABU99553.1|  enolase                                                 263   2e-82    
emb|CEG76656.1|  Putative Enolase                                       258   2e-82    
gb|ABU99701.1|  enolase                                                 263   2e-82    
gb|ABU99633.1|  enolase                                                 263   2e-82    
gb|ABU99557.1|  enolase                                                 263   2e-82    
ref|XP_005295339.1|  PREDICTED: beta-enolase                            260   2e-82    
ref|XP_005256578.1|  PREDICTED: beta-enolase isoform X1                 264   2e-82    
ref|XP_010744629.1|  PREDICTED: enolase-like isoform X1                 265   2e-82    
gb|ABU99709.1|  enolase                                                 263   2e-82    
ref|XP_005597080.1|  PREDICTED: beta-enolase isoform X1                 264   2e-82    
ref|XP_003791262.1|  PREDICTED: beta-enolase isoform 3                  265   2e-82    
emb|CAK47550.1|  enolase                                                264   2e-82    
emb|CAA36216.1|  muscle-specific enolase                                264   2e-82    
ref|XP_011161551.1|  PREDICTED: enolase isoform X1                      265   2e-82    
ref|XP_004433267.1|  PREDICTED: beta-enolase isoform 1                  264   2e-82    
ref|XP_004760508.1|  PREDICTED: beta-enolase isoform X1                 264   2e-82    
gb|EGW01873.1|  Alpha-enolase                                           263   2e-82    
ref|XP_004604991.1|  PREDICTED: beta-enolase isoform X2                 264   2e-82    
ref|XP_006863374.1|  PREDICTED: beta-enolase isoform X2                 264   2e-82    
ref|NP_037081.2|  beta-enolase                                          264   2e-82    
gb|ABU99579.1|  enolase                                                 262   2e-82    
ref|XP_011235325.1|  PREDICTED: beta-enolase isoform X1                 265   2e-82    
ref|XP_006994179.1|  PREDICTED: beta-enolase                            263   2e-82    
ref|NP_001254531.1|  beta-enolase                                       263   2e-82    
ref|XP_004594912.1|  PREDICTED: beta-enolase isoform X1                 263   2e-82    
ref|XP_010604102.1|  PREDICTED: beta-enolase isoform X1                 264   2e-82    
gb|ACZ51355.1|  enolase                                                 264   2e-82    
ref|XP_004447281.1|  PREDICTED: beta-enolase isoform 3                  264   3e-82    
gb|ABU99583.1|  enolase                                                 262   3e-82    
ref|XP_005067533.1|  PREDICTED: beta-enolase isoform X1                 263   3e-82    
ref|XP_004222043.1|  enolase                                            264   3e-82    
ref|XP_004058398.1|  PREDICTED: beta-enolase isoform 1                  263   3e-82    
ref|XP_004398638.1|  PREDICTED: beta-enolase isoform 1                  263   3e-82    
gb|ABU99681.1|  enolase                                                 262   3e-82    
ref|XP_011235326.1|  PREDICTED: beta-enolase isoform X2                 263   3e-82    
ref|XP_005693511.1|  PREDICTED: beta-enolase isoform X1                 264   3e-82    
gb|ABU99600.1|  enolase                                                 262   3e-82    
ref|XP_006151928.1|  PREDICTED: beta-enolase isoform X1                 263   3e-82    
ref|XP_007254360.1|  PREDICTED: alpha-enolase-like                      263   3e-82    
ref|XP_004760509.1|  PREDICTED: beta-enolase isoform X2                 263   3e-82    
gb|ABU99678.1|  enolase                                                 262   3e-82    
gb|ABU99611.1|  enolase                                                 262   3e-82    
ref|NP_001967.3|  beta-enolase isoform 1                                263   3e-82    
ref|XP_008686158.1|  PREDICTED: beta-enolase                            263   3e-82    
ref|XP_003512064.2|  PREDICTED: alpha-enolase isoform X2                263   3e-82    
gb|ABU99567.1|  enolase                                                 262   3e-82    
gb|ABU99694.1|  enolase                                                 262   3e-82    
gb|ABU99723.1|  enolase                                                 262   3e-82    
gb|ABU99558.1|  enolase                                                 262   3e-82    
ref|XP_005220294.1|  PREDICTED: beta-enolase isoform X1                 263   3e-82    
gb|ABU99568.1|  enolase                                                 262   3e-82    
ref|XP_010678396.1|  PREDICTED: enolase 1, chloroplastic                265   3e-82    
gb|AEE62664.1|  unknown                                                 264   3e-82    
gb|ABU99703.1|  enolase                                                 262   3e-82    
ref|XP_007631689.1|  PREDICTED: alpha-enolase isoform X3                263   3e-82    
gb|ABU99704.1|  enolase                                                 262   3e-82    
gb|ABU99659.1|  enolase                                                 262   3e-82    
emb|CDI97979.1|  enolase                                                263   3e-82    
ref|XP_004012648.1|  PREDICTED: beta-enolase                            263   3e-82    
ref|XP_010604103.1|  PREDICTED: beta-enolase isoform X2                 263   4e-82    
ref|XP_007432114.1|  PREDICTED: alpha-enolase                           260   4e-82    
gb|ABU99695.1|  enolase                                                 262   4e-82    
ref|NP_001075554.1|  beta-enolase                                       263   4e-82    
ref|XP_006903348.1|  PREDICTED: beta-enolase isoform X1                 264   4e-82    
ref|XP_004638386.1|  PREDICTED: beta-enolase isoform X1                 263   4e-82    
ref|XP_005669210.1|  PREDICTED: beta-enolase isoform X1                 263   4e-82    
gb|ABU99550.1|  enolase                                                 261   4e-82    
ref|XP_003466342.1|  PREDICTED: beta-enolase isoform 1                  263   4e-82    
gb|ABU99710.1|  enolase                                                 262   4e-82    
gb|ABU99561.1|  enolase                                                 262   4e-82    
ref|XP_010594837.1|  PREDICTED: beta-enolase isoform X2                 263   4e-82    
gb|ABU99690.1|  enolase                                                 262   4e-82    
gb|ABU99682.1|  enolase                                                 262   4e-82    
ref|XP_008854145.1|  PREDICTED: beta-enolase                            263   4e-82    
gb|ABU99684.1|  enolase                                                 259   4e-82    
ref|XP_005619976.1|  PREDICTED: beta-enolase isoform X2                 263   4e-82    
ref|XP_003996194.1|  PREDICTED: beta-enolase                            263   4e-82    
gb|ABU99603.1|  enolase                                                 261   4e-82    
gb|ABU99562.1|  enolase                                                 261   5e-82    
ref|XP_004666960.1|  PREDICTED: beta-enolase isoform X1                 263   5e-82    
ref|NP_001029874.1|  beta-enolase                                       263   5e-82    
ref|XP_004901365.1|  PREDICTED: beta-enolase isoform X5                 263   5e-82    
ref|XP_004804268.1|  PREDICTED: beta-enolase isoform X1                 264   5e-82    
ref|NP_001037992.1|  beta-enolase                                       263   5e-82    
ref|XP_007483316.1|  PREDICTED: beta-enolase isoform X3                 263   5e-82    
ref|XP_004660313.1|  PREDICTED: beta-enolase-like isoform X1            263   5e-82    
ref|XP_005669211.1|  PREDICTED: beta-enolase isoform X2                 263   5e-82    
ref|XP_003963162.1|  PREDICTED: alpha-enolase-like isoform 1            263   6e-82    
gb|ABU99605.1|  enolase                                                 261   6e-82    
ref|XP_010739239.1|  PREDICTED: alpha-enolase isoform X1                263   6e-82    
gb|AEU04637.1|  enolase                                                 261   6e-82    
gb|ABU99669.1|  enolase                                                 261   6e-82    
ref|XP_008283661.1|  PREDICTED: enolase-like                            263   6e-82    
ref|XP_008064118.1|  PREDICTED: beta-enolase isoform X1                 263   6e-82    
ref|NP_031959.1|  beta-enolase                                          263   6e-82    
gb|EDL12600.1|  enolase 3, beta muscle, isoform CRA_a                   263   6e-82    
gb|AEU04636.1|  enolase                                                 261   6e-82    
gb|ABU99721.1|  enolase                                                 261   7e-82    
gb|ABU99672.1|  enolase                                                 261   7e-82    
ref|XP_004804269.1|  PREDICTED: beta-enolase isoform X2                 263   7e-82    



>ref|XP_011094426.1| PREDICTED: enolase [Sesamum indicum]
Length=444

 Score =   385 bits (990),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVDV LSN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLSNGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQT IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|NP_001234080.1| enolase [Solanum lycopersicum]
 sp|P26300.1|ENO_SOLLC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Solanum 
lycopersicum]
 emb|CAA41115.1| enolase [Solanum lycopersicum]
Length=444

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV +SN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHISNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQT +DNFMV QLDGTQNEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGLDNFMVHQLDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            ++FKE+MKMGCEVYHHL
Sbjct  181  ANFKEAMKMGCEVYHHL  197



>ref|XP_009623017.1| PREDICTED: enolase [Nicotiana tomentosiformis]
Length=444

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV LSN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSLKARQIFDSRGNPTVEVDVHLSNGVWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSII P+LVGKDPTDQT IDNFMV QLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIAPSLVGKDPTDQTGIDNFMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKNIPLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNIPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_006338945.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVDV LSN    RAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLSNGVWERAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQT +DN+MV QLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNYMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_004249573.1| PREDICTED: enolase-like [Solanum lycopersicum]
Length=444

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV LSN    RAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVYLSNGLWERAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQT +DN+MV QLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNYMVHQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_006341172.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   380 bits (977),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV +SN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHVSNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQT +DNFMV +LDGTQNEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            ++FKE+MKMGCEVYHHL
Sbjct  181  ANFKEAMKMGCEVYHHL  197



>emb|CDP15353.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI SVKARQIFDSRGNPTVEVDV +SN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIVSVKARQIFDSRGNPTVEVDVHVSNGVWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPTDQT IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVKN+PLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKNLPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|NP_001275058.1| enolase-like [Solanum tuberosum]
 gb|ABB87127.1| enolase-like [Solanum tuberosum]
Length=443

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV +SN   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVHVSNGVFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPTDQT +DNFMV +LDGTQNEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTDQTGLDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV+N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            ++FKE+MKMGCEVYHHL
Sbjct  181  ANFKEAMKMGCEVYHHL  197



>gb|ACR56690.1| enolase [Nicotiana tabacum]
Length=444

 Score =   377 bits (967),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVDV LSN   ARAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQT +DNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_008241309.1| PREDICTED: enolase [Prunus mume]
Length=444

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQ+VKARQIFDSRGNPTVEVD++LS+  LARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQTVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_007202055.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
 gb|EMJ03254.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
Length=444

 Score =   376 bits (965),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQ+VKARQIFDSRGNPTVEVD++LS+  LARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQTVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_011101486.1| PREDICTED: enolase-like [Sesamum indicum]
Length=444

 Score =   375 bits (964),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVDV L+N   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDVHLTNGIWARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGK+PTDQT IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNTIIGPALVGKNPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA+ NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAALLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|EYU35120.1| hypothetical protein MIMGU_mgv1a006438mg [Erythranthe guttata]
Length=444

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+SVKARQIFDSRGNPTVEVD+ LSN   ARAAVPSGASTG+YEALELRDGGS+YLG
Sbjct  1    MATIKSVKARQIFDSRGNPTVEVDIHLSNGLWARAAVPSGASTGVYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPTDQT IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGAAV +IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGAAVLDIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_009764205.1| PREDICTED: enolase-like [Nicotiana sylvestris]
Length=444

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LSN   ARAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKIVKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQT +DNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_009612088.1| PREDICTED: enolase-like [Nicotiana tomentosiformis]
Length=444

 Score =   374 bits (959),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LSN   ARAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKIVKARQIFDSRGNPTVEVDVTLSNGVFARAAVPSGASTGIYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKD TDQT +DNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDATDQTGLDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA +N+PLYKHIA+LAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAAARNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMGCEVYHHL
Sbjct  181  SSFKEAMKMGCEVYHHL  197



>ref|XP_009365316.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=444

 Score =   374 bits (959),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQS+KARQIFDSRGNPTVEVD+ILS+  LARAAVPSGASTG+YEALELRDGG DYLG
Sbjct  1    MATIQSIKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_004303035.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=444

 Score =   373 bits (958),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQ VKARQIFDSRGNPTVEVD+ILS+ +LARAAVPSGASTG+YEALELRDGGS+YLG
Sbjct  1    MATIQCVKARQIFDSRGNPTVEVDIILSDGYLARAAVPSGASTGVYEALELRDGGSEYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK  PLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKTPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_008391739.1| PREDICTED: enolase-like [Malus domestica]
Length=444

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVD+ILS+  LARAAVPSGASTG+YEALELRDGG DYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVN+IIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNTIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK +PLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVAKAGASVKKVPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_008386927.1| PREDICTED: enolase [Malus domestica]
Length=444

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVD+ILS+  LARAAVPSGASTG+YEALELRDGG DYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK IPLYKHIANLAGN  LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVAKAGASVKKIPLYKHIANLAGNXNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|KJB16686.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=386

 Score =   369 bits (948),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|KJB16680.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=419

 Score =   370 bits (950),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_004143301.1| PREDICTED: enolase-like [Cucumis sativus]
 ref|XP_004164073.1| PREDICTED: enolase-like [Cucumis sativus]
 gb|KGN48232.1| hypothetical protein Csa_6G450370 [Cucumis sativus]
Length=444

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVD++LS+  LARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIVLSDGSLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDPT+Q  IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNAIIGPALVGKDPTEQAQIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLY+HIANLAGN +LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNSQLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|AAQ18140.1| enolase [Gossypium barbadense]
Length=445

 Score =   370 bits (951),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|KJB16684.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   370 bits (950),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|ACG31732.1| enolase [Zea mays]
Length=446

 Score =   370 bits (950),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|KHG13187.1| Enolase 1 [Gossypium arboreum]
 gb|KJB16678.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=445

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|ACN26258.1| unknown [Zea mays]
 tpg|DAA46777.1| TPA: putative enolase family protein isoform 1 [Zea mays]
 tpg|DAA46778.1| TPA: putative enolase family protein isoform 2 [Zea mays]
Length=446

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|KDP22386.1| hypothetical protein JCGZ_26217 [Jatropha curcas]
Length=445

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVKLSDGTVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VKNIPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGATVKNIPLYQHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|KJB16682.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=429

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|KJB36425.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=386

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>gb|KJB16679.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=442

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_008462531.1| PREDICTED: enolase [Cucumis melo]
Length=444

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVD++LS+  LARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDIVLSDGTLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDPT+Q  IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNAIIGPALVGKDPTEQAQIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGN +LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNSQLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_004962569.1| PREDICTED: enolase 2-like isoform X2 [Setaria italica]
Length=445

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPT QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA++K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  181  ASFKEAMKMGVEVYHNL  197



>ref|XP_002510911.1| enolase, putative [Ricinus communis]
 gb|EEF51513.1| enolase, putative [Ricinus communis]
Length=445

 Score =   369 bits (946),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 186/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+ VKARQIFDSRGNPTVEVDVILS+  LARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MTTIKVVKARQIFDSRGNPTVEVDVILSDGTLARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_009353019.1| PREDICTED: enolase-like [Pyrus x bretschneideri]
Length=444

 Score =   368 bits (945),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIF SRGNPTVEVD+ILS+  LARAAVPSGASTG+YEALELRDGG DYLG
Sbjct  1    MATIQSVKARQIFASRGNPTVEVDIILSDGTLARAAVPSGASTGVYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVN+IIGPAL+GKDP++QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNTIIGPALIGKDPSEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAV KAGA+VK +PLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVAKAGASVKKVPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_007027607.1| Enolase [Theobroma cacao]
 gb|EOY08109.1| Enolase [Theobroma cacao]
Length=445

