BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031H22

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625701.1|  PREDICTED: mitochondrial Rho GTPase 1              265   5e-81   Nicotiana tomentosiformis
emb|CAN83792.1|  hypothetical protein VITISV_021048                     249   1e-80   Vitis vinifera
ref|XP_011075507.1|  PREDICTED: mitochondrial Rho GTPase 1              257   4e-78   Sesamum indicum [beniseed]
gb|EYU28762.1|  hypothetical protein MIMGU_mgv1a002695mg                254   5e-77   Erythranthe guttata [common monkey flower]
emb|CDP15520.1|  unnamed protein product                                254   1e-76   Coffea canephora [robusta coffee]
gb|KJB26439.1|  hypothetical protein B456_004G241600                    246   1e-75   Gossypium raimondii
ref|XP_002284757.1|  PREDICTED: mitochondrial Rho GTPase 1              250   2e-75   Vitis vinifera
emb|CBI36765.3|  unnamed protein product                                250   5e-75   Vitis vinifera
gb|KJB26438.1|  hypothetical protein B456_004G241600                    246   9e-75   Gossypium raimondii
gb|KJB26437.1|  hypothetical protein B456_004G241600                    248   2e-74   Gossypium raimondii
ref|XP_010244210.1|  PREDICTED: mitochondrial Rho GTPase 1-like         246   5e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010674761.1|  PREDICTED: mitochondrial Rho GTPase 1-like         244   4e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56330.1|  hypothetical protein CISIN_1g008223mg                   240   6e-73   Citrus sinensis [apfelsine]
gb|AAP73840.1|  unknown protein,3'-partial                              228   2e-72   Oryza sativa Japonica Group [Japonica rice]
gb|KDO56328.1|  hypothetical protein CISIN_1g008223mg                   240   3e-72   Citrus sinensis [apfelsine]
ref|XP_002512373.1|  rac-GTP binding protein, putative                  240   3e-72   
gb|KJB45950.1|  hypothetical protein B456_007G342600                    241   4e-72   Gossypium raimondii
gb|KJB45953.1|  hypothetical protein B456_007G342600                    241   5e-72   Gossypium raimondii
gb|KHG06383.1|  mitochondrial rho gtpase 1                              241   5e-72   Gossypium arboreum [tree cotton]
gb|KJB45955.1|  hypothetical protein B456_007G342600                    241   5e-72   Gossypium raimondii
ref|XP_006433310.1|  hypothetical protein CICLE_v10000541mg             241   9e-72   
ref|XP_009760211.1|  PREDICTED: mitochondrial Rho GTPase 1-like         240   9e-72   Nicotiana sylvestris
ref|XP_010043089.1|  PREDICTED: mitochondrial Rho GTPase 1              240   1e-71   Eucalyptus grandis [rose gum]
gb|KCW85147.1|  hypothetical protein EUGRSUZ_B01990                     240   1e-71   Eucalyptus grandis [rose gum]
ref|XP_008388965.1|  PREDICTED: mitochondrial Rho GTPase 1-like         235   1e-71   
ref|XP_008355766.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    231   4e-71   
ref|XP_007030856.1|  Mitochondrial Rho GTPase isoform 3                 234   6e-71   
gb|KDP23523.1|  hypothetical protein JCGZ_23356                         238   9e-71   Jatropha curcas
ref|XP_002319545.2|  hypothetical protein POPTR_0013s02400g             238   3e-70   
ref|XP_004247162.1|  PREDICTED: mitochondrial Rho GTPase 1              235   7e-70   Solanum lycopersicum
ref|XP_011023599.1|  PREDICTED: mitochondrial Rho GTPase 1-like         235   1e-69   Populus euphratica
ref|XP_007030854.1|  Mitochondrial Rho GTPase isoform 1                 235   1e-69   
ref|XP_007030855.1|  Mitochondrial Rho GTPase isoform 2                 234   1e-69   
gb|EPS65475.1|  hypothetical protein M569_09302                         228   3e-69   Genlisea aurea
ref|XP_008786917.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    233   5e-69   Phoenix dactylifera
ref|XP_008790947.1|  PREDICTED: mitochondrial Rho GTPase 1              233   6e-69   Phoenix dactylifera
ref|XP_008786915.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    233   8e-69   Phoenix dactylifera
ref|XP_010931978.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    233   8e-69   
ref|XP_010524876.1|  PREDICTED: mitochondrial Rho GTPase 1-like         233   8e-69   Tarenaya hassleriana [spider flower]
ref|XP_008364027.1|  PREDICTED: mitochondrial Rho GTPase 1-like         231   9e-69   
ref|XP_010931977.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    233   9e-69   Elaeis guineensis
tpg|DAA52127.1|  TPA: hypothetical protein ZEAMMB73_406369              224   5e-68   
gb|KDP21466.1|  hypothetical protein JCGZ_21937                         230   6e-68   Jatropha curcas
ref|XP_002306771.1|  GTP-binding family protein                         229   2e-67   
gb|EAZ29014.1|  hypothetical protein OsJ_13062                          228   2e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051665.1|  Os03g0810600                                       229   3e-67   
ref|XP_009385505.1|  PREDICTED: mitochondrial Rho GTPase 1-like         228   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67245.1|  hypothetical protein ZEAMMB73_549387                    228   4e-67   
ref|XP_006841409.1|  hypothetical protein AMTR_s00003p00020850          228   4e-67   Amborella trichopoda
ref|XP_008643395.1|  PREDICTED: uncharacterized protein LOC100278...    228   4e-67   Zea mays [maize]
ref|XP_010546687.1|  PREDICTED: mitochondrial Rho GTPase 1-like         228   4e-67   Tarenaya hassleriana [spider flower]
ref|XP_010550971.1|  PREDICTED: mitochondrial Rho GTPase 1-like         228   4e-67   Tarenaya hassleriana [spider flower]
ref|XP_009385504.1|  PREDICTED: mitochondrial Rho GTPase 1-like         227   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004981322.1|  PREDICTED: mitochondrial Rho GTPase 1-like         227   1e-66   Setaria italica
ref|XP_011032724.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    226   2e-66   Populus euphratica
ref|XP_011032722.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    226   2e-66   Populus euphratica
ref|XP_011032721.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    226   2e-66   Populus euphratica
ref|XP_010456750.1|  PREDICTED: mitochondrial Rho GTPase 1-like         224   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008665658.1|  PREDICTED: mitochondrial Rho GTPase 1-like         225   5e-66   Zea mays [maize]
ref|NP_001144985.1|  uncharacterized protein LOC100278140               225   8e-66   Zea mays [maize]
ref|XP_006287226.1|  hypothetical protein CARUB_v10000404mg             224   3e-65   
ref|XP_010535310.1|  PREDICTED: mitochondrial Rho GTPase 1-like         210   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_010421600.1|  PREDICTED: mitochondrial Rho GTPase 1-like         223   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006287227.1|  hypothetical protein CARUB_v10000404mg             223   4e-65   
ref|NP_198106.1|  MIRO-related GTP-ase 1                                223   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129866.1|  PREDICTED: mitochondrial Rho GTPase 1-like         223   4e-65   Brassica rapa
emb|CDY05572.1|  BnaA02g31190D                                          223   4e-65   
ref|XP_006361849.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    223   6e-65   Solanum tuberosum [potatoes]
ref|XP_004230188.1|  PREDICTED: mitochondrial Rho GTPase 1              223   6e-65   Solanum lycopersicum
ref|XP_002874365.1|  EMB2473                                            223   6e-65   
ref|XP_010494001.1|  PREDICTED: mitochondrial Rho GTPase 1-like         222   7e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003556505.1|  PREDICTED: mitochondrial Rho GTPase 1-like         221   2e-64   Glycine max [soybeans]
ref|XP_010908350.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    221   3e-64   Elaeis guineensis
emb|CDY25032.1|  BnaC02g39760D                                          220   4e-64   Brassica napus [oilseed rape]
ref|XP_010908349.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    221   4e-64   Elaeis guineensis
ref|XP_006394958.1|  hypothetical protein EUTSA_v10003793mg             220   6e-64   Eutrema salsugineum [saltwater cress]
dbj|BAJ85941.1|  predicted protein                                      218   9e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563951.1|  PREDICTED: mitochondrial Rho GTPase 1-like         219   9e-64   Brachypodium distachyon [annual false brome]
ref|XP_006382604.1|  hypothetical protein POPTR_0005s03670g             219   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009787210.1|  PREDICTED: mitochondrial Rho GTPase 1-like         219   1e-63   Nicotiana sylvestris
ref|XP_006402304.1|  hypothetical protein EUTSA_v10005831mg             218   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006349667.1|  PREDICTED: mitochondrial Rho GTPase 1-like         218   4e-63   Solanum tuberosum [potatoes]
ref|XP_009631945.1|  PREDICTED: mitochondrial Rho GTPase 1-like         217   5e-63   Nicotiana tomentosiformis
ref|XP_008786933.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    213   6e-63   
ref|XP_008235402.1|  PREDICTED: mitochondrial Rho GTPase 1              216   8e-63   Prunus mume [ume]
gb|KJB23093.1|  hypothetical protein B456_004G080500                    214   9e-63   Gossypium raimondii
ref|XP_007199739.1|  hypothetical protein PRUPE_ppa002696mg             216   1e-62   Prunus persica
gb|KFK35452.1|  hypothetical protein AALP_AA5G286100                    216   1e-62   Arabis alpina [alpine rockcress]
gb|KFK35451.1|  hypothetical protein AALP_AA5G286100                    216   2e-62   Arabis alpina [alpine rockcress]
ref|XP_007050628.1|  Mitochondrial Rho GTPase                           216   2e-62   
ref|XP_004158944.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like       211   2e-62   
ref|XP_011036782.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    216   4e-62   Populus euphratica
ref|XP_010090397.1|  Mitochondrial Rho GTPase 1                         214   4e-62   
gb|KJB23092.1|  hypothetical protein B456_004G080500                    214   5e-62   Gossypium raimondii
ref|XP_008451367.1|  PREDICTED: mitochondrial Rho GTPase 1              214   6e-62   Cucumis melo [Oriental melon]
gb|KJB23094.1|  hypothetical protein B456_004G080500                    214   6e-62   Gossypium raimondii
gb|KJB23090.1|  hypothetical protein B456_004G080500                    214   6e-62   Gossypium raimondii
ref|XP_011036784.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    214   7e-62   Populus euphratica
gb|KJB23091.1|  hypothetical protein B456_004G080500                    214   8e-62   Gossypium raimondii
ref|XP_006444083.1|  hypothetical protein CICLE_v10019250mg             206   2e-61   
ref|XP_009151199.1|  PREDICTED: mitochondrial Rho GTPase 1-like         213   2e-61   
ref|XP_004495731.1|  PREDICTED: mitochondrial Rho GTPase 1-like         213   2e-61   Cicer arietinum [garbanzo]
emb|CDX80639.1|  BnaC07g28050D                                          213   2e-61   
emb|CDX86152.1|  BnaA06g28690D                                          213   2e-61   
ref|XP_006290901.1|  hypothetical protein CARUB_v10017013mg             210   2e-61   
ref|XP_009111756.1|  PREDICTED: mitochondrial Rho GTPase 1-like         213   3e-61   Brassica rapa
gb|KGN44818.1|  hypothetical protein Csa_7G389500                       212   3e-61   Cucumis sativus [cucumbers]
ref|XP_002878499.1|  hypothetical protein ARALYDRAFT_486817             213   3e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_004148893.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    212   3e-61   
emb|CDY69035.1|  BnaA09g52280D                                          213   4e-61   Brassica napus [oilseed rape]
ref|XP_010552773.1|  PREDICTED: mitochondrial Rho GTPase 1              211   7e-61   Tarenaya hassleriana [spider flower]