 Score =   368 bits (945),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI S+KARQIFDSRGNPTVEVDV  SN    RAAVPSGASTG+YEALELRDGG DYLGKG
Sbjct  4    TIVSIKARQIFDSRGNPTVEVDVETSNGKKVRAAVPSGASTGVYEALELRDGGLDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASS
Sbjct  124  VCKAGAEVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>gb|KJB36423.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=439

 Score =   368 bits (944),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>sp|P42896.1|ENO_RICCO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Ricinus 
communis]
 emb|CAA82232.1| enolase [Ricinus communis]
Length=445

 Score =   368 bits (944),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE D+ LS+ HLARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVNSIIGPAL+GKDPT+QTA+DNFMVQ+LDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  LCKAGAHVKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>ref|XP_004962568.1| PREDICTED: enolase 2-like isoform X1 [Setaria italica]
Length=476

 Score =   369 bits (946),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPALVGKDPT QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALVGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA++K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  181  ASFKEAMKMGVEVYHNL  197



>gb|KJB36420.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36421.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36424.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=446

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGKKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>gb|KJB16681.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=383

 Score =   365 bits (937),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/196 (91%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_010558960.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Tarenaya 
hassleriana]
Length=444

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV+LS+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIAAVKARQIFDSRGNPTVEVDVVLSSGFKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAVNNVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVNNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKGIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MKMG EVYH+L
Sbjct  181  SSFSEAMKMGVEVYHNL  197



>gb|KHF99213.1| Enolase 2 [Gossypium arboreum]
Length=446

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/196 (90%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI S+KARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSIKARQIFDSRGNPTVEVDVETSNGRKARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTQQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA V NIPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGAEVLNIPLYRHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_010094249.1| hypothetical protein L484_001983 [Morus notabilis]
 gb|EXB55478.1| hypothetical protein L484_001983 [Morus notabilis]
Length=419

 Score =   366 bits (939),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV+LS+   +RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVVLSDGSFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIGPALVGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGAAV  IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAICKAGAAVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_003534043.1| PREDICTED: enolase [Glycine max]
 gb|KHN27853.1| Enolase [Glycine soja]
Length=445

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKARQIFDSRGNPTVEVDVILS+    RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGSFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|NP_001105371.1| enolase 2 [Zea mays]
 sp|P42895.1|ENO2_MAIZE RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Zea mays]
 gb|AAD04187.1| enolase [Zea mays]
 gb|AAQ17040.2| pollen 2-phosphoglycerate dehydrogenase 2 precursor [Cynodon 
dactylon]
Length=446

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/196 (88%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGS YLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGSYYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNS+IGPAL+GKDPT QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_003548246.1| PREDICTED: enolase-like [Glycine max]
Length=445

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKARQIFDSRGNPTVEVDVILS+    RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGTFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|KDP22388.1| hypothetical protein JCGZ_26219 [Jatropha curcas]
Length=445

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV L++  +ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVKLTDGKVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT +DNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTQLDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKEIPLYQHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_010096850.1| hypothetical protein L484_003561 [Morus notabilis]
 gb|EXB66234.1| hypothetical protein L484_003561 [Morus notabilis]
Length=444

 Score =   365 bits (937),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQ VKARQIFDSRGNPTVEVDV LSN    RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQIVKARQIFDSRGNPTVEVDVGLSNGTKHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALIGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V NIPLYKHIANL+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVNNIPLYKHIANLSGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S+FKE+MKMG EVYHHL
Sbjct  181  STFKEAMKMGVEVYHHL  197



>gb|EMS66544.1| Enolase 1 [Triticum urartu]
Length=449

 Score =   365 bits (937),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  75   SMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYL  254
            +  TIQSVKARQIFDSRGNPTVEVD+ LS+   AR AVPSGASTGIYEALELRDGGSDYL
Sbjct  4    ATTTIQSVKARQIFDSRGNPTVEVDIGLSDGSFARGAVPSGASTGIYEALELRDGGSDYL  63

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAVNNVN+IIGPAL+GKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAV
Sbjct  64   GKGVLKAVNNVNAIIGPALIGKDPTEQTDIDNFMVQQLDGTSNEWGWCKQKLGANAILAV  123

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP G
Sbjct  124  SLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTG  183

Query  615  ASSFKESMKMGCEVYHHL  668
            ASSFKE+MKMG EVYHHL
Sbjct  184  ASSFKEAMKMGVEVYHHL  201



>ref|XP_009374527.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=445

 Score =   365 bits (937),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVTLSDGTYARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_010278245.1| PREDICTED: enolase 1-like [Nelumbo nucifera]
Length=445

 Score =   365 bits (937),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVE DVILS+  +ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCVKARQIFDSRGNPTVEADVILSDGTMARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PALVGKDPT+Q ++DN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIAPALVGKDPTEQVSVDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGAEVYHHL  197



>gb|KHN24421.1| Enolase [Glycine soja]
Length=448

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKARQIFDSRGNPTVEVDVILS+    RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKAVKARQIFDSRGNPTVEVDVILSDGTFHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAVK IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_002528580.1| enolase, putative [Ricinus communis]
 gb|EEF33788.1| enolase, putative [Ricinus communis]
Length=445

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE D+ LS+ HLARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVNSIIGPAL+GKDPT+QTA+DNFMVQ+LDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLYKHIAN AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  LCKAGAHVKGIPLYKHIANHAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>gb|ABW21688.1| enolase [Gossypium hirsutum]
Length=445

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDG  DYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGDFDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_006481907.1| PREDICTED: enolase-like [Citrus sinensis]
 gb|ADD12953.1| 2-phospho-D-glycerate hydrolase [Citrus trifoliata]
Length=445

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H+ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QTAIDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYKHIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>gb|AGH20062.1| enolase [Triticum aestivum]
Length=446

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNSII PALVGKDPT QT +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSIIAPALVGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAT  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_006851831.1| hypothetical protein AMTR_s00041p00062460 [Amborella trichopoda]
 gb|ERN13298.1| hypothetical protein AMTR_s00041p00062460 [Amborella trichopoda]
Length=445

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI SVKARQIFDSRGNPTVEVDV LS+    RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MVTITSVKARQIFDSRGNPTVEVDVGLSDGTCHRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+G+DPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVMKAVGNVNSIIGPALIGRDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKESMKMG EVYHHL
Sbjct  181  SSFKESMKMGVEVYHHL  197



>ref|XP_004308163.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=446

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI+ +KARQIFDSRGNPTVEVDV LS+  LARAAVPSGASTG+YEALELRDGGSDYLGKG
Sbjct  4    TIKLIKARQIFDSRGNPTVEVDVTLSDGTLARAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV NVN IIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVENVNGIIGPALIGKDPTEQTQIDNYMVQQLDGTTNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGATVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_010243562.1| PREDICTED: enolase 1 [Nelumbo nucifera]
Length=444

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQ VKARQIFDSRGNPTVE DV LS+  +ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIQCVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALIGKDPTEQTNIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYKHIANLAGN+ LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAGVKKIPLYKHIANLAGNRTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH L
Sbjct  181  SSFKEAMKMGSEVYHTL  197



>sp|Q9LEJ0.1|ENO1_HEVBR RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00532.1| enolase, isoform 1 [Hevea brasiliensis]
Length=445

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE DV LS+ +LARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN IIGPALVGKDPTDQ  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>ref|XP_006430314.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
 gb|ESR43554.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
Length=356

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H+ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QTAIDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLYKHIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  ICKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>gb|KJB16683.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 184/196 (94%), Gaps = 1/196 (1%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  SN   ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQ FMILPVGAS
Sbjct  123  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQ-FMILPVGAS  181

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  182  SFKEAMKMGVEVYHHL  197



>gb|AEW69686.1| enolase1 [Guzmania wittmackii x Guzmania lingulata]
Length=445

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ ++ARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIQARQIFDSRGNPTVEVDVCLSDGAKARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIGPALIGKDPTEQTQIDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKNIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_007152407.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
 gb|ESW24401.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
Length=445

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LS+   +RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKVVKARQIFDSRGNPTVEVDVTLSDGTFSRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV+KAV NVN+II PAL+GKDPT QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVNKAVENVNTIIAPALIGKDPTKQTEIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA K IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|KJB07831.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=445

 Score =   363 bits (932),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDVSLSDGAVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPTEQAKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA +K IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMLKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_010527847.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Tarenaya hassleriana]
Length=468

 Score =   364 bits (934),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +3

Query  42   VSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEA  221
            +S SR   +S SMATI +VKARQIFDSRGNPTVEVDV+LSN     AAVPSGASTGIYEA
Sbjct  14   LSPSRSTRAS-SMATITAVKARQIFDSRGNPTVEVDVVLSNGAKVTAAVPSGASTGIYEA  72

Query  222  LELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCK  401
            LELRDGGSDYLGKGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK
Sbjct  73   LELRDGGSDYLGKGVSKAVGNVNTIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCK  132

Query  402  EKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            +KLGANAILAVSLAVCKAGA V+ IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKL
Sbjct  133  QKLGANAILAVSLAVCKAGAVVEGIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKL  192

Query  582  AMQEFMILPVGASSFKESMKMGCEVYHHL  668
            AMQEFMILPVGASSF E+MKMG EVYH+L
Sbjct  193  AMQEFMILPVGASSFSEAMKMGVEVYHNL  221



>gb|ABR16178.1| unknown [Picea sitchensis]
Length=380

 Score =   360 bits (925),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKAR IFDSRGNPTVEVD+ LS+ +L+RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQT IDNFMVQ+LDGTQN+WGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVIPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF+E+M+MG EVYHHL
Sbjct  181  SSFREAMQMGSEVYHHL  197



>gb|AIR93791.1| enolase [Kalanchoe fedtschenkoi]
Length=445

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/196 (89%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQ VKARQIFDSRGNPTVEV+V LSN   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQFVKARQIFDSRGNPTVEVEVGLSNGVKARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVN+IIGPAL+GKDPT+Q++IDNFMVQQLDGT NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNTIIGPALIGKDPTEQSSIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA   NIPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  123  AVCKAGANALNIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>gb|EEC74867.1| hypothetical protein OsI_10758 [Oryza sativa Indica Group]
Length=445

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKDPT+QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  ALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_007162849.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
 gb|ESW34843.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
Length=444

 Score =   363 bits (931),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATILSIKARQIFDSRGNPTVEVDLSCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QTAIDN MVQQLDGT NEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTAIDNLMVQQLDGTVNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>sp|Q9LEI9.1|ENO2_HEVBR RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00533.1| enolase, isoform 2 [Hevea brasiliensis]
Length=445

 Score =   363 bits (931),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SV+ARQIFDSRGNPTVE DV LS+ +LARAAVP GASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN IIGPALVGKDPTDQ  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYKH+ANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>ref|NP_001049556.1| Os03g0248600 [Oryza sativa Japonica Group]
 gb|ABF94968.1| Enolase 2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11470.1| Os03g0248600 [Oryza sativa Japonica Group]
 dbj|BAG93549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94076.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58701.1| hypothetical protein OsJ_10141 [Oryza sativa Japonica Group]
Length=445

 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDICCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKDPT+QT IDNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDPTEQTVIDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  ALCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>gb|KDO61018.1| hypothetical protein CISIN_1g043137mg [Citrus sinensis]
Length=445

 Score =   362 bits (930),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H+ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QTAIDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLYKHIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  VCKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_003557232.1| PREDICTED: enolase 1 [Brachypodium distachyon]
Length=447

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TIQSVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  5    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  64

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAVNNVN+IIGPAL+GKDPT+Q  IDNFMVQQLDGT N+WGWCK+KLGANAILAVSLA
Sbjct  65   VLKAVNNVNAIIGPALIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  124

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  125  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  184

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  185  FKEAMKMGVEVYHHL  199



>gb|EMT10090.1| Enolase 1 [Aegilops tauschii]
Length=448

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TIQSVKARQIFDSRGNPTVEVD+ LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  6    TIQSVKARQIFDSRGNPTVEVDIGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  65

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPAL+GKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  66   VLKAVSNVNAIIGPALIGKDPTEQTDIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  125

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+S
Sbjct  126  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAAS  185

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  186  FKEAMKMGVEVYHHL  200



>gb|KJB07830.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=466

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVDV LS+  +ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDVSLSDGAVARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPTEQAKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA +K IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMLKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_006430313.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
 gb|ESR43553.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
Length=445

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI +VKARQIFDSRGNPTVEVDV  S+ H+ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITAVKARQIFDSRGNPTVEVDVTTSDGHVARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV+NVN+IIGPAL GKDPT+QTAIDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVSNVNAIIGPALAGKDPTEQTAIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            +CKAGA VK IPLYKHIA L+GNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS 
Sbjct  124  ICKAGAHVKKIPLYKHIAELSGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASC  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_002283632.1| PREDICTED: enolase 1 [Vitis vinifera]
 emb|CBI30238.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TIQ VKARQIFDSRGNPTVEVD+ LSN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MVTIQFVKARQIFDSRGNPTVEVDIGLSNGAKVSAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDP+DQT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVANVNTIIGPALIGKDPSDQTGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VKNIPLYKHIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAIVKNIPLYKHIANIAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
             SFKE+MKMG EVYHHL
Sbjct  181  PSFKEAMKMGVEVYHHL  197



>ref|XP_010050038.1| PREDICTED: enolase-like [Eucalyptus grandis]
Length=444

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA I+ +KARQIFDSRGNPTVE DV L +   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MAKIKCIKARQIFDSRGNPTVEADVTLDDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV N+NSIIGPALVGKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNINSIIGPALVGKDPTEQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV  IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAVNKIPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|AGZ15373.1| enolase [Phaseolus vulgaris]
Length=444

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATILSIKARQIFDSRGNPTVEVDLSCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QTAIDN MVQQLDGT NEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTAIDNLMVQQLDGTVNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_010907928.1| PREDICTED: enolase-like [Elaeis guineensis]
Length=445

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVD  LS+    RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGSFCRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  ID FMVQQLDGT NEWGWCKEKLGANAIL VS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQAQIDTFMVQQLDGTSNEWGWCKEKLGANAILTVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>dbj|BAJ90134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  6    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  65

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVNSII PAL+GKDPT QT +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  66   GVSKAVGNVNSIIAPALIGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  125

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  126  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  185

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  186  SFKEAMKMGVEVYHNL  201



>ref|XP_003573806.1| PREDICTED: enolase [Brachypodium distachyon]
Length=446

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNSII PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSIIAPALIGKDPTTQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAT  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_003558351.1| PREDICTED: enolase 2 [Brachypodium distachyon]
Length=446

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GV KAV+NVNSIIGPAL+GKD T+QT IDNFMV QLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVLKAVDNVNSIIGPALIGKDATEQTEIDNFMVHQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA++K IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP GAS
Sbjct  123  AVCKAGASIKKIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAS  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_003521438.1| PREDICTED: enolase-like [Glycine max]
Length=444

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVN+II PALVGKDPT QTAIDN MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALVGKDPTQQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAAV  +PLYKHIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGAAVLKVPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_011041692.1| PREDICTED: enolase [Populus euphratica]
Length=445

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI++VKARQIFDSRGNPTVE D++LS+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADIVLSDGTYARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  IDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNSIIGPALIGKDPTEQVQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_002322420.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
 gb|ABK94302.1| unknown [Populus trichocarpa]
 gb|EEF06547.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
Length=445

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI++VKARQIFDSRGNPTVE D++LS+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADILLSDGSYARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+Q  IDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNSIIGPALIGKDPTEQVQIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|AGH20061.1| enolase [Triticum aestivum]
 gb|AGH20063.1| enolase [Triticum aestivum]
Length=446

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 185/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNSII PAL+GKDPT QT +DN+MVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSIIAPALIGKDPTAQTELDNYMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_004514974.1| PREDICTED: enolase-like [Cicer arietinum]
Length=445

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKFVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIAPALIGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA  K IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>emb|CBI24517.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   360 bits (925),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALELRDGGSD+LG
Sbjct  1    MATIKVIKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIYEALELRDGGSDFLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIAPALIGKDPTEQVKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPLGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_008376333.1| PREDICTED: enolase [Malus domestica]
Length=445

 Score =   360 bits (924),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALELRDGGS+YLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVDVTLSDGTYARAAVPSGASTGIYEALELRDGGSNYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S FKE+MKMG EVYHHL
Sbjct  181  SCFKEAMKMGVEVYHHL  197



>gb|ABR17990.1| unknown [Picea sitchensis]
Length=445

 Score =   360 bits (924),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKAR IFDSRGNPTVEVD+ LS+ +L+RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQT IDNFMVQ+LDGTQN+WGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF+E+M+MG EVYHHL
Sbjct  181  SSFREAMQMGSEVYHHL  197



>gb|ABR16337.1| unknown [Picea sitchensis]
Length=445

 Score =   360 bits (924),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKAR IFDSRGNPTVEVD+ LS+ +L+RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQT IDNFMVQ+LDGTQN+WGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF+E+M+MG EVYHHL
Sbjct  181  SSFREAMQMGSEVYHHL  197



>gb|ACN39925.1| unknown [Picea sitchensis]
Length=445

 Score =   360 bits (924),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI++VKAR IFDSRGNPTVEVD+ LS+ +L+RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIKAVKARSIFDSRGNPTVEVDIHLSDGYLSRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDP DQT IDNFMVQ+LDGTQN+WGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNKIIGPALIGKDPVDQTGIDNFMVQELDGTQNQWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIAN+AGNK LV+PVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAYVKKIPLYQHIANIAGNKTLVMPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF+E+M+MG EVYHHL
Sbjct  181  SSFREAMQMGSEVYHHL  197



>ref|XP_010933076.1| PREDICTED: enolase 2 [Elaeis guineensis]
Length=445

 Score =   360 bits (924),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVD  LS+   +RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGTFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSIIGPAL+GKDPT Q  ID FMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVTNVNSIIGPALIGKDPTAQAEIDTFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_004964466.1| PREDICTED: enolase 1-like isoform X4 [Setaria italica]
Length=446

 Score =   360 bits (923),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDNFMVQQLDGT N+WGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_002267091.2| PREDICTED: enolase [Vitis vinifera]
Length=510

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = +3

Query  75   SMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYL  254
            +MATI+ +KARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGIYEALELRDGGSD+L
Sbjct  65   TMATIKVIKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIYEALELRDGGSDFL  124

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAV NVN+II PAL+GKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAV
Sbjct  125  GKGVLKAVENVNAIIAPALIGKDPTEQVKIDNFMVQQLDGTVNEWGWCKQKLGANAILAV  184

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA V  IPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP+G
Sbjct  185  SLAVCKAGAMVNKIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPLG  244

Query  615  ASSFKESMKMGCEVYHHL  668
            ASSFKE+MKMG EVYHHL
Sbjct  245  ASSFKEAMKMGVEVYHHL  262



>ref|XP_007038456.1| Enolase isoform 1 [Theobroma cacao]
 gb|EOY22957.1| Enolase isoform 1 [Theobroma cacao]
Length=445

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+SVKARQIFDSRGNPTVE DV LS+  +ARAAVPSGASTG YEALELRDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>dbj|BAJ85279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATIQSVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIQSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVN II PAL+GKDPT QT +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNLIIAPALIGKDPTAQTELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA+VK IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGASVKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>gb|AAL16111.1|AF428279_1 At2g36530/F1O11.16 [Arabidopsis thaliana]
Length=325

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  181  ASFKEAMKMGVEVYHHL  197



>ref|XP_006421751.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
 gb|ESR34991.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
Length=445

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV LS+  LARAAVPSGASTGIYEALELRDGG DY G
Sbjct  1    MATINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTQQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S+FKE+MKMG EVYHHL
Sbjct  181  STFKEAMKMGVEVYHHL  197



>ref|NP_001056727.1| Os06g0136600 [Oryza sativa Japonica Group]
 dbj|BAD68461.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAD68886.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAF18641.1| Os06g0136600 [Oryza sativa Japonica Group]
 gb|EEC79946.1| hypothetical protein OsI_21538 [Oryza sativa Indica Group]
Length=446

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TIQSVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPAL+GKDPT+Q  IDNFMVQQLDGT N WGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_007218006.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
 gb|EMJ19205.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
Length=446

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI+ VKARQIFDSRGNPTVEVDV L +   ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIKLVKARQIFDSRGNPTVEVDVTLFDGTYARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV NVNSIIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAIVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_008234357.1| PREDICTED: enolase [Prunus mume]
Length=446

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI+ VKARQIFDSRGNPTVEVDV L +   ARAAVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIKLVKARQIFDSRGNPTVEVDVTLFDGTYARAAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV NVNSIIGPAL+GKDPT+QT IDN+MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVENVNSIIGPALIGKDPTEQTKIDNYMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  124  VCKAGAIVNKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_006661656.1| PREDICTED: enolase-like [Oryza brachyantha]
Length=446

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAVNNVNS+I PAL+GKDPT Q  IDN+MVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVNNVNSVIAPALIGKDPTAQAEIDNYMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AVCKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  183  SFKEAMKMGVEVYHHL  198



>ref|XP_010277374.1| PREDICTED: enolase-like [Nelumbo nucifera]
Length=445

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI++VKARQIFDSRGNPTVE DV LS+   ARAAVPSGASTG YEALELRDGGS+YLG
Sbjct  1    MVTIKAVKARQIFDSRGNPTVEADVTLSDGTQARAAVPSGASTGCYEALELRDGGSNYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+QT IDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALIGKDPTEQTKIDNFMVQELDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGTEVYHHL  197



>ref|XP_006403745.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
 dbj|BAJ33773.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45198.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
Length=444

 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S     RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITHVKARQIFDSRGNPTVEVDVHTSTGVQVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_004964465.1| PREDICTED: enolase 1-like isoform X3 [Setaria italica]
Length=470

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDNFMVQQLDGT N+WGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>gb|AFB35652.1| enolase [Phytolacca americana]
Length=444

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+ VKARQI+DSRGNPTVE DV L +   ARAAVPSGASTGIYEALELRDGGSDY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADVHLDDGTFARAAVPSGASTGIYEALELRDGGSDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAVNNVN IIGPALVGKDPT QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVQKAVNNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK  PLYKHIA LAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAQVKKTPLYKHIAELAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFK++MKMG EVYHHL
Sbjct  181  SSFKDAMKMGSEVYHHL  197



>ref|XP_002984551.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
 gb|EFJ14601.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
Length=446

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            +IQ VKAR IFDSRGNPTVEVDV+LS+    RAAVPSGASTG+YEALELRDGG DY+GKG
Sbjct  4    SIQQVKARTIFDSRGNPTVEVDVVLSDKSYYRAAVPSGASTGVYEALELRDGGKDYMGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAVNNVN+IIGPALVGKDPTDQT IDNFMV +LDGTQN+WGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVNNVNAIIGPALVGKDPTDQTGIDNFMVHELDGTQNKWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLY+HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGASS
Sbjct  124  VCKAGAGVSKIPLYQHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            F+E+MKMG EVYH L
Sbjct  184  FREAMKMGAEVYHSL  198



>ref|XP_009393022.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA I SVKARQIFDSRGNPTVEVDV L++   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MAAIASVKARQIFDSRGNPTVEVDVCLTDGTCARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVANVNAIIGPALIGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANIAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|NP_001237329.1| enolase [Glycine max]
 gb|AAS18240.1| enolase [Glycine max]
Length=444

 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+ ARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIVSINARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVN++IGPAL+GKDPT+QTAIDN MVQQLDGT NEWGWCK+KLGANAILAV 
Sbjct  61   KGVSKAVDNVNTVIGPALIGKDPTEQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVF  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLYKHIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGASVLKIPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_006294225.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
 gb|EOA27123.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
Length=444

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|AAS66001.1| LOS2 [Capsella bursa-pastoris]
Length=444

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|KEH24119.1| phosphopyruvate hydratase [Medicago truncatula]
Length=444

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA I S+KARQIFDSRGNPTVEVD+ +S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MAAITSIKARQIFDSRGNPTVEVDITVSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+II PAL+GKDPT QT IDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVANVNTIIAPALIGKDPTQQTEIDNFMVQKLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  121  LAVCKAGANVLKIPLYKHIANIAGNKHLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_008791285.1| PREDICTED: enolase isoform X2 [Phoenix dactylifera]
Length=436

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVD  L++   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLTDGSFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV +VN+II PAL+GKDPT Q  +DNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGHVNTIIAPALIGKDPTQQAEVDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_008791284.1| PREDICTED: enolase isoform X1 [Phoenix dactylifera]
Length=445

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVD  L++   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLTDGSFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV +VN+II PAL+GKDPT Q  +DNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGHVNTIIAPALIGKDPTQQAEVDNFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>gb|ACN50180.1| enolase [Annona cherimola]
Length=445

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+S+KARQIFDSRGNPTVEVD  L++   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKSIKARQIFDSRGNPTVEVDCTLNDGSFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PALVGKDPTDQ  IDN+MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVGNVNTIIAPALVGKDPTDQAGIDNYMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  181  ASFKEAMKMGVEVYHNL  197



>gb|KJB16685.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=435

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/196 (89%), Positives = 180/196 (92%), Gaps = 10/196 (5%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVE          ARAAVPSGASTGIYEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVE----------ARAAVPSGASTGIYEALELRDGGSDYLGK  52

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV NVN+IIGPAL+GKDPT+QTAIDNFMVQQLDGTQNEWGWCK+KLGANAILAVSL
Sbjct  53   GVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSL  112

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            AVCKAGA VK +PLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS
Sbjct  113  AVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  172

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYHHL
Sbjct  173  SFKEAMKMGVEVYHHL  188



>ref|XP_009401920.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+SVKARQIFDSRGNPTVEVD+   +   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEVDLHCDDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIAPALIGKDPTEQAQIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_011018872.1| PREDICTED: enolase 2 [Populus euphratica]
Length=445

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVE DV  S+  L+RAAVPSGASTG+YEALELRDGGSDYLGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEADVTTSDGVLSRAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+Q AIDN MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVGNVNTIIGPALIGKDPTEQVAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA  K IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAHAKGIPLYKHIANLAGNKSLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>ref|XP_010050008.1| PREDICTED: enolase 1 [Eucalyptus grandis]
Length=444

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M  I+ +KARQIFDSRGNPTVE D  L +    RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MVKIKCIKARQIFDSRGNPTVEADATLDDGTFVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPALVGKDP DQ AIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVENVNTIIGPALVGKDPRDQIAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGAA   IPLYKHIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAAANKIPLYKHIANIAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>emb|CAB96173.1| enolase [Spinacia oleracea]
Length=444

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+SVKARQIFDSRGNPTVE D+ L +   ARAAVPSGASTGIYEALELRDGG DY+G
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADIHLDDGTFARAAVPSGASTGIYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT+QTAIDNFMVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVFKAVQNVNEIIGPALVGKDPTEQTAIDNFMVQELDGTTNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIA ++GNKK+VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEISGNKKMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF+E+MKMG EVYHHL
Sbjct  181  SSFREAMKMGSEVYHHL  197



>gb|KFK34543.1| hypothetical protein AALP_AA5G159700 [Arabis alpina]
Length=444

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QT+IDNFMV +LDGTQNEWGWCKEKLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTSIDNFMVHELDGTQNEWGWCKEKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|NP_181192.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
 sp|P25696.1|ENO2_ARATH RecName: Full=Bifunctional enolase 2/transcriptional activator; 
AltName: Full=2-phospho-D-glycerate hydro-lyase 2; AltName: 
Full=2-phosphoglycerate dehydratase 2; AltName: Full=LOW 
EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1 [Arabidopsis thaliana]
 gb|AAL11597.1|AF424603_1 At2g36530/F1O11.16 [Arabidopsis thaliana]
 emb|CAA41114.1| enolase [Arabidopsis thaliana]
 gb|AAD24635.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AAN12963.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AEC09265.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
Length=444

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  181  ASFKEAMKMGVEVYHHL  197



>ref|XP_006381325.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
 gb|ABK96195.1| unknown [Populus trichocarpa]
 gb|ERP59122.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
Length=445

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVE DV  S+  L+RAAVPSGASTG+YEALELRDGGSDYLGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEADVTTSDGVLSRAAVPSGASTGVYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPT+Q AIDN MVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVGNVNTIIGPALIGKDPTEQVAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA  K IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAHAKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGAEVYHHL  198



>gb|AAL59917.1| putative enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis 
thaliana]
Length=444

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  181  ASFKEAMKMGVEVYHHL  197



>gb|KDO65391.1| hypothetical protein CISIN_1g013317mg [Citrus sinensis]
Length=445

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI +VKARQIFDSRGNPTVEVDV LS+  LARAAVPSGASTGIYEALELRDGG DY G
Sbjct  1    MVTINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHA NKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHADNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S+FKE+MKMG EVYHHL
Sbjct  181  STFKEAMKMGVEVYHHL  197



>gb|KFK32725.1| hypothetical protein AALP_AA6G281000 [Arabis alpina]
Length=444

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGG DYLG
Sbjct  1    MATITGVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGKDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNDIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYHHL
Sbjct  181  SSFKEAMKMGVEVYHHL  197



>ref|XP_009133088.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV  S+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_006490248.1| PREDICTED: enolase-like [Citrus sinensis]
Length=445

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI +VKARQIFDSRGNPTVEVDV LS+  LARAAVPSGASTGIYEALELRDGG DY G
Sbjct  1    MVTINAVKARQIFDSRGNPTVEVDVSLSDGTLARAAVPSGASTGIYEALELRDGGWDYHG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            +GV KAV NVNSIIGPALVGKDPT+QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   RGVLKAVQNVNSIIGPALVGKDPTEQTQIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHA NKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAMVKKIPLYQHIANLAGNKALVLPVPAFNVINGGSHADNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S+FKE+MKMG EVYHHL
Sbjct  181  STFKEAMKMGVEVYHHL  197



>ref|XP_002965441.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
 gb|EFJ32861.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
Length=446

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            +IQ VKAR IFDSRGNPTVEVDV+LS+    RAAVPSGASTG+YEALELRDGG DY+GKG
Sbjct  4    SIQQVKARTIFDSRGNPTVEVDVVLSDKSCYRAAVPSGASTGVYEALELRDGGKDYMGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAVNNVN+IIGPALVGKDPTDQT IDNFMV +LDGTQN+WGWCK+KLGANAILAVSLA
Sbjct  64   VSKAVNNVNAIIGPALVGKDPTDQTGIDNFMVHELDGTQNKWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA V  IPLY HIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGASS
Sbjct  124  VCKAGAGVSKIPLYLHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGASS  183

Query  624  FKESMKMGCEVYHHL  668
            F+E+MKMG EVYH L
Sbjct  184  FREAMKMGAEVYHSL  198



>ref|XP_008778664.1| PREDICTED: enolase-like [Phoenix dactylifera]
Length=445

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ +KARQIFDSRGNPTVEVD  LS+   +RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIKCIKARQIFDSRGNPTVEVDCCLSDGTFSRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT Q  ID FMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIGPALIGKDPTAQAEIDTFMVQQLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+CKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LALCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
             SFKE+MKMG EVYHHL
Sbjct  181  CSFKEAMKMGVEVYHHL  197



>gb|AAL06912.1| At2g36530/F1O11.16 [Arabidopsis thaliana]
Length=444

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN++IGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNVIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  181  ASFKEAMKMGVEVYHHL  197



>gb|AAC49173.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>sp|Q42971.2|ENO_ORYSJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase; AltName: 
Full=OSE1 [Oryza sativa Japonica Group]
 gb|AAP94211.1| enolase [Oryza sativa Japonica Group]
 gb|ABL74573.1| enolase [Oryza sativa Japonica Group]
 gb|ADM86850.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_010515776.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S     RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDN+MV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  +PLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGVPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|ABG65935.1| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=457

 Score =   355 bits (911),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  216

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  217  SFKEAMKMGVEVYHNL  232



>ref|XP_002877895.1| enolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54154.1| enolase [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI ++KARQIFDSRGNPTVEVDV  S     RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITAIKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+G DPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGNDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN KL+LPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKLMLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_004964464.1| PREDICTED: enolase 1-like isoform X2 [Setaria italica]
Length=526