emb|CAB87760.1|  rac-GTP binding protein-like                           211   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAL25592.1|  AT3g63150/T20O10_250                                    211   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207133.1|  hypothetical protein PRUPE_ppa002661mg             211   2e-60   Prunus persica
ref|XP_006444084.1|  hypothetical protein CICLE_v10019250mg             204   2e-60   
ref|XP_006444082.1|  hypothetical protein CICLE_v10019250mg             207   2e-60   
ref|NP_567139.1|  MIRO-related GTP-ase 2                                211   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008246476.1|  PREDICTED: mitochondrial Rho GTPase 1-like         211   2e-60   Prunus mume [ume]
gb|KDO68750.1|  hypothetical protein CISIN_1g005908mg                   207   3e-60   Citrus sinensis [apfelsine]
gb|AFK45596.1|  unknown                                                 204   1e-59   Medicago truncatula
ref|XP_010413192.1|  PREDICTED: mitochondrial Rho GTPase 1-like         208   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009138638.1|  PREDICTED: mitochondrial Rho GTPase 1              208   1e-59   Brassica rapa
ref|XP_002993625.1|  hypothetical protein SELMODRAFT_451618             208   1e-59   Selaginella moellendorffii
emb|CDX93929.1|  BnaC04g20880D                                          208   1e-59   
ref|XP_002973259.1|  MIRO family protein                                208   1e-59   Selaginella moellendorffii
ref|XP_008454749.1|  PREDICTED: mitochondrial Rho GTPase 1-like         208   2e-59   Cucumis melo [Oriental melon]
ref|XP_006444081.1|  hypothetical protein CICLE_v10019250mg             207   2e-59   Citrus clementina [clementine]
ref|XP_004302432.1|  PREDICTED: mitochondrial Rho GTPase 1-like         207   2e-59   Fragaria vesca subsp. vesca
ref|XP_008368856.1|  PREDICTED: mitochondrial Rho GTPase 1              207   4e-59   
gb|KDO68749.1|  hypothetical protein CISIN_1g005908mg                   207   5e-59   Citrus sinensis [apfelsine]
gb|EEC71783.1|  hypothetical protein OsI_04400                          206   5e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010091557.1|  Mitochondrial Rho GTPase 1                         206   5e-59   Morus notabilis
ref|XP_008386506.1|  PREDICTED: mitochondrial Rho GTPase 1-like         206   6e-59   Malus domestica [apple tree]
emb|CDX89176.1|  BnaA04g00100D                                          206   6e-59   
ref|XP_010468881.1|  PREDICTED: mitochondrial Rho GTPase 1-like         206   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002520752.1|  rac-GTP binding protein, putative                  206   6e-59   Ricinus communis
ref|XP_001775852.1|  predicted protein                                  206   9e-59   
ref|XP_003591106.1|  Mitochondrial Rho GTPase                           206   1e-58   Medicago truncatula
gb|KHN20217.1|  Mitochondrial Rho GTPase 1                              205   2e-58   Glycine soja [wild soybean]
ref|XP_003536081.1|  PREDICTED: mitochondrial Rho GTPase 1-like         205   2e-58   Glycine max [soybeans]
ref|XP_004139182.1|  PREDICTED: mitochondrial Rho GTPase 1-like         204   3e-58   
ref|XP_004156425.1|  PREDICTED: mitochondrial Rho GTPase 1-like         204   3e-58   
ref|XP_009355476.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    204   3e-58   Pyrus x bretschneideri [bai li]
gb|KGN60899.1|  hypothetical protein Csa_2G021700                       204   3e-58   Cucumis sativus [cucumbers]
ref|XP_009355477.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    204   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_010512723.1|  PREDICTED: mitochondrial Rho GTPase 1-like         203   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_007144734.1|  hypothetical protein PHAVU_007G180300g             202   1e-57   Phaseolus vulgaris [French bean]
ref|XP_011079844.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    202   2e-57   Sesamum indicum [beniseed]
ref|XP_006588627.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    199   3e-57   Glycine max [soybeans]
ref|XP_002275434.1|  PREDICTED: mitochondrial Rho GTPase 1              201   5e-57   Vitis vinifera
emb|CDX99980.1|  BnaC09g03210D                                          201   6e-57   
ref|XP_003536499.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    200   1e-56   Glycine max [soybeans]
emb|CDY19722.1|  BnaA09g03750D                                          201   1e-56   Brassica napus [oilseed rape]
ref|XP_007144632.1|  hypothetical protein PHAVU_007G171800g             198   5e-56   Phaseolus vulgaris [French bean]
ref|XP_009111753.1|  PREDICTED: mitochondrial Rho GTPase 1-like         198   8e-56   
ref|XP_006604432.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    195   1e-55   Glycine max [soybeans]
ref|XP_003554248.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    196   3e-55   Glycine max [soybeans]
ref|XP_006604431.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    196   4e-55   Glycine max [soybeans]
gb|KJB26440.1|  hypothetical protein B456_004G241600                    195   6e-55   Gossypium raimondii
ref|XP_006644996.1|  PREDICTED: mitochondrial Rho GTPase 1-like         195   1e-54   
gb|EYU46588.1|  hypothetical protein MIMGU_mgv1a002738mg                190   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_007162421.1|  hypothetical protein PHAVU_001G150700g             187   4e-52   Phaseolus vulgaris [French bean]
ref|XP_010094555.1|  Mitochondrial Rho GTPase 2                         186   1e-51   
ref|XP_009367695.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    184   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_009367694.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    184   7e-51   
ref|XP_004495205.1|  PREDICTED: mitochondrial Rho GTPase 1-like         182   6e-50   Cicer arietinum [garbanzo]
gb|KHN45356.1|  Mitochondrial Rho GTPase 1                              181   1e-49   Glycine soja [wild soybean]
ref|XP_001767645.1|  predicted protein                                  181   1e-49   
ref|XP_003590652.1|  Mitochondrial Rho GTPase                           179   5e-49   Medicago truncatula
ref|XP_001779282.1|  predicted protein                                  179   6e-49   
ref|XP_004493664.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    179   7e-49   Cicer arietinum [garbanzo]
ref|XP_004493665.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    179   7e-49   Cicer arietinum [garbanzo]
gb|KHN03795.1|  Mitochondrial Rho GTPase 1                              176   1e-47   Glycine soja [wild soybean]
ref|XP_006298991.1|  hypothetical protein CARUB_v10015117mg             175   1e-47   
gb|EMS67255.1|  Mitochondrial Rho GTPase 1                              172   1e-46   Triticum urartu
gb|EMT05838.1|  Mitochondrial Rho GTPase 1                              172   1e-46   
gb|KHN18884.1|  Mitochondrial Rho GTPase 1                              168   3e-46   Glycine soja [wild soybean]
ref|XP_006575867.1|  PREDICTED: mitochondrial Rho GTPase 1-like         169   4e-46   
ref|XP_004290658.1|  PREDICTED: mitochondrial Rho GTPase 2              171   5e-46   Fragaria vesca subsp. vesca
ref|XP_001778992.1|  predicted protein                                  170   1e-45   
ref|XP_003571671.1|  PREDICTED: mitochondrial Rho GTPase 1-like         169   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_006651944.1|  PREDICTED: mitochondrial Rho GTPase 1-like         158   1e-45   
ref|XP_003520566.1|  PREDICTED: mitochondrial Rho GTPase 1-like         169   2e-45   Glycine max [soybeans]
ref|NP_187182.1|  MIRO-related GTP-ase 3                                168   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882407.1|  hypothetical protein ARALYDRAFT_477819             168   5e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_010464053.1|  PREDICTED: mitochondrial Rho GTPase 1-like         164   9e-44   
gb|KEH23754.1|  Rho GTPase                                              162   2e-43   Medicago truncatula
ref|XP_003613772.1|  Mitochondrial Rho GTPase                           163   3e-43   
gb|AES96730.2|  Rho GTPase-like protein                                 162   4e-43   Medicago truncatula
gb|KEH23751.1|  Rho GTPase                                              162   4e-43   Medicago truncatula
ref|XP_006408091.1|  hypothetical protein EUTSA_v10020270mg             162   4e-43   Eutrema salsugineum [saltwater cress]
gb|KEH23750.1|  Rho GTPase                                              162   4e-43   Medicago truncatula
gb|KEH23752.1|  Rho GTPase                                              162   5e-43   Medicago truncatula
gb|KEH23753.1|  Rho GTPase                                              161   6e-43   Medicago truncatula
ref|XP_010485971.1|  PREDICTED: mitochondrial Rho GTPase 1-like         160   3e-42   
gb|KEH32598.1|  Rho GTPase-like protein                                 157   5e-41   Medicago truncatula
ref|XP_010242349.1|  PREDICTED: mitochondrial Rho GTPase 1-like         156   5e-41   
ref|XP_010425682.1|  PREDICTED: mitochondrial Rho GTPase 1              155   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_005702894.1|  Miro (mitochondrial Rho) protein (GTPase/ ca...    154   4e-40   Galdieria sulphuraria
ref|XP_003613256.1|  Mitochondrial Rho GTPase                           153   9e-40   Medicago truncatula
emb|CDY40707.1|  BnaC03g34230D                                          152   3e-39   Brassica napus [oilseed rape]
gb|AAT77912.1|  hypothetical protein                                    146   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124073.1|  PREDICTED: mitochondrial Rho GTPase 2-like         148   6e-38   Brassica rapa
ref|XP_005642921.1|  hypothetical protein COCSUDRAFT_38657              143   2e-36   Coccomyxa subellipsoidea C-169
ref|XP_010098381.1|  Mitochondrial Rho GTPase 1                         140   3e-36   
emb|CDY66986.1|  BnaAnng23350D                                          142   6e-36   Brassica napus [oilseed rape]
dbj|GAC93572.1|  hypothetical protein PHSY_001137                       140   6e-35   Pseudozyma hubeiensis SY62
ref|XP_011389032.1|  hypothetical protein UMAG_02638                    139   3e-34   Ustilago maydis 521
ref|XP_009134822.1|  PREDICTED: mitochondrial Rho GTPase 2              137   3e-34   Brassica rapa
gb|KFH68549.1|  hypothetical protein MVEG_05362                         137   4e-34   Mortierella verticillata NRRL 6337
gb|EST05554.1|  Small GTPase - RAS protein                              138   4e-34   Kalmanozyma brasiliensis GHG001
ref|NP_001044775.1|  Os01g0843300                                       137   4e-34   
emb|CBQ73019.1|  conserved hypothetical protein                         138   4e-34   Sporisorium reilianum SRZ2
dbj|BAD81741.1|  putative mitochondrial Rho 1                           136   7e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EPS66187.1|  hypothetical protein M569_08590                         132   9e-34   Genlisea aurea
gb|EEE55655.1|  hypothetical protein OsJ_04046                          135   2e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CDI53495.1|  conserved hypothetical protein                         136   3e-33   Melanopsichium pennsylvanicum 4
dbj|GAK64448.1|  mitochondrial Rho 1                                    135   3e-33   Moesziomyces antarcticus
emb|CCF52858.1|  uncharacterized protein UHOR_04215                     135   4e-33   Ustilago hordei
gb|ETS64793.1|  hypothetical protein PaG_00757                          135   5e-33   Moesziomyces aphidis DSM 70725
dbj|GAC71821.1|  predicted Ras related Rac-GTP binding protein          135   5e-33   Moesziomyces antarcticus T-34
gb|KDN47152.1|  mitochondrial Rho GTPase 1                              134   1e-32   Tilletiaria anomala UBC 951
ref|XP_005847786.1|  hypothetical protein CHLNCDRAFT_133936             130   7e-32   Chlorella variabilis
dbj|BAJ94408.1|  predicted protein                                      130   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDQ20950.1|  hypothetical protein BOTBODRAFT_124842                  128   1e-30   Botryobasidium botryosum FD-172 SS1
gb|KIJ54421.1|  hypothetical protein M422DRAFT_58414                    127   2e-30   Sphaerobolus stellatus SS14
gb|KIK06177.1|  hypothetical protein K443DRAFT_286142                   127   3e-30   Laccaria amethystina LaAM-08-1
ref|XP_001876187.1|  predicted protein                                  127   3e-30   Laccaria bicolor S238N-H82
ref|XP_007380209.1|  mitochondrial Rho GTPase                           127   3e-30   Punctularia strigosozonata HHB-11173 SS5
ref|XP_007329726.1|  hypothetical protein AGABI1DRAFT_59100             126   4e-30   Agaricus bisporus var. burnettii JB137-S8
gb|KII90979.1|  hypothetical protein PLICRDRAFT_158439                  126   6e-30   Plicaturopsis crispa FD-325 SS-3
ref|XP_006462756.1|  hypothetical protein AGABI2DRAFT_224362            126   6e-30   Agaricus bisporus var. bisporus H97
gb|KDR82801.1|  hypothetical protein GALMADRAFT_88479                   126   7e-30   Galerina marginata CBS 339.88
emb|CEJ03380.1|  Putative Mitochondrial Rho GTPase 1                    122   7e-30   Rhizopus microsporus
gb|EPT05115.1|  hypothetical protein FOMPIDRAFT_1027338                 125   8e-30   Fomitopsis pinicola FP-58527 SS1
gb|ESA16053.1|  hypothetical protein GLOINDRAFT_160597                  125   8e-30   
gb|KJA23989.1|  hypothetical protein HYPSUDRAFT_162448                  125   8e-30   Hypholoma sublateritium FD-334 SS-4
emb|CCL99263.1|  predicted protein                                      125   8e-30   Fibroporia radiculosa
gb|KIJ17754.1|  hypothetical protein PAXINDRAFT_130103                  125   9e-30   Paxillus involutus ATCC 200175
ref|XP_007319634.1|  hypothetical protein SERLADRAFT_470296             125   9e-30   Serpula lacrymans var. lacrymans S7.9
gb|AES92418.2|  Rho GTPase                                              125   9e-30   Medicago truncatula
gb|KIJ64547.1|  hypothetical protein HYDPIDRAFT_111893                  125   1e-29   Hydnomerulius pinastri MD-312
ref|XP_003034526.1|  hypothetical protein SCHCODRAFT_52884              125   1e-29   Schizophyllum commune H4-8
gb|KIP10221.1|  hypothetical protein PHLGIDRAFT_85427                   125   1e-29   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003610221.1|  Mitochondrial Rho GTPase                           125   2e-29   
ref|XP_007399690.1|  hypothetical protein PHACADRAFT_177305             124   2e-29   Phanerochaete carnosa HHB-10118-sp
ref|XP_001835979.2|  mitochondrial Rho 1                                124   2e-29   Coprinopsis cinerea okayama7#130
gb|AAP73841.1|  hypothetical protein                                    120   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|KIM66859.1|  hypothetical protein SCLCIDRAFT_257565                  124   2e-29   Scleroderma citrinum Foug A
ref|XP_011423546.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    124   3e-29   Crassostrea gigas
ref|XP_011423547.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    124   3e-29   Crassostrea gigas
gb|KIK57222.1|  hypothetical protein GYMLUDRAFT_98845                   124   3e-29   Gymnopus luxurians FD-317 M1
gb|KIM89138.1|  hypothetical protein PILCRDRAFT_813047                  124   4e-29   Piloderma croceum F 1598
emb|CEI90383.1|  Putative Mitochondrial Rho GTPase                      124   4e-29   Rhizopus microsporus
emb|CEP12085.1|  hypothetical protein                                   123   5e-29   Parasitella parasitica
gb|EPB85013.1|  mitochondrial Rho GTPase 1                              123   5e-29   Mucor circinelloides f. circinelloides 1006PhL
gb|KIK18365.1|  hypothetical protein PISMIDRAFT_684252                  123   5e-29   Pisolithus microcarpus 441
dbj|GAN04132.1|  mitochondrial Rho 1                                    123   6e-29   Mucor ambiguus
gb|KIL67794.1|  hypothetical protein M378DRAFT_72960                    123   6e-29   Amanita muscaria Koide BX008
gb|KDQ62481.1|  hypothetical protein JAAARDRAFT_121545                  123   7e-29   Jaapia argillacea MUCL 33604
ref|XP_003330754.2|  hypothetical protein PGTG_12291                    123   8e-29   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|KIK45607.1|  hypothetical protein CY34DRAFT_801381                   122   1e-28   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007007020.1|  hypothetical protein TREMEDRAFT_40611              122   1e-28   Tremella mesenterica DSM 1558
ref|XP_007866767.1|  mitochondrial Rho GTPase                           122   1e-28   Gloeophyllum trabeum ATCC 11539
ref|XP_011423548.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    122   1e-28   Crassostrea gigas
ref|XP_011423549.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    122   1e-28   Crassostrea gigas
gb|KIY45663.1|  mitochondrial Rho 1                                     122   1e-28   Fistulina hepatica ATCC 64428
ref|XP_008037865.1|  mitochondrial Rho GTPase                           122   2e-28   Trametes versicolor FP-101664 SS1
emb|CDH57580.1|  mitochondrial rho 1                                    121   2e-28   Lichtheimia corymbifera JMRC:FSU:9682
gb|KIO02676.1|  hypothetical protein M404DRAFT_1001881                  122   2e-28   Pisolithus tinctorius Marx 270
gb|KIK80370.1|  hypothetical protein PAXRUDRAFT_833557                  122   2e-28   Paxillus rubicundulus Ve08.2h10
gb|EMS23072.1|  mitochondrial Rho 1                                     122   2e-28   Rhodotorula toruloides NP11
emb|CDR46547.1|  RHTO0S12e06062g1_1                                     122   2e-28   Rhodotorula toruloides
emb|CDS08665.1|  Putative Mitochondrial Rho GTPase 1                    121   3e-28   Lichtheimia ramosa
emb|CDH57579.1|  mitochondrial rho 1                                    121   3e-28   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007409133.1|  hypothetical protein MELLADRAFT_116192             121   3e-28   Melampsora larici-populina 98AG31
gb|KIR34995.1|  mitochondrial Rho GTPase 1                              121   4e-28   Cryptococcus gattii VGII MMRL2647
gb|KDQ25557.1|  hypothetical protein PLEOSDRAFT_1057842                 120   4e-28   Pleurotus ostreatus PC15
gb|KIR84145.1|  mitochondrial Rho GTPase 1                              121   4e-28   Cryptococcus gattii VGIV IND107
ref|XP_003194619.1|  vesicle-mediated transport-related protein         121   5e-28   
gb|KIR28386.1|  mitochondrial Rho GTPase 1                              121   5e-28   
gb|KGB76107.1|  mitochondrial Rho GTPase 1                              121   5e-28   
gb|KEP53085.1|  Rho GTPase                                              120   5e-28   
ref|XP_009545782.1|  hypothetical protein HETIRDRAFT_36706              120   5e-28   
gb|EMD39551.1|  hypothetical protein CERSUDRAFT_111868                  120   5e-28   
emb|CEL52020.1|  hypothetical protein RSOLAG1IB_00557                   120   6e-28   
gb|KIR45690.1|  mitochondrial Rho GTPase 1                              120   7e-28   
gb|KIR58273.1|  mitochondrial Rho GTPase 1                              120   7e-28   
ref|XP_011396840.1|  Mitochondrial Rho GTPase                           117   9e-28   
emb|CDO71695.1|  hypothetical protein BN946_scf184915.g39               119   1e-27   
ref|XP_007304676.1|  mitochondrial Rho 1                                120   1e-27   
ref|XP_007768461.1|  mitochondrial Rho 1                                119   1e-27   
ref|XP_007346086.1|  mitochondrial Rho GTPase                           119   1e-27   
ref|XP_774921.1|  hypothetical protein CNBF0860                         119   2e-27   
ref|XP_007363716.1|  mitochondrial Rho 1                                119   2e-27   
ref|XP_571358.1|  vesicle-mediated transport-related protein            119   2e-27   
ref|XP_007844953.1|  mitochondrial rho gtpase 1                         119   2e-27   
ref|XP_007271728.1|  mitochondrial Rho GTPase                           119   3e-27   
gb|KIO29747.1|  hypothetical protein M407DRAFT_163566                   119   3e-27   
gb|KIY71675.1|  mitochondrial Rho GTPase                                118   4e-27   
ref|XP_006679829.1|  hypothetical protein BATDEDRAFT_19960              117   6e-27   
gb|ELT87672.1|  hypothetical protein CAPTEDRAFT_218919                  117   7e-27   
gb|AFR95905.1|  mitochondrial Rho GTPase 1                              117   1e-26   
gb|KFM77075.1|  Mitochondrial Rho GTPase 1                              115   4e-26   
ref|XP_009297701.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    115   5e-26   
ref|XP_009297702.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    115   5e-26   
ref|XP_007891818.1|  PREDICTED: mitochondrial Rho GTPase 2 isofor...    114   6e-26   
ref|XP_007891819.1|  PREDICTED: mitochondrial Rho GTPase 2 isofor...    114   6e-26   
emb|CCU97440.1|  unnamed protein product                                115   8e-26   
ref|XP_005709866.1|  unnamed protein product                            114   8e-26   
ref|XP_009188357.1|  PREDICTED: mitochondrial Rho GTPase 1              114   2e-25   
emb|CAX72934.1|  ras homolog gene family, member T1                     114   2e-25   
ref|XP_005176029.1|  PREDICTED: mitochondrial Rho GTPase isoform X2     113   2e-25   
ref|XP_005534815.1|  mitochondrial Rho GTP-binding protein Miro         113   2e-25   
ref|XP_005176030.1|  PREDICTED: mitochondrial Rho GTPase isoform X3     113   2e-25   
ref|XP_005176026.1|  PREDICTED: mitochondrial Rho GTPase isoform X1     113   2e-25   
ref|NP_001074335.1|  mitochondrial Rho GTPase 2                         113   2e-25   
gb|EJT98761.1|  mitochondrial Rho 1                                     113   2e-25   
gb|KGL87788.1|  Mitochondrial Rho GTPase 1                              113   2e-25   
gb|KGB34985.1|  Mitochondrial Rho GTPase                                114   3e-25   
gb|AAH68463.1|  RHOT1 protein                                           113   3e-25   
gb|AAH41114.1|  RHOT1 protein                                           113   3e-25   
emb|CCD80717.1|  putative rac-GTP binding protein                       113   4e-25   
ref|NP_001006208.1|  mitochondrial Rho GTPase 1                         112   4e-25   
ref|XP_008494960.1|  PREDICTED: mitochondrial Rho GTPase 2 isofor...    112   4e-25   
ref|XP_008494959.1|  PREDICTED: mitochondrial Rho GTPase 2 isofor...    112   4e-25   
ref|XP_002603584.1|  hypothetical protein BRAFLDRAFT_93126              112   4e-25   
ref|NP_997869.1|  mitochondrial Rho GTPase 1-A                          112   4e-25   
gb|AAH44431.1|  Ras homolog gene family, member T1a                     112   5e-25   
ref|XP_007877819.1|  hypothetical protein PFL1_02117                    113   5e-25   
ref|XP_009297700.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    112   5e-25   
ref|NP_001076295.2|  mitochondrial Rho GTPase 1                         112   5e-25   
ref|XP_005166247.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   5e-25   
ref|XP_008011602.1|  PREDICTED: mitochondrial Rho GTPase 1              112   5e-25   
ref|XP_010370587.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   5e-25   
ref|XP_005166248.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   5e-25   
ref|XP_003818071.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   5e-25   
ref|XP_002800405.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    112   6e-25   
ref|XP_005583440.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   6e-25   
ref|XP_010370586.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   6e-25   
ref|XP_002800404.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    112   7e-25   
ref|XP_005583436.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   7e-25   
ref|XP_010370585.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   7e-25   
ref|XP_010370584.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   7e-25   
ref|XP_005583437.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   7e-25   