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDNFMVQQLDGT N+WGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>ref|XP_006403746.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
 gb|ESQ45199.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
Length=444

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  S      AAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATITLVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|ABB46862.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQEFMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGAA  216

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  217  SFKEAMKMGVEVYHNL  232



>ref|XP_002881452.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57711.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  S+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITGVKARQIFDSRGNPTVEVDIHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MKMG EVYHHL
Sbjct  181  SSFTEAMKMGVEVYHHL  197



>ref|XP_010505199.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MKMG EVYHHL
Sbjct  181  SSFTEAMKMGVEVYHHL  197



>gb|AEM97875.1| enolase [Corylus heterophylla]
Length=454

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI+ VKARQIFDSRGNPTVEV+V LS+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MATIKLVKARQIFDSRGNPTVEVEVYLSDDRQARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN IIGPALVG DPT+QT ID++MVQ+LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNKIIGPALVGMDPTEQTKIDDYMVQKLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGALVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S FKE+MKMG EVYHHL
Sbjct  181  SCFKEAMKMGVEVYHHL  197



>ref|XP_009384633.1| PREDICTED: enolase [Musa acuminata subsp. malaccensis]
Length=445

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M  I SVKARQIFDSRGNPTVEVD+   +   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MVRITSVKARQIFDSRGNPTVEVDLRCDDGTFARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+II PAL+GKDPT+Q  IDNFMVQQLDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNAIIAPALIGKDPTEQAQIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASVKKIPLYQHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  181  ASFKEAMKMGVEVYHNL  197



>ref|XP_010509461.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MKMG EVYHHL
Sbjct  181  SSFTEAMKMGVEVYHHL  197



>gb|AAM12985.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
Length=444

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVIN GSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINDGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  181  ASFKEAMKMGVEVYHHL  197



>ref|XP_004964463.1| PREDICTED: enolase 1-like isoform X1 [Setaria italica]
Length=550

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAVNNVNSIIGPA++GKDPT+Q  IDNFMVQQLDGT N+WGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVNNVNSIIGPAIIGKDPTEQVDIDNFMVQQLDGTSNDWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  184  FKEAMKMGVEVYHHL  198



>gb|ABD92697.1| los [Brassica rapa subsp. chinensis]
Length=444

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLA N K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLADNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_010516879.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVD+  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDIHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MKMG EVYHHL
Sbjct  181  SSFTEAMKMGVEVYHHL  197



>gb|AAQ77240.1| enolase [Brassica rapa subsp. oleifera]
Length=444

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV  S+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPA +GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPASIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|NP_001064223.1| Os10g0167300 [Oryza sativa Japonica Group]
 dbj|BAF26137.1| Os10g0167300 [Oryza sativa Japonica Group]
Length=446

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ FMILP GA+
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAFMILPTGAA  182

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  183  SFKEAMKMGVEVYHNL  198



>ref|XP_010050020.1| PREDICTED: enolase-like isoform X1 [Eucalyptus grandis]
Length=491

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +3

Query  57   FNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRD  236
             NL   +MA I+ VKARQIFDSRGNP VE DV L +   ARAAVPS ASTGIYEALE+RD
Sbjct  41   LNLRFVAMAKIKCVKARQIFDSRGNPMVEADVTLDDGTFARAAVPSDASTGIYEALEVRD  100

Query  237  GGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGA  416
            G SDYLGKGVSKAV NVN+IIGPALVG DP DQTAIDNFMVQ+LDGT NEWGWCK+KLGA
Sbjct  101  GSSDYLGKGVSKAVENVNTIIGPALVGMDPRDQTAIDNFMVQKLDGTVNEWGWCKQKLGA  160

Query  417  NAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEF  596
            NAILAVSLAVCKAGAA   IPLYKHIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEF
Sbjct  161  NAILAVSLAVCKAGAAANKIPLYKHIANVAGNSKLVLPVPAFNVINGGSHAGNKLAMQEF  220

Query  597  MILPVGASSFKESMKMGCEVYHHL  668
            MILPVGASSFKE+MKMG EVYHHL
Sbjct  221  MILPVGASSFKEAMKMGVEVYHHL  244



>ref|XP_009143574.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_006291136.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
 gb|EOA24034.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
Length=444

 Score =   352 bits (904),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA+I +VKARQIFDSRGNPTVEVDV  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MASITAVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDN+MV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|AFW85964.1| enolase1 [Zea mays]
Length=446

 Score =   352 bits (904),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYH+L
Sbjct  184  FKEAMKMGVEVYHNL  198



>gb|AFW85965.1| enolase1 [Zea mays]
Length=422

 Score =   351 bits (901),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYH+L
Sbjct  184  FKEAMKMGVEVYHNL  198



>gb|ACL53816.1| unknown [Zea mays]
Length=446

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYH+L
Sbjct  184  FKEAMKMGVEVYHNL  198



>ref|NP_001105896.1| enolase 1 [Zea mays]
 sp|P26301.1|ENO1_MAIZE RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1 [Zea mays]
 emb|CAA39454.1| enolase [Zea mays]
Length=446

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPTGASS  183

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYH+L
Sbjct  184  FKEAMKMGVEVYHNL  198



>ref|XP_010050029.1| PREDICTED: enolase-like isoform X2 [Eucalyptus grandis]
Length=491

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +3

Query  57   FNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRD  236
             NL   +MA I+ VKARQIFDSRGNP VE DV L +   ARAAVPS ASTGIYEALE+RD
Sbjct  41   LNLRFVAMAKIKCVKARQIFDSRGNPMVEADVTLDDGTFARAAVPSDASTGIYEALEVRD  100

Query  237  GGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGA  416
            G SDYLGKGVSKAV NVN+IIGPALVG DP DQTAIDNFMVQ+LDGT NEWGWCK+KLGA
Sbjct  101  GSSDYLGKGVSKAVENVNTIIGPALVGMDPRDQTAIDNFMVQKLDGTVNEWGWCKQKLGA  160

Query  417  NAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEF  596
            NAILAVSLAVCKAGAA   IPLYKHIAN+AGN KLVLPVPAFNVINGGSHAGNKLAMQEF
Sbjct  161  NAILAVSLAVCKAGAAANKIPLYKHIANVAGNSKLVLPVPAFNVINGGSHAGNKLAMQEF  220

Query  597  MILPVGASSFKESMKMGCEVYHHL  668
            MILPVGASSFKE+MKMG EVYHHL
Sbjct  221  MILPVGASSFKEAMKMGVEVYHHL  244



>gb|KHG20587.1| Enolase 2 [Gossypium arboreum]
Length=434

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 180/195 (92%), Gaps = 11/195 (6%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI SVKARQIFDSRGNPTVEV          RAAVPSGASTGIYEALELRDGGSD+LGKG
Sbjct  4    TIVSVKARQIFDSRGNPTVEV----------RAAVPSGASTGIYEALELRDGGSDFLGKG  53

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            VSKAV NVN+IIGPAL+GKDPTDQTAIDNFMVQ LDGTQN+WGWCK+KLGANAILAVSLA
Sbjct  54   VSKAVANVNTIIGPALIGKDPTDQTAIDNFMVQ-LDGTQNQWGWCKQKLGANAILAVSLA  112

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VKNIPLYKHIANL+GNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS
Sbjct  113  VCKAGAEVKNIPLYKHIANLSGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  172

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYHHL
Sbjct  173  FKEAMKMGVEVYHHL  187



>gb|KHN02262.1| Enolase [Glycine soja]
Length=457

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 186/210 (89%), Gaps = 13/210 (6%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVN++IGPAL+GKDPT+QTAIDN MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNTVIGPALIGKDPTEQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ---------  590
            LAVCKAGA+V  IPLYKHIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQ         
Sbjct  121  LAVCKAGASVLKIPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQACFLRPFFC  180

Query  591  ----EFMILPVGASSFKESMKMGCEVYHHL  668
                EFM+LPVGASSFKE+MKMG EVYH+L
Sbjct  181  LSVCEFMVLPVGASSFKEAMKMGVEVYHNL  210



>ref|XP_007038457.1| Enolase isoform 2, partial [Theobroma cacao]
 gb|EOY22958.1| Enolase isoform 2, partial [Theobroma cacao]
Length=394

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 181/209 (87%), Gaps = 12/209 (6%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+SVKARQIFDSRGNPTVE DV LS+  +ARAAVPSGASTG YEALELRDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLY------------KHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            LAVCKAGA VK IPLY            +HIANLAGNK LVLPVPAFNVINGGSHAGNKL
Sbjct  121  LAVCKAGAMVKKIPLYQVIFTLFVSSNLQHIANLAGNKTLVLPVPAFNVINGGSHAGNKL  180

Query  582  AMQEFMILPVGASSFKESMKMGCEVYHHL  668
            AMQEFMILPVGASSFKE+MKMG EVYHHL
Sbjct  181  AMQEFMILPVGASSFKEAMKMGVEVYHHL  209



>emb|CAB75428.1| enolase [Lupinus luteus]
Length=444

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI ++KARQIFDSRGNPTVEVD+ LS+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIATIKARQIFDSRGNPTVEVDLTLSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVN+II PAL+GKDPT+QTAIDNF+VQ+LDGT NEWGW K+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALIGKDPTEQTAIDNFIVQELDGTVNEWGWGKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+   IPLYKHIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGASALKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            S+FKE++K+G EVYH+L
Sbjct  181  STFKEALKIGVEVYHNL  197



>gb|ABB46861.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  37   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  96

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  97   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  156

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGAS  620
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ FMILP GA+
Sbjct  157  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAFMILPTGAA  216

Query  621  SFKESMKMGCEVYHHL  668
            SFKE+MKMG EVYH+L
Sbjct  217  SFKEAMKMGVEVYHNL  232



>gb|AAN04181.1| Putative enolase (2-phospho-D-glycerate hydroylase) [Oryza sativa 
Japonica Group]
Length=428

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 1/197 (1%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ-EFMILPVGA  617
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ EFMILP GA
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAEFMILPTGA  182

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  183  ASFKEAMKMGVEVYHNL  199



>gb|KHN18726.1| Enolase [Glycine soja]
Length=455

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 184/208 (88%), Gaps = 11/208 (5%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI S+KARQIFDSRGNPTVEVD+  S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATIVSIKARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVN+II PALVGKDPT QTAIDN MVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNTIIAPALVGKDPTQQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ---------  590
            LAVCKAGAAV  +PLYKHIAN+AGNKKLVLPVPAFNVINGGSHAGNKLAMQ         
Sbjct  121  LAVCKAGAAVLKVPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQACIQRPFFC  180

Query  591  --EFMILPVGASSFKESMKMGCEVYHHL  668
              EFM+LPVGASSFKE+MKMG EVYH+L
Sbjct  181  VWEFMVLPVGASSFKEAMKMGVEVYHNL  208



>ref|XP_009141601.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Brassica 
rapa]
Length=444

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  SN     AAVPSGASTGIYEALELRD GSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDCGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_004494139.1| PREDICTED: enolase-like [Cicer arietinum]
Length=442

 Score =   350 bits (899),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 181/197 (92%), Gaps = 2/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA+I S+KARQIFDSRGNPTVEVD+ +S+   ARAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MASITSIKARQIFDSRGNPTVEVDITVSDGTFARAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV+NVNSII PAL+GKDPT QT IDN M  QLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVDNVNSIIAPALIGKDPTQQTEIDNLM--QLDGTVNEWGWCKQKLGANAILAVS  118

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA+V  IPLYKHIAN+AGNK LVLPVPAFNVINGGSHAGNKLAMQEFM+LPVGA
Sbjct  119  LAVCKAGASVLKIPLYKHIANIAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMVLPVGA  178

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYHHL
Sbjct  179  TSFKEAMKMGVEVYHHL  195



>gb|EEC66609.1| hypothetical protein OsI_32842 [Oryza sativa Indica Group]
 gb|EEE50625.1| hypothetical protein OsJ_30829 [Oryza sativa Japonica Group]
Length=447

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 182/197 (92%), Gaps = 1/197 (1%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGK  260
            ATI SVKARQIFDSRGNPTVEVDV  S+   ARAAVPSGASTG+YEALELRDGGSDYLGK
Sbjct  3    ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSDYLGK  62

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GVSKAV+NVNS+I PAL+GKDPT Q  +DNFMVQQLDGT+NEWGWCK+KLGANAILAVSL
Sbjct  63   GVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVSL  122

Query  441  AVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQ-EFMILPVGA  617
            A+CKAGA +K IPLY+HIANLAGNK+LVLPVPAFNVINGGSHAGNKLAMQ EFMILP GA
Sbjct  123  AICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAEFMILPTGA  182

Query  618  SSFKESMKMGCEVYHHL  668
            +SFKE+MKMG EVYH+L
Sbjct  183  ASFKEAMKMGVEVYHNL  199



>ref|XP_007038458.1| Enolase isoform 3 [Theobroma cacao]
 gb|EOY22959.1| Enolase isoform 3 [Theobroma cacao]
Length=418

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 181/209 (87%), Gaps = 12/209 (6%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+SVKARQIFDSRGNPTVE DV LS+  +ARAAVPSGASTG YEALELRDGGSDYLG
Sbjct  1    MVTIKSVKARQIFDSRGNPTVEADVTLSDGTVARAAVPSGASTGTYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPALVGKDP +Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVENVNTIIGPALVGKDPKEQGKIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLY------------KHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            LAVCKAGA VK IPLY            +HIANLAGNK LVLPVPAFNVINGGSHAGNKL
Sbjct  121  LAVCKAGAMVKKIPLYQVIFTLFVSSNLQHIANLAGNKTLVLPVPAFNVINGGSHAGNKL  180

Query  582  AMQEFMILPVGASSFKESMKMGCEVYHHL  668
            AMQEFMILPVGASSFKE+MKMG EVYHHL
Sbjct  181  AMQEFMILPVGASSFKEAMKMGVEVYHHL  209



>ref|XP_010504049.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S     RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDN+MV +LDGTQNE GWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNYMVHELDGTQNELGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLY+HIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVNGIPLYQHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>gb|EEE65047.1| hypothetical protein OsJ_20044 [Oryza sativa Japonica Group]
Length=462

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 180/211 (85%), Gaps = 16/211 (8%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TIQSVKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TIQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  V----------------SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGW  395
            V                 KAV+NVN+IIGPAL+GKDPT+Q  IDNFMVQQLDGT N WGW
Sbjct  64   VLKAVSNVNTIIGPALIGKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGW  123

Query  396  CKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
            CK+KLGANAILAVSLAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGN
Sbjct  124  CKQKLGANAILAVSLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGN  183

Query  576  KLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            KLAMQEFMILP GASSFKE+MKMG EVYHHL
Sbjct  184  KLAMQEFMILPTGASSFKEAMKMGVEVYHHL  214



>ref|XP_001751337.1| predicted protein [Physcomitrella patens]
 gb|EDQ83654.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQS+KAR IFDSRGNPTVE D++LS+    RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIQSIKARSIFDSRGNPTVEADILLSDGSWYRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV+NVN+IIGPALVGKDPTDQT IDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVQKAVDNVNNIIGPALVGKDPTDQTGIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V   PLY+HIANLAGNK++V+PVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAGVLKTPLYQHIANLAGNKEIVMPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSF E+MK+G EVYH+L
Sbjct  181  SSFTEAMKIGSEVYHNL  197



>ref|XP_010683886.1| PREDICTED: enolase [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M  I+ +KARQI+DSRGNPTVE DV L +   ARAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MVAIKGIKARQIYDSRGNPTVEADVHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN IIGPALVGKDPT+QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVQNVNEIIGPALVGKDPTEQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIA +AGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNPKMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGSEVYHNL  197



>sp|Q43321.1|ENO_ALNGL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Alnus 
glutinosa]
 emb|CAA63121.1| enolase [Alnus glutinosa]
Length=440