ref|XP_001109912.2|  PREDICTED: mitochondrial Rho GTPase 1-like i...    112   8e-25   
ref|XP_010370582.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   8e-25   
ref|XP_009249772.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    112   8e-25   
ref|XP_010370583.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    112   8e-25   
ref|XP_004042015.1|  PREDICTED: mitochondrial Rho GTPase 1              111   9e-25   
ref|XP_002943363.2|  PREDICTED: mitochondrial Rho GTPase 1-like i...    111   2e-24   
ref|XP_005797563.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   2e-24   
ref|XP_006739093.1|  PREDICTED: mitochondrial Rho GTPase 1-like         109   2e-24   
ref|XP_005797562.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   2e-24   
ref|XP_010341917.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   2e-24   
ref|XP_005102390.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   2e-24   
ref|XP_010341916.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   2e-24   
ref|XP_005993810.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    110   2e-24   
ref|XP_005102389.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   3e-24   
ref|XP_005166249.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_007423563.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    109   3e-24   
ref|XP_009893094.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    110   3e-24   
ref|XP_008413168.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   3e-24   
ref|XP_004071539.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    110   3e-24   
ref|XP_010787225.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like       109   3e-24   
ref|XP_010405714.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_005526746.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_010565316.1|  PREDICTED: mitochondrial Rho GTPase 2              110   3e-24   
ref|XP_008413163.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    110   3e-24   
ref|XP_005526745.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_010405713.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_011303852.1|  PREDICTED: mitochondrial Rho GTPase isoform X3     110   3e-24   
ref|XP_011303851.1|  PREDICTED: mitochondrial Rho GTPase isoform X2     110   3e-24   
ref|XP_007423562.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    110   3e-24   
ref|XP_005349471.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   3e-24   
ref|XP_004177020.1|  PREDICTED: mitochondrial Rho GTPase 1              110   3e-24   
ref|NP_001153288.1|  mitochondrial Rho GTPase 2                         105   3e-24   
ref|XP_002198633.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 2    110   4e-24   
ref|XP_010405715.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
ref|XP_007423561.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    110   4e-24   
ref|XP_002748243.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   4e-24   
ref|XP_005349470.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
ref|XP_006787499.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   4e-24   
ref|XP_003933061.2|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
gb|KDE06290.1|  mitochondrial Rho GTPase 1                              110   4e-24   
ref|XP_007551618.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   4e-24   
ref|XP_005349469.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   4e-24   
ref|XP_008995361.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   4e-24   
ref|XP_003933063.2|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
ref|XP_003933060.2|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
ref|XP_006787498.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   4e-24   
ref|XP_003933062.2|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    110   4e-24   
ref|XP_007247925.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_010742768.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_005349468.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_007247926.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
emb|CAB66863.1|  hypothetical protein                                   109   5e-24   
ref|XP_002748244.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_005470008.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_004567869.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_011303849.1|  PREDICTED: mitochondrial Rho GTPase isoform X1     109   5e-24   
ref|XP_008327904.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    109   5e-24   
ref|XP_008327906.1|  PREDICTED: mitochondrial Rho GTPase 1-A isof...    109   5e-24   
ref|XP_005077140.1|  PREDICTED: mitochondrial Rho GTPase 1              109   5e-24   
ref|NP_001121318.1|  ras homolog family member T1                       109   5e-24   
ref|XP_002748245.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_002748246.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_005749016.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_004567868.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_006722033.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_008995360.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_004385457.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 3    109   5e-24   
ref|XP_008995359.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_006154430.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_003279416.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 1    109   5e-24   
emb|CAL38085.1|  hypothetical protein                                   109   5e-24   
gb|EAW80246.1|  ras homolog gene family, member T1, isoform CRA_e       109   5e-24   
ref|XP_004684940.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   5e-24   
ref|XP_003447940.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   5e-24   
ref|XP_009060214.1|  hypothetical protein LOTGIDRAFT_210168             108   6e-24   
ref|NP_060777.3|  mitochondrial Rho GTPase 1 isoform 3                  109   6e-24   
ref|XP_007551617.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   6e-24   
gb|EAW80250.1|  ras homolog gene family, member T1, isoform CRA_i       109   6e-24   
ref|XP_010742769.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   6e-24   
ref|XP_008519683.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
gb|AAH60781.2|  Ras homolog gene family, member T1                      109   6e-24   
ref|XP_004593939.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004593940.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_007530883.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006099930.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_011358327.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006925036.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
emb|CCO28810.1|  hypothetical protein BN14_02808                        110   6e-24   
emb|CAD56956.1|  mitochondrial Rho 1                                    109   6e-24   
gb|KIM28732.1|  hypothetical protein M408DRAFT_329191                   109   6e-24   
ref|XP_003279418.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 3    109   6e-24   
ref|XP_008145981.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004593938.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004593937.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004267221.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 1    109   6e-24   
ref|XP_006977571.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|NP_001100496.1|  mitochondrial Rho GTPase 1                         109   6e-24   
ref|XP_004385456.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 2    109   6e-24   
ref|XP_003279417.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 2    109   6e-24   
ref|NP_001039547.1|  mitochondrial Rho GTPase 1                         109   6e-24   
ref|XP_004707005.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_008846403.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_867966.1|  PREDICTED: mitochondrial Rho GTPase 1 isoformX2       109   6e-24   
ref|XP_004267222.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 2    109   6e-24   
ref|XP_002912393.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|NP_001275683.1|  mitochondrial Rho GTPase 1 isoform 5               109   6e-24   
ref|XP_007452439.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_007628333.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
tpg|DAA19129.1|  TPA: mitochondrial Rho GTPase 1                        109   6e-24   
ref|XP_003964614.1|  PREDICTED: mitochondrial Rho GTPase 1-A-like...    109   6e-24   
ref|XP_005258053.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_008145980.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004684938.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006925034.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006154428.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|NP_001028738.1|  mitochondrial Rho GTPase 1 isoform 2               109   6e-24   
ref|XP_006059471.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_008519682.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_008519680.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006154426.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_010592519.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_003797231.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    109   6e-24   
ref|XP_008519678.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_006890992.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_005003589.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_004807644.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
gb|EDL15631.1|  ras homolog gene family, member T1, isoform CRA_b       109   6e-24   
ref|NP_067511.4|  mitochondrial Rho GTPase 1 isoform 1                  109   6e-24   
ref|XP_006099926.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   6e-24   
ref|XP_010956619.1|  PREDICTED: mitochondrial Rho GTPase 1              109   7e-24   
ref|XP_005327847.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_004454951.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 5    109   7e-24   
ref|XP_537733.4|  PREDICTED: mitochondrial Rho GTPase 1 isoformX1       109   7e-24   
ref|XP_005327846.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_003797228.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    108   7e-24   
ref|XP_011228948.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_004807642.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_006832365.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    108   7e-24   
ref|XP_004399670.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 4    108   7e-24   
ref|XP_007530881.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_004684937.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_006154429.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_007530882.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_004454950.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 4    109   7e-24   
ref|XP_003279419.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 4    109   7e-24   
ref|XP_004707004.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_006247047.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    108   7e-24   
ref|XP_004399669.1|  PREDICTED: mitochondrial Rho GTPase 1 isoform 3    109   7e-24   
dbj|BAB31529.2|  unnamed protein product                                108   7e-24   
ref|XP_007628332.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_003483108.1|  PREDICTED: mitochondrial Rho GTPase 1 isoformX2    108   7e-24   
ref|XP_005220053.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_007452438.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_005327845.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   
ref|XP_004747123.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    109   7e-24   



>ref|XP_009625701.1| PREDICTED: mitochondrial Rho GTPase 1 [Nicotiana tomentosiformis]
 ref|XP_009625702.1| PREDICTED: mitochondrial Rho GTPase 1 [Nicotiana tomentosiformis]
Length=645

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            GVR++VAGD KTGKSSLIL AAT+S+P++VPPVLPPTRLPDDI+PDRVP+TIIDTSSSPE
Sbjct  15   GVRIVVAGDAKTGKSSLILTAATDSYPSNVPPVLPPTRLPDDIYPDRVPVTIIDTSSSPE  74

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
            NRG L EE+ RADAVVLTYACDKPATLDRLST+WLPELRRLEV+ PVIVVGCMLDKRD+Q
Sbjct  75   NRGKLVEELKRADAVVLTYACDKPATLDRLSTFWLPELRRLEVRVPVIVVGCMLDKRDEQ  134

Query  516  QAINLEQVMLPIMQQFREIETCIECSAY  599
              ++LEQVM PIMQQFREIETCIECSAY
Sbjct  135  IPVSLEQVMSPIMQQFREIETCIECSAY  162



>emb|CAN83792.1| hypothetical protein VITISV_021048 [Vitis vinifera]
Length=180

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G++N+ GN +GVR++VAGD  TGKSSLI+ AA E+FPA+V PVLPPTRLPDD +PDR
Sbjct  4    ASAGATNS-GNRTGVRIVVAGDRGTGKSSLIVTAAAENFPANVAPVLPPTRLPDDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSSS ENR  L +E+ RADAVVLTYACD+PATLDRLST+WLPELRRLEVK PV
Sbjct  63   VPITIIDTSSSLENRSALADELRRADAVVLTYACDQPATLDRLSTFWLPELRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  123  IVVGCKLDLRDENQQMSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_011075507.1| PREDICTED: mitochondrial Rho GTPase 1 [Sesamum indicum]
 ref|XP_011075508.1| PREDICTED: mitochondrial Rho GTPase 1 [Sesamum indicum]
Length=645

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + VR++VAGD KTGKSSLI+ AA E+FP +VPPVLPPTRLP+D++PDRVP+TIIDTSSSP
Sbjct  13   NAVRIVVAGDAKTGKSSLIVTAAAENFPTNVPPVLPPTRLPEDLYPDRVPVTIIDTSSSP  72

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            ENRG L EE+ RADAVVLTYACD+P TLDRLSTYWLPELRRLEVK PVIVVGCMLDKR D
Sbjct  73   ENRGKLVEELTRADAVVLTYACDRPETLDRLSTYWLPELRRLEVKVPVIVVGCMLDKRGD  132

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  133  QQPVSLEQVMSPIMQQFREIETCIECSA  160



>gb|EYU28762.1| hypothetical protein MIMGU_mgv1a002695mg [Erythranthe guttata]
 gb|EYU28763.1| hypothetical protein MIMGU_mgv1a002695mg [Erythranthe guttata]
Length=646

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD KTGKSSLI+ AA ESFP +VPPV+PPTRLP+D++PDRVP+TI+DTSSSPEN
Sbjct  16   VRIVVAGDAKTGKSSLIVTAAAESFPTNVPPVMPPTRLPEDLYPDRVPVTIVDTSSSPEN  75

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            RG L E++ RADAVVLTYACD+P TLDRLSTYWLPELRRLEVK PVIVVGCMLDKR DQQ
Sbjct  76   RGRLVEDLKRADAVVLTYACDRPETLDRLSTYWLPELRRLEVKVPVIVVGCMLDKRGDQQ  135

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             ++LEQVM PIMQQFREIETCIECSA
Sbjct  136  PVSLEQVMSPIMQQFREIETCIECSA  161



>emb|CDP15520.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGN---ISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDI  284
            MAGGG++  + N    +GVR++VAGD KTGKSSLIL AA ++FP SV  VLPPTRLPDD+
Sbjct  1    MAGGGANATRWNPTGAAGVRIVVAGDAKTGKSSLILTAAADAFPPSVLSVLPPTRLPDDM  60

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEV  464
            FPDRVP+T++DTSSS ENRG L EE+ RADAV+LTYACD+P TLDRLST+WLPELRR+EV
Sbjct  61   FPDRVPVTVVDTSSSTENRGKLVEELRRADAVILTYACDRPETLDRLSTFWLPELRRIEV  120

Query  465  KAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            + PVIVVGCMLDKRDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  121  RVPVIVVGCMLDKRDDDYPVSLEQVMSPIMQQFREIETCIECSA  164



>gb|KJB26439.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=471

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G  +GVR++VAGD  TGKSSLI+ AA E+FP +VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-TGVRIVVAGDRGTGKSSLIVTAAAETFPTNVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L EE+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  63   IIDTSSNPEDRGKLAEELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>ref|XP_002284757.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659841.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659842.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659843.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
Length=647

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G++N+ GN +GVR++VAGD  TGKSSLI+ AA E+FPA+V PVLPPTRLPDD +PDR
Sbjct  4    ASAGATNS-GNRTGVRIVVAGDRGTGKSSLIVTAAAENFPANVAPVLPPTRLPDDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSSS ENR  L +E+ RADAVVLTYACD+PATLDRLST+WLPELRRLEVK PV
Sbjct  63   VPITIIDTSSSLENRSALADELRRADAVVLTYACDQPATLDRLSTFWLPELRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  123  IVVGCKLDLRDENQQMSLEQVMSPIMQQFREIETCIECSA  162



>emb|CBI36765.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G++N+ GN +GVR++VAGD  TGKSSLI+ AA E+FPA+V PVLPPTRLPDD +PDR
Sbjct  41   ASAGATNS-GNRTGVRIVVAGDRGTGKSSLIVTAAAENFPANVAPVLPPTRLPDDFYPDR  99

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSSS ENR  L +E+ RADAVVLTYACD+PATLDRLST+WLPELRRLEVK PV
Sbjct  100  VPITIIDTSSSLENRSALADELRRADAVVLTYACDQPATLDRLSTFWLPELRRLEVKVPV  159

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  160  IVVGCKLDLRDENQQMSLEQVMSPIMQQFREIETCIECSA  199



>gb|KJB26438.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=568

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G  +GVR++VAGD  TGKSSLI+ AA E+FP +VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-TGVRIVVAGDRGTGKSSLIVTAAAETFPTNVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L EE+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  63   IIDTSSNPEDRGKLAEELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>gb|KJB26437.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=644

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G  +GVR++VAGD  TGKSSLI+ AA E+FP +VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-TGVRIVVAGDRGTGKSSLIVTAAAETFPTNVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L EE+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  63   IIDTSSNPEDRGKLAEELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>ref|XP_010244210.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
 ref|XP_010244211.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
Length=646

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            MAG   + + G  + VR++V GDP TGKSSLI+ AA E+FP++VPPVLPPTRLP D +PD
Sbjct  1    MAGSAGNLSLGGRTNVRIVVVGDPGTGKSSLIVTAAAEAFPSNVPPVLPPTRLPADFYPD  60

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVPLTIIDTSSS  + G LFEE+  ADAVVLTYACD+P TLDRLST+WLPELRRLEVK P
Sbjct  61   RVPLTIIDTSSSYNSIGKLFEELKHADAVVLTYACDRPETLDRLSTFWLPELRRLEVKVP  120

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RDD Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  121  VIVVGCKLDLRDDNQQVSLEQVMSPIMQQFREIETCIECSA  161



>ref|XP_010674761.1| PREDICTED: mitochondrial Rho GTPase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            ++ G  +G+R++VAGD  TGKSSLI+ A +E+FP +VPPVLPP+RLPDD+FPDRVP+TII
Sbjct  4    SSSGTKNGIRIVVAGDRATGKSSLIVTAVSETFPTNVPPVLPPSRLPDDMFPDRVPITII  63

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSSS E R  + EEM RADAVVLTYACD+P +LDRLSTYWLPELRRLEV+ PVIVVGC 
Sbjct  64   DTSSSVEQRNKVGEEMRRADAVVLTYACDRPESLDRLSTYWLPELRRLEVRVPVIVVGCK  123