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA I  +KARQIFDSRGNPTVE +V  +N  ++RAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MAEITHIKARQIFDSRGNPTVEAEVTTANGVVSRAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAID-NFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            KGV KAV+NVN IIGPAL+GKD T+QTAID +FM QQLDGT NEWGWCK+KLGANAILAV
Sbjct  61   KGVLKAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAV  120

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA+VK IPLYKHIANLAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  180

Query  615  ASSFKESMKMGCEVYHHL  668
            ASSFKE+MKMG EVYHHL
Sbjct  181  ASSFKEAMKMGVEVYHHL  198



>gb|AAA21277.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+ VKARQI+DSRGNPTVE D+ L +   ARAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVYKAVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIA +AGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGSEVYHNL  197



>ref|XP_001751336.1| predicted protein [Physcomitrella patens]
 gb|EDQ83653.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATIQS+KAR I+DSRGNPTVE D+ LS+    RAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MATIQSIKARAIYDSRGNPTVEADIHLSDGSWYRAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV+NVN IIGPALVGKDPT+QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVQKAVDNVNKIIGPALVGKDPTNQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V   PLY+HIANLAGNK++V+PVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAGVSKTPLYQHIANLAGNKEIVMPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MK+G EVYH+L
Sbjct  181  SSFKEAMKIGSEVYHNL  197



>sp|Q43130.1|ENO_MESCR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Mesembryanthemum 
crystallinum]
 gb|AAB34986.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   347 bits (891),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M TI+ VKARQI+DSRGNPTVE D+ L +   ARAAVPSGASTG+YEALELRDGG DY+G
Sbjct  1    MVTIKCVKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKDYMG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN IIGPALVGKDPT QTAIDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVYKAVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA VK IPLY+HIA +AGNK +VLPVPAFNVINGGSHAGNKLAMQEFMILP GA
Sbjct  121  LAVCKAGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILPTGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGSEVYHNL  197



>emb|CDX73592.1| BnaC08g24110D [Brassica napus]
Length=444

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV  S      A++PSGASTGIYEA+ELRDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSTGVKVTASIPSGASTGIYEAVELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV QLDGTQNEWGWCK++LGANAI +VS
Sbjct  61   KGVSKAVRNVNSIIGPALIGKDPTQQTAIDNFMVHQLDGTQNEWGWCKQELGANAIGSVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILP+GA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKVVLPVPAFNVINGGSHAGNKLAMQEFMILPIGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH L
Sbjct  181  SSFKEAMKMGVEVYHTL  197



>gb|AFW85966.1| enolase1 [Zea mays]
Length=445

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 178/195 (91%), Gaps = 1/195 (1%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKG  263
            TI  VKARQIFDSRGNPTVEVDV LS+   AR AVPSGASTGIYEALELRDGGSDYLGKG
Sbjct  4    TITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSDYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KAV+NVN+IIGPA+VGKDPT+Q  IDNFMVQQLDGT NEWGWCK+KLGANAILAVSLA
Sbjct  64   VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS  623
            VCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQ FMILP GASS
Sbjct  124  VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQ-FMILPTGASS  182

Query  624  FKESMKMGCEVYHHL  668
            FKE+MKMG EVYH+L
Sbjct  183  FKEAMKMGVEVYHNL  197



>gb|AAQ77241.1| enolase [Brassica napus]
Length=444

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S+     AAVPSGASTGIYEAL LRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALGLRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KG SKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGASKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGG HAGNKLAMQEFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGLHAGNKLAMQEFMILPVGA  180

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  181  SSFKEAMKMGVEVYHNL  197



>ref|XP_010426928.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=445

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 177/198 (89%), Gaps = 1/198 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S     RAAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVRAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGK-DPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            KGVSKAV NVNSIIGPAL+GK  P  +TAIDN+MV +LDGTQNEWGWCK+KLGANAILAV
Sbjct  61   KGVSKAVGNVNSIIGPALIGKVTPLLRTAIDNYMVHELDGTQNEWGWCKQKLGANAILAV  120

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            SLAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGAVVNGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  180

Query  615  ASSFKESMKMGCEVYHHL  668
            ASSF E+MKMG EVYH+L
Sbjct  181  ASSFTEAMKMGVEVYHNL  198



>ref|XP_006656609.1| PREDICTED: enolase 1-like [Oryza brachyantha]
Length=452

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 170/201 (85%), Gaps = 6/201 (3%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTV------EVDVILSNSHLARAAVPSGASTGIYEALELRDGGS  245
            TIQS+  R ++   G          +VDV LS+   AR AVPSGASTGIYEALELRDGGS
Sbjct  4    TIQSIADRFVWFCAGIDGGGGGGWSQVDVGLSDGSFARGAVPSGASTGIYEALELRDGGS  63

Query  246  DYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAI  425
            DYLGKGV KAVNNVN+IIGPAL+GKDPT+Q  IDNFMVQQLDGT N WGWCK+KLGANAI
Sbjct  64   DYLGKGVLKAVNNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAI  123

Query  426  LAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMIL  605
            LAVSLAVCKAGA VK IPLY+HIANLAGNK LVLPVPAFNVINGGSHAGNKLAMQEFMIL
Sbjct  124  LAVSLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMIL  183

Query  606  PVGASSFKESMKMGCEVYHHL  668
            P GASSFKE+MKMG EVYHHL
Sbjct  184  PTGASSFKEAMKMGVEVYHHL  204



>emb|CDX84555.1| BnaA03g16750D [Brassica napus]
Length=429

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 166/197 (84%), Gaps = 15/197 (8%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI +VKARQIFDSRGNPTVEVDV  S+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  166  SSFKEAMKMGVEVYHNL  182



>emb|CDY65842.1| BnaAnng21140D [Brassica napus]
Length=429

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 165/197 (84%), Gaps = 15/197 (8%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  SN     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSNGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  166  SSFKEAMKMGVEVYHNL  182



>emb|CDX79684.1| BnaC03g20200D [Brassica napus]
Length=429

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 165/197 (84%), Gaps = 15/197 (8%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S+     AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVNSIIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNSIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  166  SSFKEAMKMGVEVYHNL  182



>emb|CDY33161.1| BnaC04g08780D [Brassica napus]
 emb|CDX75031.1| BnaA05g07770D [Brassica napus]
Length=429

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 164/197 (83%), Gaps = 15/197 (8%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MATI  VKARQIFDSRGNPTVEVDV  S      AAVPSGASTGIYEALELRDGGSDYLG
Sbjct  1    MATITVVKARQIFDSRGNPTVEVDVHTSTGVKVTAAVPSGASTGIYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGVSKAV NVN+IIGPAL+GKDPT QTAIDNFMV +LDGTQNEWGWCK+KLGANAILAVS
Sbjct  61   KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA V  IPLYKHIANLAGN K+VLPVPAFN               EFMILPVGA
Sbjct  121  LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFN---------------EFMILPVGA  165

Query  618  SSFKESMKMGCEVYHHL  668
            SSFKE+MKMG EVYH+L
Sbjct  166  SSFKEAMKMGVEVYHNL  182



>gb|AES75861.2| phosphopyruvate hydratase [Medicago truncatula]
Length=429

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 163/197 (83%), Gaps = 17/197 (9%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            + TI+ VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  2    VVTIKIVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGVYEALELRDGGSDYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVNSII PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANAILAVS
Sbjct  62   KGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANAILAVS  121

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LAVCKAGA  K IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQ         
Sbjct  122  LAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQ---------  172

Query  618  SSFKESMKMGCEVYHHL  668
                    MG EVYH+L
Sbjct  173  --------MGVEVYHYL  181



>gb|KDO32627.1| enolase 2 [Saprolegnia parasitica CBS 223.65]
Length=453

 Score =   311 bits (798),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGV  266
            IQS+KARQIFDSRGNPTVEVD++ +   L RAAVPSGASTG +EALELRDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDLV-TEKGLFRAAVPSGASTGEFEALELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAV  446
              AV NVN II P+L+GK+  +Q  ID +MV+ LDGTQNEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   LTAVKNVNEIIAPSLIGKNEVEQKEIDQYMVEVLDGTQNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA KN+PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF
Sbjct  122  CKAGAAAKNVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGATSF  181

Query  627  KESMKMGCEVYHHL  668
             ESMK+G EVYHHL
Sbjct  182  TESMKIGSEVYHHL  195



>ref|XP_008619366.1| enolase 2 [Saprolegnia diclina VS20]
 gb|EQC27179.1| enolase 2 [Saprolegnia diclina VS20]
Length=453

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 169/194 (87%), Gaps = 1/194 (1%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGV  266
            IQS+KARQIFDSRGNPTVEVD++ +   L RAAVPSGASTG +EALELRDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDLV-TEKGLFRAAVPSGASTGEFEALELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAV  446
              AV NVN II P+L+GK+  +Q  ID +MV+ LDGTQNEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   LTAVKNVNEIIAPSLIGKNEVEQKEIDQYMVEVLDGTQNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA KN+PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF
Sbjct  122  CKAGAAAKNVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGAASF  181

Query  627  KESMKMGCEVYHHL  668
             ESMK+G EVYHHL
Sbjct  182  TESMKIGSEVYHHL  195



>gb|ETK83693.1| enolase, partial [Phytophthora parasitica]
 gb|ETK83706.1| enolase, partial [Phytophthora parasitica]
Length=215

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>gb|ETL37108.1| enolase, partial [Phytophthora parasitica]
 gb|ETL37122.1| enolase, partial [Phytophthora parasitica]
Length=221

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>gb|ETL90278.1| phosphopyruvate hydratase, partial [Phytophthora parasitica]
Length=329

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>ref|XP_003619643.1| Enolase [Medicago truncatula]
Length=434

 Score =   306 bits (784),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 163/202 (81%), Gaps = 22/202 (11%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGI-----YEALELRDGG  242
            + TI+ VKARQIFDSRGNPTVEVDV LS+   ARAAVPSGASTGI     YEALELRDGG
Sbjct  2    VVTIKIVKARQIFDSRGNPTVEVDVTLSDGTFARAAVPSGASTGIFGSGVYEALELRDGG  61

Query  243  SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANA  422
            SDYLGKGV KAV NVNSII PAL+GKDPT QT IDNFMVQQLDGT NEWGWCK+KLGANA
Sbjct  62   SDYLGKGVLKAVENVNSIIAPALLGKDPTKQTEIDNFMVQQLDGTVNEWGWCKQKLGANA  121

Query  423  ILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMI  602
            ILAVSLAVCKAGA  K IPLYKHIANLAGNK LVLPVP+FNVINGGSHAGNKLAMQ    
Sbjct  122  ILAVSLAVCKAGALAKKIPLYKHIANLAGNKTLVLPVPSFNVINGGSHAGNKLAMQ----  177

Query  603  LPVGASSFKESMKMGCEVYHHL  668
                         MG EVYH+L
Sbjct  178  -------------MGVEVYHYL  186



>gb|ETO99514.1| enolase, partial [Phytophthora parasitica CJ01A1]
Length=419

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>gb|ETI29888.1| enolase, partial [Phytophthora parasitica P1569]
 gb|ETP41532.1| enolase, partial [Phytophthora parasitica P10297]
Length=453

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>gb|ETP27738.1| enolase, partial [Phytophthora parasitica P10297]
Length=449

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>ref|XP_009834734.1| enolase [Aphanomyces astaci]
 gb|ETV75603.1| enolase [Aphanomyces astaci]
Length=453

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGV  266
            I S+KARQIFDSRGNPTVEVD++  +  L RAAVPSGASTG +EALELRDGG  YLGKGV
Sbjct  3    IISIKARQIFDSRGNPTVEVDLVTEHG-LFRAAVPSGASTGEFEALELRDGGKAYLGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAV  446
            SKAVNNVNSII PAL+GKD  +Q  +D +MV+ LDGT+NEWGWCK+KLGAN+ILAVSLAV
Sbjct  62   SKAVNNVNSIIAPALIGKDEKNQQELDVYMVETLDGTKNEWGWCKKKLGANSILAVSLAV  121

Query  447  CKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K +PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILP GA+SF
Sbjct  122  CKAGAAAKGVPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPTGATSF  181

Query  627  KESMKMGCEVYHHL  668
             ESM++G EVYH L
Sbjct  182  TESMQIGTEVYHTL  195



>gb|ETM43595.1| enolase, partial [Phytophthora parasitica]
 gb|ETM47238.1| enolase, partial [Phytophthora parasitica]
Length=474

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  21   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  79

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  80   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  139

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  140  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  199

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  200  TSFTEAMKIGSEVYHNL  216



>gb|ETI47488.1| enolase, partial [Phytophthora parasitica P1569]
Length=476

 Score =   305 bits (781),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  23   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  81

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  82   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  141

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  142  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  201

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  202  TSFTEAMKIGSEVYHNL  218



>gb|ETM43582.1| enolase, partial [Phytophthora parasitica]
Length=482

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  30   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  88

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  89   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  148

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  149  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  208

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  209  TSFTEAMKIGSEVYHNL  225



>ref|XP_008907532.1| enolase [Phytophthora parasitica INRA-310]
 ref|XP_008916865.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETM97838.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETN07156.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETO72281.1| enolase [Phytophthora parasitica P1976]
Length=483

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  30   MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  88

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PALVGKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  89   KGVLNAVRNVNEIIAPALVGKDVTKQAEIDRFMVEELDGTQNEWGWCKKKLGANAILGVS  148

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  149  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  208

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  209  TSFTEAMKIGSEVYHNL  225



>gb|EPS60909.1| enolase, partial [Genlisea aurea]
Length=291

 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +3

Query  210  IYEALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEW  389
            IYEALELRDGGSDYLGKGVSKAVNNVN+II PAL+GK+PT+QTAIDNFMVQ LDGTQNEW
Sbjct  1    IYEALELRDGGSDYLGKGVSKAVNNVNAIIAPALIGKNPTEQTAIDNFMVQTLDGTQNEW  60

Query  390  GWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHA  569
            GWCK+KLGANAILAVSLAVCKAGAA  NIPLYKHIANLAGNKKLVLPVPAFNVINGGSHA
Sbjct  61   GWCKQKLGANAILAVSLAVCKAGAASLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHA  120

Query  570  GNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            GNKLAMQEFMILPVGASSFKE+MKMG EVYHHL
Sbjct  121  GNKLAMQEFMILPVGASSFKEAMKMGVEVYHHL  153



>ref|XP_002906751.1| enolase [Phytophthora infestans T30-4]
 gb|EEY66152.1| enolase [Phytophthora infestans T30-4]
Length=454

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
             +F E+MK+G EVYH+L
Sbjct  180  KNFTEAMKIGSEVYHNL  196



>ref|XP_002906750.1| enolase [Phytophthora infestans T30-4]
 gb|EEY66151.1| enolase [Phytophthora infestans T30-4]
Length=454

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID FMV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
             +F E+MK+G EVYH+L
Sbjct  180  KNFTEAMKIGSEVYHNL  196



>emb|CCI48932.1| unnamed protein product [Albugo candida]
 emb|CCI48939.1| unnamed protein product [Albugo candida]
Length=447

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGV  266
            I+S+KARQIFDSRGNPTVEVD+        RA+VPSGASTG +EA ELRDGG DY+GKGV
Sbjct  3    IRSIKARQIFDSRGNPTVEVDLHTEKGSF-RASVPSGASTGDFEARELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAV  446
             +A+ NVN II PAL+ K+  DQ+ +D  MV+ LDGT+NEWGWCKEKLGANAILAVSLA+
Sbjct  62   LQAIANVNDIIAPALISKNEVDQSVLDKLMVESLDGTKNEWGWCKEKLGANAILAVSLAI  121

Query  447  CKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K +PL++HIANLAGN    +PVP+FN+INGGSHAGNKLAMQEFMI+P+GA++F
Sbjct  122  CKAGAAAKEVPLWRHIANLAGNPSPCMPVPSFNIINGGSHAGNKLAMQEFMIVPIGAATF  181

Query  627  KESMKMGCEVYHHL  668
            KE+MK+GCEVYH L
Sbjct  182  KEAMKIGCEVYHTL  195



>emb|CCA14125.1| unnamed protein product [Albugo laibachii Nc14]
Length=449

 Score =   298 bits (764),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 164/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGV  266
            IQS+KARQIFDSRGNPTVEVD+   N    RA+VPSGASTG +EA ELRDGG DY+GKGV
Sbjct  3    IQSIKARQIFDSRGNPTVEVDLHTENGSF-RASVPSGASTGDFEARELRDGGKDYMGKGV  61

Query  267  SKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAV  446
              AV NVN +I PAL+ K+  +Q+ +D  MV+ LDGT NEWGWCK+KLGANAILAVSLA+
Sbjct  62   LHAVANVNDVIAPALLHKNEVNQSELDKMMVESLDGTLNEWGWCKKKLGANAILAVSLAI  121

Query  447  CKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSF  626
            CKAGAA K IPL+KHIA+LAGN    +PVP+FN+INGGSHAGNKLAMQEFMILP+GASSF
Sbjct  122  CKAGAAAKKIPLWKHIADLAGNPSPCMPVPSFNIINGGSHAGNKLAMQEFMILPIGASSF  181

Query  627  KESMKMGCEVYHHL  668
            +E+MK+GCEVYH L
Sbjct  182  QEAMKIGCEVYHTL  195



>gb|AAN31479.1| enolase [Phytophthora infestans]
Length=454

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD++       RAAVPSGASTG +EALE+RDGG DY+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLVTELGEY-RAAVPSGASTGEFEALEMRDGGKDYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  ID FMV++LDGTQNEWGW K+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWYKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL++HIA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
             +F E+MK+G EVYH+L
Sbjct  180  KNFTEAMKIGSEVYHNL  196



>ref|XP_011133483.1| enolase, partial [Gregarina niphandrodes]
 gb|EZG43261.1| enolase, partial [Gregarina niphandrodes]
Length=333

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLG  257
            A I SV ARQI DSRGNPTVEVD+        RAAVPSGASTGIYEALELRDG  S YLG
Sbjct  3    AKIVSVHARQILDSRGNPTVEVDLTTEQGCF-RAAVPSGASTGIYEALELRDGDKSTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KA+NNVN+II PALVGKD TDQ  +D  MV+ LDGTQNEWGWCK+KLGANAILA S
Sbjct  62   KGVLKAINNVNTIIAPALVGKDATDQAGLDKLMVESLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLYK++A LAG   +K  LPVPAFNVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAISRAGAAASKMPLYKYVAKLAGKPTEKFCLPVPAFNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKESMKMGCEVYHHL  668
            GASSF ++++MG EVYH+L
Sbjct  182  GASSFSQAVQMGAEVYHNL  200



>ref|XP_009515820.1| hypothetical protein PHYSODRAFT_284295 [Phytophthora sojae]
 gb|EGZ28545.1| hypothetical protein PHYSODRAFT_284295 [Phytophthora sojae]
Length=454

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            M +I S+KARQIFDSRGNPTVEVD+        RAAVPSGASTG +EALE+RDGG  Y+G
Sbjct  1    MVSIVSIKARQIFDSRGNPTVEVDLTTELGQY-RAAVPSGASTGEFEALEMRDGGKAYMG  59

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV  AV NVN II PAL+GKD T Q  +D +MV++LDGTQNEWGWCK+KLGANAIL VS
Sbjct  60   KGVLNAVKNVNEIIAPALIGKDVTKQGELDRYMVEELDGTQNEWGWCKKKLGANAILGVS  119

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            LA+C+AGAA K  PL+++IA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA
Sbjct  120  LALCRAGAAAKKQPLWQYIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGA  179

Query  618  SSFKESMKMGCEVYHHL  668
            +SF E+MK+G EVYH+L
Sbjct  180  TSFTEAMKIGSEVYHNL  196



>ref|XP_009515818.1| phosphopyruvate hydratase [Phytophthora sojae]
 gb|EGZ28543.1| phosphopyruvate hydratase [Phytophthora sojae]
Length=485

 Score =   295 bits (755),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = +3

Query  66   SSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGS  245
            S  +M +I ++KARQIFDSRGNPTVEVD+        RAAVPSGASTG +EALE+RDGG 
Sbjct  28   SISTMVSIVAIKARQIFDSRGNPTVEVDLTTELGQY-RAAVPSGASTGEFEALEMRDGGK  86

Query  246  DYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAI  425
             Y+GKGV  AV NVN II PAL+GKD T Q  +D +MV++LDGTQNEWGWCK+KLGANAI
Sbjct  87   AYMGKGVLNAVKNVNEIIAPALIGKDVTKQGELDRYMVEELDGTQNEWGWCKKKLGANAI  146

Query  426  LAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMIL  605
            L VSLA+C+AGAA K  PL+++IA+LAGN    LPVP+FN+INGGSHAGNKLAMQEFMIL
Sbjct  147  LGVSLALCRAGAAAKKQPLWQYIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMIL  206

Query  606  PVGASSFKESMKMGCEVYHHL  668
            PVGA+SF E+MK+G EVYH+L
Sbjct  207  PVGATSFTEAMKIGSEVYHNL  227



>ref|XP_001415437.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93729.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=477

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 171/212 (81%), Gaps = 6/212 (3%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGI  212
            + P++F    +  ++   I  V  RQIFDSRGNPTVE DV  ++  + RA VPSGASTGI
Sbjct  29   DEPLAFVSEYMKKRTTPAITKVVGRQIFDSRGNPTVEADV-YTHKGMFRAMVPSGASTGI  87

Query  213  YEALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWG  392
            YEA+ELRDGG +Y+GKGV +AV N+N II PAL+GKDP DQ AID+FM + LDGT N   
Sbjct  88   YEAVELRDGGKEYMGKGVMQAVKNLNEIIAPALIGKDPRDQKAIDDFMCKDLDGTDN---  144

Query  393  WCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAG  572
              K KLGANA+LAVS+AV KAGAA K++PLY+HIA+LAGN KLVLPVPAFNVINGGSHAG
Sbjct  145  --KGKLGANAVLAVSMAVAKAGAAEKDVPLYQHIADLAGNGKLVLPVPAFNVINGGSHAG  202

Query  573  NKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            NKLAMQEFMILPVGASSFKE+M+MG EVYH+L
Sbjct  203  NKLAMQEFMILPVGASSFKEAMQMGSEVYHNL  234



>ref|XP_005791836.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
 gb|EOD39407.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
Length=499

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 168/216 (78%), Gaps = 5/216 (2%)
 Frame = +3

Query  33   ETPVSFSRFNLSSK-SMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTG  209
            E P +     L+SK S   I    ARQIFDSRGNPTVEVDV  +     RAAVPSGASTG
Sbjct  36   EDPCAHMSETLASKASPEKITKCVARQIFDSRGNPTVEVDVHTTKGSY-RAAVPSGASTG  94

Query  210  IYEALELRDG-GSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNE  386
            IYEALELRD    DY+GKGVS+AV NVN II PAL    P DQ AID+ MV++LDG QNE
Sbjct  95   IYEALELRDNIKEDYMGKGVSQAVKNVNEIISPALKDMSPIDQKAIDDKMVKELDGQQNE  154

Query  387  WGWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGN--KKLVLPVPAFNVINGG  560
            WGW K KLGANAILAVS+AVCKAGAA K +PLYKHIANLA N   K+ +PVP+FN+INGG
Sbjct  155  WGWSKSKLGANAILAVSMAVCKAGAAAKGVPLYKHIANLADNPTDKMYMPVPSFNIINGG  214

Query  561  SHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            SHAGNKLAMQEFMILPVGASSF E+MKMG EVYH+L
Sbjct  215  SHAGNKLAMQEFMILPVGASSFSEAMKMGSEVYHNL  250



>ref|XP_002772277.1| Enolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER04093.1| Enolase, putative [Perkinsus marinus ATCC 50983]
Length=365

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 165/199 (83%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLG  257
            + I ++ AR+I DSRGNPTVEVD + ++  + RAAVPSGASTG+YEALELRDG  + YLG
Sbjct  3    SKIVTLHAREIIDSRGNPTVEVD-LTTDRGMFRAAVPSGASTGVYEALELRDGDKTRYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KA+ NVN II PAL+GKD TDQ  ID  MV++LDGTQNEWGWCK KLGANAILAVS
Sbjct  62   KGVQKAIKNVNDIIAPALIGKDVTDQAGIDKLMVEELDGTQNEWGWCKAKLGANAILAVS  121

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +AVC+AGA  KNIPLYKHIA++ G +  +  +PVP+FNVINGGSHAGN+LA QEFMILPV
Sbjct  122  MAVCRAGATAKNIPLYKHIADIGGKRSDQFTMPVPSFNVINGGSHAGNRLACQEFMILPV  181

Query  612  GASSFKESMKMGCEVYHHL  668
            GA+SFK +M++G EVYH L
Sbjct  182  GATSFKHAMQIGAEVYHSL  200



>ref|XP_002771110.1| Enolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER02926.1| Enolase, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 165/197 (84%), Gaps = 4/197 (2%)
 Frame = +3

Query  87   IQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLGKG  263
            I ++ AR+I DSRGNPTVEVD + ++  + RAAVPSGASTG+YEALELRDG  + YLGKG
Sbjct  5    IVTLHAREIIDSRGNPTVEVD-LTTDRGMFRAAVPSGASTGVYEALELRDGDKTRYLGKG  63

Query  264  VSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLA  443
            V KA+ NVN II PAL+GKD TDQ  ID FMV++LD TQNEWGWCK KLGANAILAVS+A
Sbjct  64   VQKAIKNVNDIIAPALIGKDVTDQAGIDKFMVEELDSTQNEWGWCKAKLGANAILAVSMA  123

Query  444  VCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA  617
            VC+AGAA KNIPLYKHIA++ G +  +  +PVP+FNVINGGSHAGN+LA QEFMILPVGA
Sbjct  124  VCRAGAAAKNIPLYKHIADIGGKRSDQFTMPVPSFNVINGGSHAGNRLACQEFMILPVGA  183

Query  618  SSFKESMKMGCEVYHHL  668
            +SFK +M++G EVYH L
Sbjct  184  TSFKHAMQIGAEVYHSL  200



>emb|CEF96573.1| Enolase, N-terminal [Ostreococcus tauri]
Length=477

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 172/212 (81%), Gaps = 6/212 (3%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGI  212
            + P++F    +  ++   I  V  RQIFDSRGNPTVE DV  ++  + RA VPSGASTGI
Sbjct  29   DEPLAFVSEYMKKRTAPAITKVVGRQIFDSRGNPTVEADV-YTHKGMFRAMVPSGASTGI  87

Query  213  YEALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWG  392
            YEA+ELRDGG+ Y+GKGV +AV N+N II PALVGKDP +Q A+D+FM ++LDGT+N   
Sbjct  88   YEAVELRDGGNTYMGKGVQQAVKNLNEIIAPALVGKDPREQKALDDFMCKELDGTEN---  144

Query  393  WCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAG  572
              K KLGANAILAVS+A+ KAGAA K++PLYKH+A+LAGN KLVLPVPAFNVINGGSHAG
Sbjct  145  --KGKLGANAILAVSMAIAKAGAAEKDVPLYKHLADLAGNGKLVLPVPAFNVINGGSHAG  202

Query  573  NKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            NKLAMQEFMILPVGA +FKE+M+MG EVYH+L
Sbjct  203  NKLAMQEFMILPVGAKTFKEAMQMGSEVYHNL  234



>ref|XP_003884000.1| unnamed protein product [Neospora caninum Liverpool]
 emb|CBZ53968.1| unnamed protein product [Neospora caninum Liverpool]
Length=475

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = +3

Query  24   VLFETPVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGAS  203
            V F  P S S  +L+   M  I+ + ARQI DSRGNPTVEVD +L++    RAAVPSGAS
Sbjct  14   VRFRYPFSASYPSLTFSKMVAIKDITARQILDSRGNPTVEVD-LLTDGGCFRAAVPSGAS  72

Query  204  TGIYEALELRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQ  380
            TGIYEALELRD   S +LGK V KAV N++ +I PAL+GKDP DQ  ID  MV++LDGT+
Sbjct  73   TGIYEALELRDKDQSKFLGKSVMKAVENIHKVIKPALIGKDPCDQKGIDKLMVEELDGTK  132

Query  381  NEWGWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVIN  554
            NEWGWCK KLGANAILAVS+A C+AGAA K +PLYK+IA LAG    K+V+PVP FNVIN
Sbjct  133  NEWGWCKCKLGANAILAVSMACCRAGAAAKGLPLYKYIATLAGTPTDKMVMPVPFFNVIN  192

Query  555  GGSHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            GGSHAGNKLAMQEFMI PVGAS+  E++++G EVYH+L
Sbjct  193  GGSHAGNKLAMQEFMIAPVGASTIHEAIQIGAEVYHNL  230



>gb|AAR97546.1| enolase 1 [Apodachlya brachynema]
Length=401

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = +3

Query  126  GNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVNNVNSIIGP  305
            GNP+VEVD++  +  L RAAVPSGASTG +EALELRDGG DY+GKGV  AV+NVN II P
Sbjct  2    GNPSVEVDLVTEDG-LFRAAVPSGASTGEFEALELRDGGKDYMGKGVKTAVHNVNDIIAP  60

Query  306  ALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAVCKAGAAVKNIPLY  485
            AL+GKD   QT +D FMV+ LDGT+NEWGWCK+KLGAN+ILAVSLA+CKAGAA + +PL+
Sbjct  61   ALIGKDQNKQTELDTFMVETLDGTKNEWGWCKKKLGANSILAVSLALCKAGAAAEKVPLW  120

Query  486  KHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHH  665
            +HIANLAGN    LPVP+FN+INGGSHAGNKLAMQEFMILPVGA+SF ESM++GCEVYH 
Sbjct  121  QHIANLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILPVGATSFTESMQIGCEVYHX  180

Query  666  L  668
            L
Sbjct  181  L  181



>ref|XP_002365578.1| enolase 2 [Toxoplasma gondii ME49]
 gb|EPR64867.1| enolase 2 [Toxoplasma gondii GT1]
 gb|EPT28275.1| enolase 2 [Toxoplasma gondii ME49]
 gb|ESS36338.1| enolase 2 [Toxoplasma gondii VEG]
 gb|KFG39200.1| enolase 2 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52456.1| enolase 2 [Toxoplasma gondii p89]
 gb|KFG54556.1| enolase 2 [Toxoplasma gondii FOU]
 gb|KFG61437.1| enolase 2 [Toxoplasma gondii RUB]
 gb|KFH06202.1| enolase 2 [Toxoplasma gondii VAND]
 gb|KFH16828.1| enolase 2 [Toxoplasma gondii MAS]
Length=475

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 174/221 (79%), Gaps = 10/221 (5%)
 Frame = +3

Query  30   FETPVSFS-----RFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPS  194
            +  P+ F      R++ S+K M  I+ + ARQI DSRGNPTVEVD +L++    RAAVPS
Sbjct  12   YSVPLRFPFCKIYRYSTSNK-MVAIKDITARQILDSRGNPTVEVD-LLTDGGCFRAAVPS  69

Query  195  GASTGIYEALELRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLD  371
            GASTGIYEALELRD   + ++GKGV KAV N++ II PAL+GKDP DQ  ID  MV++LD
Sbjct  70   GASTGIYEALELRDKDQTKFMGKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELD  129

Query  372  GTQNEWGWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGN--KKLVLPVPAFN  545
            GT+NEWGWCK KLGANAILAVS+A C+AGAA K +PLYK+IA LAGN   K+V+PVP FN
Sbjct  130  GTKNEWGWCKSKLGANAILAVSMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFN  189

Query  546  VINGGSHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            VINGGSHAGNK+AMQEFMI PVGAS+ +E++++G EVY HL
Sbjct  190  VINGGSHAGNKVAMQEFMIAPVGASTIQEAIQIGAEVYQHL  230



>ref|XP_008882278.1| enolase 2 [Hammondia hammondi]
 gb|KEP66655.1| enolase 2 [Hammondia hammondi]
Length=475