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            LD RD+QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  124  LDLRDEQQQVSLEQVMSPIMQQFREIETCIECSA  157



>gb|KDO56330.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
Length=514

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  114  MAGGGSSNAK-GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   ++N+  G  +GVR++V G+  TGKSSLI+ AA ++FPA+VPPVLPPTRLP+D +P
Sbjct  1    MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP+TIIDT SS E+RG L EE+ RADAVVLTYACD+P TLD LST+WLPELRRLEVK 
Sbjct  61   DRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD+ Q ++LEQVM+PIMQQFREIETCIECSA
Sbjct  121  PVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSA  162



>gb|AAP73840.1| unknown protein,3'-partial [Oryza sativa Japonica Group]
Length=165

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
             GVRV+V GDP TGKSSL+++ ATE+FP +VP V+PPTRLP D FPDRVP+TI+DTSSSP
Sbjct  14   QGVRVVVIGDPGTGKSSLVVSVATEAFPENVPRVMPPTRLPADYFPDRVPITIVDTSSSP  73

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+R  L  E   ADAVVLTYACD+PATL+RLST+WLPELRRL++KAPVIVVGC LD RD+
Sbjct  74   EHRAKLIAECQAADAVVLTYACDRPATLERLSTFWLPELRRLQLKAPVIVVGCKLDLRDE  133

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  134  QQ-VSLEQVMAPIMQTFREIETCIECSA  160



>gb|KDO56328.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
 gb|KDO56329.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
Length=573

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  114  MAGGGSSNAK-GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   ++N+  G  +GVR++V G+  TGKSSLI+ AA ++FPA+VPPVLPPTRLP+D +P
Sbjct  1    MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP+TIIDT SS E+RG L EE+ RADAVVLTYACD+P TLD LST+WLPELRRLEVK 
Sbjct  61   DRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD+ Q ++LEQVM+PIMQQFREIETCIECSA
Sbjct  121  PVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSA  162



>ref|XP_002512373.1| rac-GTP binding protein, putative [Ricinus communis]
 gb|EEF49825.1| rac-GTP binding protein, putative [Ricinus communis]
Length=583

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A   S+N  G  SGVR++VAGD  TGKSSLI+ AA ++FPA+VPPVLPPTRLP+D +PDR
Sbjct  4    AASASANPGGR-SGVRIVVAGDRGTGKSSLIVTAAVDTFPANVPPVLPPTRLPEDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            +P+TIIDTSS  E+ G + EE+ RADAVVLTYACD+P TLDRLST+WLPELRRLEVK PV
Sbjct  63   IPVTIIDTSSRVEDSGKVAEELKRADAVVLTYACDRPETLDRLSTFWLPELRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD RD+ Q ++LE VM PIMQQFREIETCIECSAY
Sbjct  123  IVVGCKLDLRDENQQVSLEIVMSPIMQQFREIETCIECSAY  163



>gb|KJB45950.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
 gb|KJB45951.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
 gb|KJB45954.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=644

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G   GVR++VAGD  TGKSSLI+ AA E+FP +V  +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-PGVRIVVAGDRGTGKSSLIVTAAAETFPTNVLRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTS++PE+RG L EE+ RADA+VLTYACD+P TL+RLSTYWLPELR+LEVK PVIVVG
Sbjct  63   IIDTSANPEDRGKLAEELKRADALVLTYACDQPETLNRLSTYWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>gb|KJB45953.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=652

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G   GVR++VAGD  TGKSSLI+ AA E+FP +V  +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-PGVRIVVAGDRGTGKSSLIVTAAAETFPTNVLRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTS++PE+RG L EE+ RADA+VLTYACD+P TL+RLSTYWLPELR+LEVK PVIVVG
Sbjct  63   IIDTSANPEDRGKLAEELKRADALVLTYACDQPETLNRLSTYWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>gb|KHG06383.1| mitochondrial rho gtpase 1 [Gossypium arboreum]
Length=644

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G   GVR++VAGD  TGKSSLI+ AA E+FP +V  +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-PGVRIVVAGDRGTGKSSLIVTAAAETFPTNVLRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTS++PE+RG L EE+ RADA+VLTYACD+P TL+RLSTYWLPELR+LEVK PVIVVG
Sbjct  63   IIDTSANPEDRGKLAEELKRADALVLTYACDQPETLNRLSTYWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>gb|KJB45955.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=654

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G   GVR++VAGD  TGKSSLI+ AA E+FP +V  +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-PGVRIVVAGDRGTGKSSLIVTAAAETFPTNVLRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTS++PE+RG L EE+ RADA+VLTYACD+P TL+RLSTYWLPELR+LEVK PVIVVG
Sbjct  63   IIDTSANPEDRGKLAEELKRADALVLTYACDQPETLNRLSTYWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RDDQQ ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CKLDLRDDQQQVSLEQVMSPIMQQFREIETCIECSAY  159



>ref|XP_006433310.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006433311.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006433313.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006472005.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472006.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472007.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X3 [Citrus 
sinensis]
 gb|ESR46550.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 gb|ESR46551.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 gb|ESR46553.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
Length=649

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  114  MAGGGSSNAK-GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   ++N+  G  +GVR++V G+  TGKSSLI+ AA ++FPA+VPPVLPPTRLP+D +P
Sbjct  1    MAKASAANSGPGGKTGVRIVVCGEKGTGKSSLIVTAAADTFPANVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP+TIIDT SS E+RG L EE+ RADAVVLTYACD+P TLD LST+WLPELRRLEVK 
Sbjct  61   DRVPITIIDTPSSVEDRGKLGEELRRADAVVLTYACDRPETLDELSTFWLPELRRLEVKV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD+ Q ++LEQVM+PIMQQFREIETCIECSA
Sbjct  121  PVIVVGCKLDLRDENQQVSLEQVMMPIMQQFREIETCIECSA  162



>ref|XP_009760211.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana sylvestris]
Length=645

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
             VR++VAGD KTGKSSLIL AAT+S+P +VPPVLPPTRLPDDI+PDRVP+TIIDTSSSPE
Sbjct  15   SVRIVVAGDAKTGKSSLILTAATDSYPPNVPPVLPPTRLPDDIYPDRVPVTIIDTSSSPE  74

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
            NRG L EE+ RADAVVLTYACDKPATLDRLST+WLPELRRLEV+ PVIVVGCMLDKRD+Q
Sbjct  75   NRGKLVEELKRADAVVLTYACDKPATLDRLSTFWLPELRRLEVRVPVIVVGCMLDKRDEQ  134

Query  516  QAINLEQVMLPIMQQFREIETCIECSAY  599
              ++LEQVM PIMQQFREIETCIECSAY
Sbjct  135  IPVSLEQVMSPIMQQFREIETCIECSAY  162



>ref|XP_010043089.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 ref|XP_010043090.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 ref|XP_010043091.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 gb|KCW85148.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
 gb|KCW85149.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
 gb|KCW85150.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
Length=647

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G+  + G  +GVR++V GD  TGKSSLI  AAT+ FPA+VPPVLPPTRLP+D +PDR
Sbjct  4    AAAGAVPSAGK-AGVRIVVVGDRGTGKSSLICTAATDVFPANVPPVLPPTRLPEDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VPLTIIDTSS  E+ G L EE+ RADAVVLTYACD+PATLDRLST+WLPELRRLEVK PV
Sbjct  63   VPLTIIDTSSRVEDSGKLGEELRRADAVVLTYACDQPATLDRLSTFWLPELRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD R++ Q I+L+ VM PIMQQFREIETCIECSAY
Sbjct  123  IVVGCKLDLREEHQQISLDHVMTPIMQQFREIETCIECSAY  163



>gb|KCW85147.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
Length=642

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G+  + G  +GVR++V GD  TGKSSLI  AAT+ FPA+VPPVLPPTRLP+D +PDR
Sbjct  4    AAAGAVPSAGK-AGVRIVVVGDRGTGKSSLICTAATDVFPANVPPVLPPTRLPEDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VPLTIIDTSS  E+ G L EE+ RADAVVLTYACD+PATLDRLST+WLPELRRLEVK PV
Sbjct  63   VPLTIIDTSSRVEDSGKLGEELRRADAVVLTYACDQPATLDRLSTFWLPELRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD R++ Q I+L+ VM PIMQQFREIETCIECSAY
Sbjct  123  IVVGCKLDLREEHQQISLDHVMTPIMQQFREIETCIECSAY  163



>ref|XP_008388965.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=453

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + VR++VAGD  TGKSSLI+ AATE+FPA+VPPVLPPTRLP+D +P+RVP+TIIDTSS P
Sbjct  15   TAVRIVVAGDRGTGKSSLIVTAATENFPANVPPVLPPTRLPEDFYPERVPITIIDTSSRP  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+   + EE+ RADAVVLTYAC++P TLDRLST+WLP+LR+LEVK PVIVVGC LD RD+
Sbjct  75   EDTNKVAEELKRADAVVLTYACNQPQTLDRLSTFWLPKLRQLEVKVPVIVVGCKLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSAY  599
             Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSAY  163



>ref|XP_008355766.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1-like 
[Malus domestica]
Length=353

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G  + VR++VAGD  TGKSSLI+ AATE+FPA+VPPVLPPTRLP+D +P+RV
Sbjct  5    AAGNDHPVGQ-TAVRIVVAGDRGTGKSSLIVTAATENFPANVPPVLPPTRLPEDFYPERV  63

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+T+IDTSS  E+   + EE+ RADAVVLTYAC++P TLDRLST+WLP+LR+LEVK PVI
Sbjct  64   PITLIDTSSRAEDTNKVAEELKRADAVVLTYACNQPQTLDRLSTFWLPKLRQLEVKVPVI  123

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            VVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  124  VVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAY  163



>ref|XP_007030856.1| Mitochondrial Rho GTPase isoform 3 [Theobroma cacao]
 gb|EOY11358.1| Mitochondrial Rho GTPase isoform 3 [Theobroma cacao]
Length=453

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            S N +G  +GVR++VAGD  TGKSSLI+ AA ++F A+VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SLNPEGK-TGVRIVVAGDRGTGKSSLIVTAAADTFAANVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L  E+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  63   IIDTSSNPEDRGKLAAELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RD+ Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CRLDLRDELQQVSLEQVMSPIMQQFREIETCIECSAY  159