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = +3

Query  30   FETPVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTG  209
            F     +S FN     M  I+ + ARQI DSRGNPTVEVD +L++    RAAVPSGASTG
Sbjct  20   FRKIYRYSTFN----KMVAIKDITARQILDSRGNPTVEVD-LLTDGGCFRAAVPSGASTG  74

Query  210  IYEALELRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNE  386
            IYEALELRD   + ++GKGV KAV N++ II PAL+GKDP DQ  ID  MV++LDGT+NE
Sbjct  75   IYEALELRDKDQTKFMGKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNE  134

Query  387  WGWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGN--KKLVLPVPAFNVINGG  560
            WGWCK KLGANAILAVS+A C+AGAA K +PLYK+IA LAGN   K+V+PVP FNVINGG
Sbjct  135  WGWCKSKLGANAILAVSMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGG  194

Query  561  SHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            SHAGNK+AMQEFMI PVGAS+ +E++++G EVY HL
Sbjct  195  SHAGNKVAMQEFMIAPVGASTIQEAIQIGAEVYQHL  230



>sp|Q9BPL7.1|ENO2_TOXGO RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Toxoplasma gondii]
 gb|AAG60329.1|AF123457_1 enolase [Toxoplasma gondii]
 gb|AAP24057.1| enolase 2 [Toxoplasma gondii]
Length=444

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
            M  I+ + ARQI DSRGNPTVEVD +L++    RAAVPSGASTGIYEALELRD   + ++
Sbjct  1    MVAIKDITARQILDSRGNPTVEVD-LLTDGGCFRAAVPSGASTGIYEALELRDKDQTKFM  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAV N++ II PAL+GKDP DQ  ID  MV++LDGT+NEWGWCK KLGANAILAV
Sbjct  60   GKGVMKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNEWGWCKSKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGN--KKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+A C+AGAA K +PLYK+IA LAGN   K+V+PVP FNVINGGSHAGNK+AMQEFMI P
Sbjct  120  SMACCRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGGSHAGNKVAMQEFMIAP  179

Query  609  VGASSFKESMKMGCEVYHHL  668
            VGAS+ +E++++G EVY HL
Sbjct  180  VGASTIQEAIQIGAEVYQHL  199



>ref|XP_001014643.1| enolase family protein [Tetrahymena thermophila]
 gb|EAR94453.1| phosphopyruvate hydratase [Tetrahymena thermophila SB210]
Length=464

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 163/200 (82%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSD-YL  254
             ++IQ+V AR+I DSRGNPT+E +V+ S     RAAVPSGASTGIYEALELRDG    YL
Sbjct  18   FSSIQNVFAREILDSRGNPTIEAEVVTSKGAF-RAAVPSGASTGIYEALELRDGDKKRYL  76

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAVNNVN++I PAL GK+P +Q  +D FMV+ LDG++N++GWCK  LGANAIL V
Sbjct  77   GKGVQKAVNNVNNVIAPALKGKNPAEQEKLDRFMVESLDGSKNQYGWCKSNLGANAILGV  136

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SLA+ +AGAA KNIPLY+++  LAG K  K +LPVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  137  SLALARAGAAEKNIPLYQYLGQLAGKKQNKYILPVPSLNVINGGKHAGNKLAMQEFMILP  196

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA+SFKESM++GCEVYH L
Sbjct  197  TGATSFKESMQIGCEVYHSL  216



>gb|AAB35826.2| enolase, partial [Echinochloa phyllopogon]
Length=180

 Score =   272 bits (695),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +3

Query  189  PSGASTGIYEALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQL  368
            PSGASTGIYEALELRD  SDYLGKGV KAV+NVNSIIGPA+ GK+PT+Q  IDN MVQQL
Sbjct  1    PSGASTGIYEALELRDRPSDYLGKGVLKAVDNVNSIIGPAIYGKEPTEQVDIDNLMVQQL  60

Query  369  DGTQNEWGWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNV  548
            DGT NEWGWCK+KLGANAILA SLA  KAG+ VK IPLY+HIANLAGNKK+VLPVPA NV
Sbjct  61   DGTSNEWGWCKQKLGANAILAASLAAVKAGSMVK-IPLYQHIANLAGNKKIVLPVPALNV  119

Query  549  INGGSHAGNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            INGGSHAGNKLAMQEFMILP G SSFKE MKMG EVYH+L
Sbjct  120  INGGSHAGNKLAMQEFMILPTGVSSFKEPMKMGVEVYHNL  159



>ref|XP_002507278.1| enolase [Micromonas sp. RCC299]
 gb|ACO68536.1| enolase [Micromonas sp. RCC299]
Length=477

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 171/211 (81%), Gaps = 8/211 (4%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYE  218
            P++F    L  ++ A I  V ARQIFDSRGNPTVE DV  ++  + RA  PSGASTGI+E
Sbjct  31   PIAFMAEYLKKQTPAAITKVVARQIFDSRGNPTVEADV-YTHKGMFRAMTPSGASTGIHE  89

Query  219  ALELRDG-GSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGW  395
            A+ELRDG  + ++GKGV++AV NVNSII PAL+GKDPTDQ  ID+ M++ LDGT+N    
Sbjct  90   AVELRDGDATKWMGKGVTRAVENVNSIIAPALIGKDPTDQKGIDDLMIE-LDGTKN----  144

Query  396  CKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
             K KLGANAILAVS+AV KAGAA K++PLYKHI+ L+GN KLVLPVPAFNVINGGSHAGN
Sbjct  145  -KGKLGANAILAVSMAVSKAGAAEKDVPLYKHISELSGNTKLVLPVPAFNVINGGSHAGN  203

Query  576  KLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            KLAMQEFMILPVGA++F E+M+MG EVYH+L
Sbjct  204  KLAMQEFMILPVGATTFAEAMRMGSEVYHNL  234



>ref|XP_002948092.1| hypothetical protein VOLCADRAFT_79991 [Volvox carteri f. nagariensis]
 gb|EFJ51080.1| hypothetical protein VOLCADRAFT_79991 [Volvox carteri f. nagariensis]
Length=477

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 167/213 (78%), Gaps = 8/213 (4%)
 Frame = +3

Query  33   ETPVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGI  212
            E P+SF    L   S   I  V  RQI DSRGNPTVE DV  +   + RAAVPSGASTG+
Sbjct  29   EEPLSFMAKALQQLSPPEIVKVVGRQIIDSRGNPTVEADV-FTRKGMFRAAVPSGASTGV  87

Query  213  YEALELRDGG-SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEW  389
            +EA+ELRDG  S YLGKGVSKAV N+N+II PAL G DPT+QT IDN M ++LDGT N  
Sbjct  88   HEAVELRDGDKSKYLGKGVSKAVENINAIIAPALKGMDPTNQTEIDNKM-KELDGTDN--  144

Query  390  GWCKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHA  569
               K KLGANAILAVS+AVCKAGAA K +PLYKHIA+LAGN KL+LPVP+FN+INGGSHA
Sbjct  145  ---KGKLGANAILAVSIAVCKAGAAEKGVPLYKHIADLAGNGKLILPVPSFNIINGGSHA  201

Query  570  GNKLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            GN LAMQEFMILPVGASSF E+M+MGCEVYH L
Sbjct  202  GNALAMQEFMILPVGASSFAEAMRMGCEVYHAL  234



>ref|XP_002788374.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER20170.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=264

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
            M+TI S+KAR+I DSRGNPTVEVD+   +  + RAA PSGASTG +EALELRDG  + Y 
Sbjct  1    MSTIISIKAREILDSRGNPTVEVDLTTKDG-MFRAACPSGASTGEFEALELRDGDKARYQ  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAV NV  +I PA++GKD TDQ  ID FMV++LDGTQNEWGWCK KLGANAILAV
Sbjct  60   GKGVLKAVANVEKVIAPAIIGKDVTDQAGIDKFMVEELDGTQNEWGWCKAKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA  N+PLY++IA LAG   +K ++P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAAASNMPLYQYIAKLAGKDTEKFLMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKESMKMGCEVYHHL  668
             GASS  E++++  EVYH L
Sbjct  180  CGASSIHEAIRIASEVYHEL  199



>gb|EJY82089.1| Enolase [Oxytricha trifallax]
Length=462

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +3

Query  66   SSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGS  245
            S++  +TI  +KAR+I DSRGNPT+E DVI SN    RAAVPSGASTGIYEALELRD   
Sbjct  12   SNRKFSTIAQIKAREILDSRGNPTIEADVITSNGQTFRAAVPSGASTGIYEALELRDKDE  71

Query  246  D-YLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANA  422
              YLGKGV  AV+NV+ I+ PAL G + TDQ  ID  MV+QLDGTQNEWGWCK+K+GANA
Sbjct  72   KRYLGKGVLHAVDNVHKILNPALKGLNVTDQVKIDKLMVEQLDGTQNEWGWCKQKVGANA  131

Query  423  ILAVSLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEF  596
            ILAVSLA+ +AGAA K++PLY ++A LAG +  K V PVP+ N+INGG+HAGN L +QEF
Sbjct  132  ILAVSLALARAGAADKSVPLYHYLAELAGKRTDKFVTPVPSLNIINGGAHAGNSLEIQEF  191

Query  597  MILPVGASSFKESMKMGCEVYHHL  668
            MI+P GASSF+E+M++G E Y HL
Sbjct  192  MIMPTGASSFREAMRIGAETYQHL  215



>dbj|BAE07171.1| enolase 3 [Karenia mikimotoi]
Length=438

 Score =   278 bits (711),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 162/199 (81%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSD-YLG  257
            A + S+KAR+IFDSRGNPTVEVD +L++ HL RAAVPSGASTG+YEALELRDG     LG
Sbjct  37   AKVVSIKAREIFDSRGNPTVEVD-LLTDMHLFRAAVPSGASTGVYEALELRDGDKKRLLG  95

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN++IGP LVG D T Q+ ID FMV+ LDGTQN+WGW K  LGANAILAVS
Sbjct  96   KGVLKAVENVNNLIGPKLVGMDVTKQSEIDKFMVETLDGTQNDWGWSKSTLGANAILAVS  155

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+C+AGAA   IPLY++IA L+G    K V+PVP FNVINGGSHAGN+LA QEFMILPV
Sbjct  156  MAICRAGAASMQIPLYEYIAYLSGRSTDKFVMPVPCFNVINGGSHAGNRLACQEFMILPV  215

Query  612  GASSFKESMKMGCEVYHHL  668
            GA+SFK+++  G EVYH L
Sbjct  216  GATSFKDALITGAEVYHTL  234



>emb|CDW73138.1| enolase [Stylonychia lemnae]
Length=462

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +3

Query  66   SSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGS  245
            S++  +TI  +KAR+I DSRGNPT+E DVI S  H+ RAAVPSGASTGIYEALELRD   
Sbjct  12   SNRKFSTIAQLKAREILDSRGNPTIEADVITSTGHVFRAAVPSGASTGIYEALELRDKDE  71

Query  246  D-YLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANA  422
              YLGKGV  AV+NV+ I+ PAL G +  DQ+ ID  MV+QLDGTQNEWGWCK+K+GANA
Sbjct  72   KRYLGKGVLHAVDNVHKILSPALKGLNVVDQSKIDKLMVEQLDGTQNEWGWCKQKVGANA  131

Query  423  ILAVSLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEF  596
            ILAVSLA+ +AGA  K IPLY ++A LAG +  K V PVP+ N+INGG+HAGN L +QEF
Sbjct  132  ILAVSLALARAGAHDKKIPLYHYLAELAGKRTDKFVTPVPSLNIINGGAHAGNSLEIQEF  191

Query  597  MILPVGASSFKESMKMGCEVYHHL  668
            MI+P GASSF+E+M++G E YHHL
Sbjct  192  MIMPTGASSFREAMRIGAETYHHL  215



>ref|XP_007515230.1| enolase [Bathycoccus prasinos]
 emb|CCO14109.1| enolase [Bathycoccus prasinos]
Length=509

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 162/210 (77%), Gaps = 6/210 (3%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYE  218
            P+SF   +L  ++   I  V  RQ+FDSRGNPTVE D I +   + RA VPSGASTGIYE
Sbjct  63   PISFMADHLRKQTPPAITKVVGRQVFDSRGNPTVECD-IYTGKGMYRAMVPSGASTGIYE  121

Query  219  ALELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWC  398
            A+ELRDGG  ++GKG   AV N+N IIGPAL+GKDP +Q A+D FM ++LDGT N     
Sbjct  122  AVELRDGGKAWMGKGCMTAVKNINEIIGPALIGKDPREQKALDEFMCKELDGTDN-----  176

Query  399  KEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNK  578
            K KLGANAILAVS A+ KAGA  K IPLYKHI+ LAGN KLVLPVPAFN+INGGSHAGNK
Sbjct  177  KGKLGANAILAVSTALAKAGAGEKGIPLYKHISELAGNSKLVLPVPAFNIINGGSHAGNK  236

Query  579  LAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            LAMQEFMILPVGA SF E+M+MG EVYH+L
Sbjct  237  LAMQEFMILPVGAKSFAEAMQMGSEVYHNL  266



>dbj|BAE07165.1| enolase 3 [Karenia brevis]
Length=438

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 162/199 (81%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSD-YLG  257
            A + S+KAR+IFDSRGNPTVEVD +L++ HL RAAVPSGASTGIYEALELRDG     LG
Sbjct  37   AKVVSIKAREIFDSRGNPTVEVD-LLTDMHLFRAAVPSGASTGIYEALELRDGDKKRLLG  95

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGP LVG D T Q+ ID  MV+ LDG+QN+WGW K  LGANA+LAVS
Sbjct  96   KGVLKAVENVNTIIGPKLVGMDVTKQSEIDKLMVETLDGSQNDWGWSKSNLGANAVLAVS  155

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+C+AGAA   IPLY+++A L+G    K V+PVP+FNVINGGSHAGN+LA QEFMILPV
Sbjct  156  MAICRAGAASMQIPLYEYVAYLSGRPTDKFVMPVPSFNVINGGSHAGNRLACQEFMILPV  215

Query  612  GASSFKESMKMGCEVYHHL  668
            GA SFKE++ +G EVYH L
Sbjct  216  GAKSFKEALIIGAEVYHTL  234



>gb|AAR97553.1| enolase [Prymnesium parvum]
Length=437

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 3/184 (2%)
 Frame = +3

Query  126  GNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVNNVNSIIG  302
            GNPTVEVD+I +     RAAVPSGASTGIYEALE+RDG  S Y+GKGVSKAV+NVN+IIG
Sbjct  2    GNPTVEVDLITAKGQTYRAAVPSGASTGIYEALEMRDGDKSMYMGKGVSKAVHNVNTIIG  61

Query  303  PALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSLAVCKAGAAVKNIPL  482
            PALVG DP  Q  ID+ MV+ LDG++N+WGW K KLGANAIL VS+AVCKAGAA K IPL
Sbjct  62   PALVGMDPVQQKEIDDKMVKTLDGSKNDWGWSKSKLGANAILGVSMAVCKAGAASKGIPL  121

Query  483  YKHIANLAGN--KKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKESMKMGCEV  656
            YKHIA LAGN   K+ +PVP+FNVINGGSHAGNKLAMQEFMILPVGA+ F E+M+MG EV
Sbjct  122  YKHIAELAGNPTDKMYMPVPSFNVINGGSHAGNKLAMQEFMILPVGATDFTEAMRMGSEV  181

Query  657  YHHL  668
            YH+L
Sbjct  182  YHNL  185



>gb|AAL05454.1|AF348915_1 enolase [Nitella opaca]
Length=355

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +3

Query  222  LELRDGGSDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCK  401
            LELRDGG D++GKGV KAV+NVN +I PAL+GKDPT+QTA+DNFMV++LDGTQNEWGWCK
Sbjct  1    LELRDGGKDFMGKGVLKAVSNVNDVIAPALIGKDPTEQTALDNFMVEELDGTQNEWGWCK  60

Query  402  EKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKL  581
            ++LGANAILAVSLAVCKAGA  K IPLY+HIANL+GN KLVLPVP+FN+INGGSHAGNKL
Sbjct  61   QRLGANAILAVSLAVCKAGAGAKKIPLYQHIANLSGNTKLVLPVPSFNIINGGSHAGNKL  120