>gb|KDP23523.1| hypothetical protein JCGZ_23356 [Jatropha curcas]
Length=652

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  GS+N  G  +GVR++VAGD  TGKSSLI+ AA E+FP++VPPVLPPTRLP+D +PDR
Sbjct  4    AATGSANHGGK-TGVRIVVAGDRGTGKSSLIVTAAAETFPSNVPPVLPPTRLPEDFYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            +P+TIIDTSS  E+   + EE+ RADAVVLTYACDKP TLDRLS +WLP+LRRLEVK PV
Sbjct  63   IPVTIIDTSSRAEDSAKVAEELKRADAVVLTYACDKPETLDRLSNFWLPQLRRLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD RD+   ++LEQVM PIMQQFREIETCIECSA+
Sbjct  123  IVVGCKLDLRDENYQVSLEQVMSPIMQQFREIETCIECSAH  163



>ref|XP_002319545.2| hypothetical protein POPTR_0013s02400g [Populus trichocarpa]
 gb|EEE95468.2| hypothetical protein POPTR_0013s02400g [Populus trichocarpa]
Length=702

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  SGVR++VAGD  TGKSSLI+ A +++FP+S+PPVLPPTR+PDD +PDRVP+TIIDTS
Sbjct  11   GVKSGVRIVVAGDRGTGKSSLIVTAISDTFPSSIPPVLPPTRMPDDFYPDRVPITIIDTS  70

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S  E+ G + EE+ RADAVVLTYACD+P TLDRLST+WLPELR+LEVK PVIVVGC LD 
Sbjct  71   SKVEDAGKVAEELKRADAVVLTYACDRPETLDRLSTFWLPELRQLEVKVPVIVVGCKLDL  130

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  131  RDENQQVSLEQVMSPIMQQFREIETCIECSAF  162



>ref|XP_004247162.1| PREDICTED: mitochondrial Rho GTPase 1 [Solanum lycopersicum]
Length=643

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M GG  S+ + N   VRV+V GD  TGKSSLI AAA+E+F   VPPVLPPTRLP D++PD
Sbjct  1    MLGGSISSGRTN---VRVVVVGDRATGKSSLITAAASETFAEEVPPVLPPTRLPADLYPD  57

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             VP+TIIDTSSS E+RG + EE+ RADAVVLTYACD+P+TL+RL+T+WL E RRLE+K P
Sbjct  58   NVPVTIIDTSSSLESRGKVAEELKRADAVVLTYACDQPSTLNRLTTFWLYEFRRLEIKVP  117

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LDKRD++  +NLEQVM PIMQQFREIETCIECSA
Sbjct  118  VIVVGCKLDKRDEEHHMNLEQVMAPIMQQFREIETCIECSA  158



>ref|XP_011023599.1| PREDICTED: mitochondrial Rho GTPase 1-like [Populus euphratica]
 ref|XP_011023600.1| PREDICTED: mitochondrial Rho GTPase 1-like [Populus euphratica]
Length=651

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  S VR++VAGD  TGKSSLI+ A +++FP+S+PPVLPPTR+PDD +PDRVP+TIIDTS
Sbjct  11   GVKSSVRIVVAGDRGTGKSSLIVTAISDTFPSSIPPVLPPTRMPDDFYPDRVPITIIDTS  70

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S  E+ G + EE+ RADAVVLTYACD+P TLDRLST+WLPELR+LEVK PVIVVGC LD 
Sbjct  71   SKVEDAGKVAEELKRADAVVLTYACDRPETLDRLSTFWLPELRQLEVKVPVIVVGCKLDL  130

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  131  RDENQQVSLEQVMSPIMQQFREIETCIECSAF  162



>ref|XP_007030854.1| Mitochondrial Rho GTPase isoform 1 [Theobroma cacao]
 gb|EOY11356.1| Mitochondrial Rho GTPase isoform 1 [Theobroma cacao]
Length=644

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            S N +G  +GVR++VAGD  TGKSSLI+ AA ++F A+VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SLNPEGK-TGVRIVVAGDRGTGKSSLIVTAAADTFAANVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L  E+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  63   IIDTSSNPEDRGKLAAELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RD+ Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  123  CRLDLRDELQQVSLEQVMSPIMQQFREIETCIECSAY  159



>ref|XP_007030855.1| Mitochondrial Rho GTPase isoform 2, partial [Theobroma cacao]
 gb|EOY11357.1| Mitochondrial Rho GTPase isoform 2, partial [Theobroma cacao]
Length=642

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            S N +G  +GVR++VAGD  TGKSSLI+ AA ++F A+VP +LPPTRLP+D +PDRVP+T
Sbjct  2    SLNPEGK-TGVRIVVAGDRGTGKSSLIVTAAADTFAANVPRLLPPTRLPEDFYPDRVPIT  60

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L  E+ RADAVVLTYACD+P TL+RLST+WLPELR+LEVK PVIVVG
Sbjct  61   IIDTSSNPEDRGKLAAELKRADAVVLTYACDQPETLNRLSTFWLPELRQLEVKVPVIVVG  120

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            C LD RD+ Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  121  CRLDLRDELQQVSLEQVMSPIMQQFREIETCIECSAY  157



>gb|EPS65475.1| hypothetical protein M569_09302, partial [Genlisea aurea]
Length=381

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G    +R++VAGD KTGKSSLI+ AA E+FP++VPPVLPPTRLP+D++ DRVP+TIIDTS
Sbjct  1    GATQAIRIVVAGDAKTGKSSLIITAAAETFPSNVPPVLPPTRLPEDLYQDRVPITIIDTS  60

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLE-VKAPVIVVGCMLD  500
            SSPE RG LFEE+ RADAVVLTYAC++P TLD LSTYWLP+LR+LE V+ PVIVVGCMLD
Sbjct  61   SSPEKRGRLFEEVTRADAVVLTYACNRPETLDSLSTYWLPQLRKLEVVRVPVIVVGCMLD  120

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            KR DQ  I LEQVM PIMQQFREIETCIECSA
Sbjct  121  KRSDQNPIRLEQVMSPIMQQFREIETCIECSA  152



>ref|XP_008786917.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Phoenix 
dactylifera]
Length=634

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + VRV+V GDP TGKSSLI++ ATE+FP +VP V+PPTRLP D +PDRVP+TIIDTS
Sbjct  9    GGRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPHVMPPTRLPADYYPDRVPITIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEVK PVIVVGC LD 
Sbjct  69   SSPENKTKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQ+M PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-MSLEQIMSPIMQQFREIETCIECSA  158



>ref|XP_008790947.1| PREDICTED: mitochondrial Rho GTPase 1 [Phoenix dactylifera]
Length=641

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G+ + VRV+V GDP TGKSSLI++ ATE+FP +VP VLPPTRLP D +PDRVP TIIDTS
Sbjct  9    GSRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPDVLPPTRLPADYYPDRVPTTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEVK PVIVVGC LD 
Sbjct  69   SSPENKSKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM PIMQQFREIETCIECS+
Sbjct  129  RDEQQ-VSLEQVMSPIMQQFREIETCIECSS  158



>ref|XP_008786915.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Phoenix 
dactylifera]
Length=643

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + VRV+V GDP TGKSSLI++ ATE+FP +VP V+PPTRLP D +PDRVP+TIIDTS
Sbjct  9    GGRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPHVMPPTRLPADYYPDRVPITIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEVK PVIVVGC LD 
Sbjct  69   SSPENKTKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQ+M PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-MSLEQIMSPIMQQFREIETCIECSA  158



>ref|XP_010931978.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Elaeis 
guineensis]
Length=634

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + VRV+V GDP TGKSSLI++ ATE+FP +VP V+PPTRLP D +PDRVP+TIIDTS
Sbjct  9    GGRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPHVMPPTRLPADYYPDRVPVTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLE+K PVIVVGC LD 
Sbjct  69   SSPENKTKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEIKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-MSLEQVMSPIMQQFREIETCIECSA  158



>ref|XP_010524876.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=648

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 5/160 (3%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            AGGG S A      VR++VAG+  TGKSSLI+AAAT++FP +VPPVLP T+LP D FPDR
Sbjct  6    AGGGGSPA-----SVRIVVAGEKGTGKSSLIVAAATDTFPPNVPPVLPDTKLPSDFFPDR  60

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            +P+TI+DTSS PE+RG L +E+ +ADAVVLTYAC++P TLDRLS YWLPELR+LEV  PV
Sbjct  61   IPITIVDTSSRPEDRGKLAKELKQADAVVLTYACNRPETLDRLSEYWLPELRQLEVNVPV  120

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IV GC LD RDD+  +NLEQVM PIMQQFREIETCIECSA
Sbjct  121  IVAGCKLDLRDDKYQVNLEQVMSPIMQQFREIETCIECSA  160



>ref|XP_008364027.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=584

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + VR++VAGD  TGKSSLI+ AATE+FPA+VPPVLPPTRLP+D +P+RVP+T+IDTSS  
Sbjct  92   TAVRIVVAGDRGTGKSSLIVTAATENFPANVPPVLPPTRLPEDFYPERVPITLIDTSSRA  151

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+   + EE+ RADAVVLTYAC++P TLDRLST+WLP+LR+LEVK PVIVVGC LD RD+
Sbjct  152  EDTNKVAEELKRADAVVLTYACNQPQTLDRLSTFWLPKLRQLEVKVPVIVVGCKLDLRDE  211

Query  513  QQAINLEQVMLPIMQQFREIETCIECSAY  599
             Q ++LEQVM PIMQQFREIETCIECSAY
Sbjct  212  NQQVSLEQVMSPIMQQFREIETCIECSAY  240



>ref|XP_010931977.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + VRV+V GDP TGKSSLI++ ATE+FP +VP V+PPTRLP D +PDRVP+TIIDTS
Sbjct  9    GGRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPHVMPPTRLPADYYPDRVPVTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLE+K PVIVVGC LD 
Sbjct  69   SSPENKTKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEIKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-MSLEQVMSPIMQQFREIETCIECSA  158