Query  582  AMQEFMILPVGASSFKESMKMGCEVYHHL  668
            AMQEFMILP GASSFKE+MKMG EVYHHL
Sbjct  121  AMQEFMILPTGASSFKEAMKMGSEVYHHL  149



>ref|XP_002785646.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER17442.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSD-YL  254
            M+ I SVKAR+I DSRGNPTVEVD++ ++  + RAA PSGASTG +EALELRDG    Y 
Sbjct  1    MSKIISVKAREILDSRGNPTVEVDLV-TDRGMFRAACPSGASTGEFEALELRDGDKKRYG  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAV+NVN IIGPA++GKDPTDQT ID  MV++LDGTQNEWGWCK KLGANAIL V
Sbjct  60   GKGVQKAVDNVNKIIGPAIIGKDPTDQTGIDKLMVEELDGTQNEWGWCKAKLGANAILGV  119

Query  435  SLAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA   +PLYK+IA LAG   +K  +P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAATSGMPLYKYIAKLAGKDTEKFTMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA S  E+++   EVYH L
Sbjct  180  CGAKSIHEAIRFAAEVYHEL  199



>dbj|BAE07174.1| polyprotein [Heterocapsa triquetra]
Length=792

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLG  257
            A I S+KAR+IFDSRGNPTVEVD++ +++HL RAAVPSGASTGIYEALELRDG  +  LG
Sbjct  353  AKIVSIKAREIFDSRGNPTVEVDLV-TDAHLFRAAVPSGASTGIYEALELRDGDKTRLLG  411

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV+NVN +I P L+G D T Q  ID  MV+ LDG QN+WGW K  LGANAILAVS
Sbjct  412  KGVLKAVSNVNELIAPKLIGMDVTKQKEIDKLMVETLDGAQNDWGWSKANLGANAILAVS  471

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +AVC+AGAA   +PLY++IANLAG    K VLPVP+FNVINGGSHAGN+LA QEFMILPV
Sbjct  472  MAVCRAGAASMQMPLYEYIANLAGKPTDKYVLPVPSFNVINGGSHAGNRLACQEFMILPV  531

Query  612  GASSFKESMKMGCEVYHHL  668
            GA+SFKE++ MGCEVYH L
Sbjct  532  GATSFKEALIMGCEVYHTL  550



>ref|XP_003056091.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59467.1| predicted protein [Micromonas pusilla CCMP1545]
Length=478

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 166/211 (79%), Gaps = 8/211 (4%)
 Frame = +3

Query  39   PVSFSRFNLSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYE  218
            P+SF    L  ++ A I  +  RQIFDSRGNPTVE DV  +   + RA  PSGASTGI+E
Sbjct  31   PISFMAEYLKKQTPAAITKIVGRQIFDSRGNPTVEADV-YTYKGMFRAMTPSGASTGIHE  89

Query  219  ALELRDGGSD-YLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGW  395
            A+ELRDG  + ++GKGV KAV N+N+II PAL+GKDP DQ  ID+ M++ LDGT+N    
Sbjct  90   AVELRDGDKEKWMGKGVLKAVENINTIIAPALIGKDPADQKMIDDLMIE-LDGTKN----  144

Query  396  CKEKLGANAILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGN  575
             K KLGANAILAVS+AV KAGAA K +PLYKHI+ LAGN KLVLPVPAFNVINGGSHAGN
Sbjct  145  -KGKLGANAILAVSMAVSKAGAAEKGVPLYKHISELAGNSKLVLPVPAFNVINGGSHAGN  203

Query  576  KLAMQEFMILPVGASSFKESMKMGCEVYHHL  668
            KLAMQEFMILPVGAS+F E+M+MG EVYH+L
Sbjct  204  KLAMQEFMILPVGASTFAEAMRMGSEVYHNL  234



>gb|AAM69295.1| enolase [Musa acuminata AAA Group]
Length=152

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGGSDYLG  257
            MA I SVKAR+IFDSRGNPTVEVDV L++   ARAAVPSGASTG+YEALELRDGGSDYLG
Sbjct  1    MAAIASVKARRIFDSRGNPTVEVDVCLTDGTCARAAVPSGASTGVYEALELRDGGSDYLG  60

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KAV NVN+IIGPAL+GKDPT+Q  IDNFMVQ LDGT NEWGWCK+KLGANAILAVS
Sbjct  61   KGVLKAVANVNTIIGPALIGKDPTEQVEIDNFMVQHLDGTSNEWGWCKQKLGANAILAVS  120

Query  438  LAVCKAGAAVKNIPLYKHIANLAGNKKLVLPV  533
            LAVCKAGA+VK IPLY+HIAN+AGNK LVLPV
Sbjct  121  LAVCKAGASVKKIPLYQHIANIAGNKNLVLPV  152



>ref|XP_011129750.1| enolase [Gregarina niphandrodes]
 gb|EZG72778.1| enolase [Gregarina niphandrodes]
Length=445

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLG  257
            + I SV ARQI DSRGNPTVEVD + +     RAAVPSGASTGIYEALELRDG  + YLG
Sbjct  3    SKIVSVHARQILDSRGNPTVEVD-LSTEQGCFRAAVPSGASTGIYEALELRDGDKTTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KA+NNVN+II PAL+GKD  DQT +D  MV+ LDGTQNEWGWCK+KLGANAILA S
Sbjct  62   KGVLKAINNVNTIIAPALIGKDAVDQTGLDKLMVETLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLYK++A LAG   +K VLPVPA NVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAIARAGAAANKMPLYKYVAKLAGKDTEKFVLPVPAMNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKESMKMGCEVYHHL  668
            GA+SF ++++MG EVYH+L
Sbjct  182  GATSFSQAIQMGAEVYHNL  200



>ref|XP_003074214.1| enolase (ISS) [Ostreococcus tauri]
Length=1228

 Score =   287 bits (734),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 6/202 (3%)
 Frame = +3

Query  63   LSSKSMATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG  242
            +  ++   I  V  RQIFDSRGNPTVE DV  ++  + RA VPSGASTGIYEA+ELRDGG
Sbjct  95   MKKRTAPAITKVVGRQIFDSRGNPTVEADV-YTHKGMFRAMVPSGASTGIYEAVELRDGG  153

Query  243  SDYLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANA  422
            + Y+GKGV +AV N+N II PALVGKDP +Q A+D+FM ++LDGT+N     K KLGANA
Sbjct  154  NTYMGKGVQQAVKNLNEIIAPALVGKDPREQKALDDFMCKELDGTEN-----KGKLGANA  208

Query  423  ILAVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMI  602
            ILAVS+A+ KAGAA K++PLYKH+A+LAGN KLVLPVPAFNVINGGSHAGNKLAMQEFMI
Sbjct  209  ILAVSMAIAKAGAAEKDVPLYKHLADLAGNGKLVLPVPAFNVINGGSHAGNKLAMQEFMI  268

Query  603  LPVGASSFKESMKMGCEVYHHL  668
            LPVGA +FKE+M+MG EVYH+L
Sbjct  269  LPVGAKTFKEAMQMGSEVYHNL  290



>ref|XP_004337411.1| Enolase, Cterminal TIM barrel domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR15398.1| Enolase, Cterminal TIM barrel domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=435

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 165/199 (83%), Gaps = 9/199 (5%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
            MATI +V ARQIFDSRGNPTVEVDV  +   L RAAVPSGASTGIYEA+ELRDG  S +L
Sbjct  1    MATITAVHARQIFDSRGNPTVEVDVT-TEKGLFRAAVPSGASTGIYEAIELRDGDKSKWL  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV+KAV+NVN +I P ++GKD T Q  +DN +++ +DGT+N     K  LGANAIL V
Sbjct  60   GKGVTKAVSNVNEVIAPKIIGKDVTKQEELDNLLLE-IDGTEN-----KGNLGANAILGV  113

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNKKLV-LPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            S+AVCKAGAAVK +PLY+HIA+LAG K+ V LPVPAFN+INGGSHAGNKLAMQEFMILPV
Sbjct  114  SMAVCKAGAAVKGVPLYRHIADLAGKKEAVTLPVPAFNIINGGSHAGNKLAMQEFMILPV  173

Query  612  GASSFKESMKMGCEVYHHL  668
            GASSF E+M+MG EVYH+L
Sbjct  174  GASSFTEAMRMGVEVYHNL  192



>ref|XP_001452406.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAI39017.1| enolase, putative [Paramecium tetraurelia]
 emb|CAK85009.1| unnamed protein product [Paramecium tetraurelia]
Length=449

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 166/200 (83%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
             ++I++V AR+I DSRGNPTVE DVI S   + R+AVPSGASTGIYEALELRDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKG-VFRSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV+KAV NVN II PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEIIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLY+++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA SFK+++++GCEVYH L
Sbjct  186  TGAKSFKDAIQIGCEVYHSL  205



>ref|XP_002772948.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER04764.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=445

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
            M+TI S+KAR+I DSRGNPTVEVD+   +  + RAA PSGASTG +EALELRDG  + Y 
Sbjct  1    MSTIISIKAREILDSRGNPTVEVDLTTKDG-MFRAACPSGASTGEFEALELRDGDKARYQ  59

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV KAV NV  +I PA++GKD TDQ  ID FMV++LDGTQNEWGWCK KLGANAILAV
Sbjct  60   GKGVLKAVANVEKVIAPAIIGKDVTDQAGIDKFMVEELDGTQNEWGWCKAKLGANAILAV  119

Query  435  SLAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            S+AVC+AGAA  N+PLY++IA LAG   +K ++P P FNVINGG HAGN+LA QEFM++P
Sbjct  120  SMAVCRAGAAASNMPLYQYIAKLAGKDTEKFLMPCPCFNVINGGKHAGNRLACQEFMLVP  179

Query  609  VGASSFKESMKMGCEVYHHL  668
             GASS  E++++  EVYH L
Sbjct  180  CGASSIHEAIRIASEVYHEL  199



>ref|XP_001423791.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK56393.1| unnamed protein product [Paramecium tetraurelia]
Length=440

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 166/200 (83%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
             ++I++V AR+I DSRGNPTVE DVI S   + R+AVPSGASTGIYEALELRDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKG-VFRSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV+KAV NVN +I PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEVIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLY+++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA SFK+++++GCEVYH L
Sbjct  186  TGAKSFKDAIQIGCEVYHSL  205



>emb|CAI39008.1| enolase, putative [Paramecium tetraurelia]
Length=449

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 166/200 (83%), Gaps = 4/200 (2%)
 Frame = +3

Query  78   MATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYL  254
             ++I++V AR+I DSRGNPTVE DVI S   + R+AVPSGASTGIYEALELRDG  S YL
Sbjct  7    FSSIKNVIAREILDSRGNPTVEADVITSKG-VFRSAVPSGASTGIYEALELRDGDKSRYL  65

Query  255  GKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAV  434
            GKGV+KAV NVN +I PALVGK+ T+QT +D  +V+QLDG++N++GW K KLGANAILAV
Sbjct  66   GKGVAKAVANVNEVIRPALVGKNVTEQTKLDKSIVEQLDGSKNKYGWSKSKLGANAILAV  125

Query  435  SLAVCKAGAAVKNIPLYKHIANLAGNK--KLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
            SL++ +AGAA +N+PLY+++A LAG +  K V PVP+ NVINGG HAGNKLAMQEFMILP
Sbjct  126  SLSLARAGAAEQNVPLYQYLAQLAGKRTDKFVTPVPSLNVINGGKHAGNKLAMQEFMILP  185

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA SFK+++++GCEVYH L
Sbjct  186  TGAKSFKDAIQIGCEVYHSL  205



>ref|XP_011131468.1| enolase [Gregarina niphandrodes]
 gb|EZG55680.1| enolase [Gregarina niphandrodes]
Length=445

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = +3

Query  81   ATIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLG  257
            + I SV ARQI DSRGNPTVEVD + +     RAAVPSGASTGIYEALELRDG  + YLG
Sbjct  3    SKIVSVHARQILDSRGNPTVEVD-LSTEQGCFRAAVPSGASTGIYEALELRDGDKTTYLG  61

Query  258  KGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVS  437
            KGV KA++NVN+II PALVGKD TDQ  +D  MV+ LDGTQNEWGWCK+KLGANAILA S
Sbjct  62   KGVLKAISNVNTIIAPALVGKDVTDQAGLDKLMVETLDGTQNEWGWCKQKLGANAILACS  121

Query  438  LAVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPV  611
            +A+ +AGAA   +PLYK++A LAG   +K VLPVPA NVINGGSHAGNKLAMQEFMILPV
Sbjct  122  MAIARAGAAANKMPLYKYVAKLAGKDTEKFVLPVPAMNVINGGSHAGNKLAMQEFMILPV  181

Query  612  GASSFKESMKMGCEVYHHL  668
            GA+SF ++++MG EVYH+L
Sbjct  182  GATSFSQAIQMGAEVYHNL  200



>ref|XP_002771109.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
 gb|EER02925.1| enolase 2, putative [Perkinsus marinus ATCC 50983]
Length=302

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +3

Query  84   TIQSVKARQIFDSRGNPTVEVDVILSNSHLARAAVPSGASTGIYEALELRDGG-SDYLGK  260
            TI ++KAR+I DSRGNPTVEVD+  +N  + RAA PSGASTG +EA+ELRDG  + + GK
Sbjct  4    TITAIKAREILDSRGNPTVEVDLFTNNKGMFRAACPSGASTGEFEAVELRDGDKTRFQGK  63

Query  261  GVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAILAVSL  440
            GV KAV NV  II PAL+GKD TDQ  ID  MV++LDGTQNEWGWCK KLGANAIL+VS+
Sbjct  64   GVLKAVANVEKIIAPALIGKDVTDQAGIDKLMVEELDGTQNEWGWCKAKLGANAILSVSM  123

Query  441  AVCKAGAAVKNIPLYKHIANLAG--NKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG  614
            AVC+AGAA   +PLY++IA LAG   +K  +P P FNVINGG HAGN+LA QEFM++P G
Sbjct  124  AVCRAGAAASGMPLYQYIAKLAGKDTEKFTMPCPCFNVINGGKHAGNRLACQEFMLVPCG  183

Query  615  ASSFKESMKMGCEVYHHL  668
            A S  E++++  EVYH L
Sbjct  184  AKSIHEAIRIASEVYHEL  201



>ref|XP_008903925.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETN10819.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETP46351.1| enolase [Phytophthora parasitica P10297]
Length=457

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 158/200 (79%), Gaps = 7/200 (4%)
 Frame = +3

Query  72   KSMATIQSVKARQIFDSRGNPTVEVDVILSNS-HLARAAVPSGASTGIYEALELRDGGSD  248
            ++ +TIQS+ AR+I DSRGNPTVEVD+ LS S  + RA+VPSGASTGI+EA+ELRDGG  
Sbjct  20   RNASTIQSIHAREIIDSRGNPTVEVDLTLSGSTEIFRASVPSGASTGIHEAVELRDGGKR  79

Query  249  YLGKGVSKAVNNVNSIIGPALVGKDPTDQTAIDNFMVQQLDGTQNEWGWCKEKLGANAIL  428
            Y GKGV +AV NV S++ P L+G DPT Q  IDN M +++DGT+N     K KLGANAIL
Sbjct  80   YAGKGVQQAVQNVKSVLAPKLIGADPTKQRDIDNLM-REIDGTEN-----KGKLGANAIL  133

Query  429  AVSLAVCKAGAAVKNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP  608
             VSLAV KAGA  K +PLY+H A+L GNK LVLPVP+FNVINGGSHAGNKLA QEFM+LP
Sbjct  134  GVSLAVAKAGATAKGVPLYQHFADLIGNKNLVLPVPSFNVINGGSHAGNKLAFQEFMLLP  193

Query  609  VGASSFKESMKMGCEVYHHL  668
             GA SF E+M MGCEVYH L
Sbjct  194  TGAESFSEAMVMGCEVYHQL  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780