>tpg|DAA52127.1| TPA: hypothetical protein ZEAMMB73_406369 [Zea mays]
Length=372

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            S VRV+V GDP TGKSSLI+A ATE FP +VP V+PPTRLP D FPDRVP+TIIDTSSSP
Sbjct  17   SSVRVVVIGDPGTGKSSLIVALATEQFPENVPRVMPPTRLPADYFPDRVPITIIDTSSSP  76

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++KAPVIVVGC LD RD+
Sbjct  77   EQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQLKAPVIVVGCKLDLRDE  136

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  137  QQ-VSLEQVMAPIMQSFREIETCIECSA  163



>gb|KDP21466.1| hypothetical protein JCGZ_21937 [Jatropha curcas]
Length=643

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            MAGG +  A G  +GVR++VAGD  TGKSSLI A AT+SFP +VP VL PTRLP D FPD
Sbjct  1    MAGGNT--ASGGRTGVRIVVAGDRFTGKSSLIAAVATDSFPENVPRVLSPTRLPADFFPD  58

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVP+TIIDTSS+PENRG L +E+ RADAVVLTYACD+P TL RLS+ WL ELR+LE+KAP
Sbjct  59   RVPITIIDTSSAPENRGKLIDELKRADAVVLTYACDQPLTLSRLSSTWLEELRQLEIKAP  118

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +IVVGC LD R D +A++LEQVM P MQ++REIETCIECSA
Sbjct  119  IIVVGCKLDLRPDSEAVSLEQVMGPTMQRYREIETCIECSA  159



>ref|XP_002306771.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE93767.1| GTP-binding family protein [Populus trichocarpa]
Length=645

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
            GG+S A G  +GVR++V GD  TGKSSLI AAATESFP ++ PVLPPTRLP D FPDRVP
Sbjct  3    GGNSAAAGGKTGVRIVVVGDRGTGKSSLIAAAATESFPENLSPVLPPTRLPADFFPDRVP  62

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TIIDTS+S E+RG L EE+ RAD ++LTYACD P TL RLS++WL E RRLEVK PVIV
Sbjct  63   ITIIDTSASLESRGKLNEELKRADVIILTYACDFPLTLTRLSSFWLQEFRRLEVKVPVIV  122

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC +D RD+ Q I+LE VM PIMQQ+REIETCIECSA
Sbjct  123  VGCKVDLRDENQPISLEPVMGPIMQQYREIETCIECSA  160



>gb|EAZ29014.1| hypothetical protein OsJ_13062 [Oryza sativa Japonica Group]
Length=609

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
             GVRV+V GDP TGKSSL+++ ATE+FP +VP V+PPTRLP D FPDRVP+TI+DTSSSP
Sbjct  14   QGVRVVVIGDPGTGKSSLVVSVATEAFPENVPRVMPPTRLPADYFPDRVPITIVDTSSSP  73

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+R  L  E   ADAVVLTYACD+PATL+RLST+WLPELRRL++KAPVIVVGC LD RD+
Sbjct  74   EHRAKLIAECQAADAVVLTYACDRPATLERLSTFWLPELRRLQLKAPVIVVGCKLDLRDE  133

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  134  QQ-VSLEQVMAPIMQTFREIETCIECSA  160



>ref|NP_001051665.1| Os03g0810600 [Oryza sativa Japonica Group]
 gb|AAT77915.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99485.1| small GTP-binding protein domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13579.1| Os03g0810600 [Oryza sativa Japonica Group]
 gb|EAY92295.1| hypothetical protein OsI_14016 [Oryza sativa Indica Group]
 dbj|BAG95295.1| unnamed protein product [Oryza sativa Japonica Group]
Length=642

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
             GVRV+V GDP TGKSSL+++ ATE+FP +VP V+PPTRLP D FPDRVP+TI+DTSSSP
Sbjct  14   QGVRVVVIGDPGTGKSSLVVSVATEAFPENVPRVMPPTRLPADYFPDRVPITIVDTSSSP  73

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+R  L  E   ADAVVLTYACD+PATL+RLST+WLPELRRL++KAPVIVVGC LD RD+
Sbjct  74   EHRAKLIAECQAADAVVLTYACDRPATLERLSTFWLPELRRLQLKAPVIVVGCKLDLRDE  133

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  134  QQ-VSLEQVMAPIMQTFREIETCIECSA  160



>ref|XP_009385505.1| PREDICTED: mitochondrial Rho GTPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=647

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + VRV+V G+  TGKSSLI+A ATESFP +VP V+PPTRLP D +PDRVPLTIIDTSS P
Sbjct  16   TSVRVVVMGETGTGKSSLIVAVATESFPENVPHVIPPTRLPADYYPDRVPLTIIDTSSRP  75

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            EN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLE K PVIVVGC LD RD+
Sbjct  76   ENKAKLIAECKSADAIVLTYACDRPSTLDRLSTYWLPELRRLEAKVPVIVVGCKLDLRDE  135

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQQ+REIETCIECSA
Sbjct  136  QQ-VSLEQVMSPIMQQYREIETCIECSA  162



>gb|AFW67245.1| hypothetical protein ZEAMMB73_549387 [Zea mays]
Length=647

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 132/164 (80%), Gaps = 4/164 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNI---SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDI  284
            MA   S     N+   SGVRV+V GDP TGKSSLI+A ATE FP +VP V+PPTRLP D 
Sbjct  1    MASATSPAMAANLAGKSGVRVVVIGDPGTGKSSLIVALATEQFPENVPRVMPPTRLPADY  60

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEV  464
            FPDRVP+TIIDTSSSPE +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++
Sbjct  61   FPDRVPITIIDTSSSPEQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQL  120

Query  465  KAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            KAPVIVVGC LD RD+QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  121  KAPVIVVGCKLDLRDEQQ-VSLEQVMAPIMQSFREIETCIECSA  163



>ref|XP_006841409.1| hypothetical protein AMTR_s00003p00020850 [Amborella trichopoda]
 gb|ERN03084.1| hypothetical protein AMTR_s00003p00020850 [Amborella trichopoda]
Length=646

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            MAG   +   G+ + VRV+V GDP TGKSSLI + ATESFP SVPP+LPPTRLP D +PD
Sbjct  1    MAGAPGNVNFGSRNSVRVVVIGDPGTGKSSLIASVATESFPESVPPMLPPTRLPVDFYPD  60

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVPL IIDTSS PE+R  L  E   ADAVVLTYACD+P+TLDRLST+WLPELR L+V  P
Sbjct  61   RVPLVIIDTSSRPEDRSRLASECRLADAVVLTYACDEPSTLDRLSTFWLPELRSLDVNVP  120

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RDDQQ ++LE+VM PIMQQFREIETCIECSA
Sbjct  121  VIVVGCKLDLRDDQQ-LSLEEVMSPIMQQFREIETCIECSA  160



>ref|XP_008643395.1| PREDICTED: uncharacterized protein LOC100278140 isoform X1 [Zea 
mays]
Length=652

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 132/164 (80%), Gaps = 4/164 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNI---SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDI  284
            MA   S     N+   SGVRV+V GDP TGKSSLI+A ATE FP +VP V+PPTRLP D 
Sbjct  1    MASATSPAMAANLAGKSGVRVVVIGDPGTGKSSLIVALATEQFPENVPRVMPPTRLPADY  60

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEV  464
            FPDRVP+TIIDTSSSPE +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++
Sbjct  61   FPDRVPITIIDTSSSPEQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQL  120

Query  465  KAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            KAPVIVVGC LD RD+QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  121  KAPVIVVGCKLDLRDEQQ-VSLEQVMAPIMQSFREIETCIECSA  163



>ref|XP_010546687.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010546688.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=649

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            +  G S   G+ + VR++VAG+  TGKSSLI+AAAT++FP +VPPVLP TRLP + F +R
Sbjct  4    SSAGGSGIPGSPTAVRIVVAGEKGTGKSSLIVAAATDTFPPNVPPVLPDTRLPPEFFAER  63

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            +P+TI+DTSS PE+RG L EE+  ADAVVLTYACD+P TLDRLS YWLPELR+LEVK P+
Sbjct  64   IPITIVDTSSRPEDRGKLAEELKLADAVVLTYACDRPETLDRLSEYWLPELRQLEVKVPI  123

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IV GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  124  IVAGCKLDMRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_010550971.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550972.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550973.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550974.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=649

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            AGGG     G+ + VR++VAG+  TGKSSLI+AAAT++FP +VPPVLP T+LP + FPDR
Sbjct  6    AGGG--GIPGSPTAVRIVVAGEKGTGKSSLIVAAATDTFPPNVPPVLPDTKLPPEFFPDR  63

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            +P+TI+DTSS  E+RG L EE+ +ADAVVLTYACD+P TLDRLS YWLPELR+LEVK P+
Sbjct  64   IPITIVDTSSRREDRGKLAEELKQADAVVLTYACDRPETLDRLSEYWLPELRQLEVKVPI  123

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IV GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  124  IVAGCKLDLRDDTNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_009385504.1| PREDICTED: mitochondrial Rho GTPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=648

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + VRV V G+  TGKSSLI+A ATESFP +VP V+PPTRLP D +PDRVPLTIIDTSS P
Sbjct  17   TSVRVAVMGEGGTGKSSLIVAVATESFPENVPHVMPPTRLPADYYPDRVPLTIIDTSSRP  76

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            EN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEVK PVIVVGC LD RD+
Sbjct  77   ENKAKLIAECKAADAIVLTYACDRPSTLDRLSTYWLPELRRLEVKVPVIVVGCKLDLRDE  136

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQQ+REIETCIECSA
Sbjct  137  QQ-VSLEQVMSPIMQQYREIETCIECSA  163



>ref|XP_004981322.1| PREDICTED: mitochondrial Rho GTPase 1-like [Setaria italica]
Length=647

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            SGVRV+V GDP TGKSSLI+A ATE FP +VP V+PPTRLP D FPDRVP+TIIDTSSSP
Sbjct  17   SGVRVVVIGDPGTGKSSLIVALATEQFPENVPKVMPPTRLPADFFPDRVPITIIDTSSSP  76

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++K PVIVVGC LD RD+
Sbjct  77   EQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQLKTPVIVVGCKLDLRDE  136

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  137  QQ-VSLEQVMAPIMQSFREIETCIECSA  163



>ref|XP_011032724.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X3 [Populus euphratica]
Length=645

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
            GG+S A G  +GVR++V GD  TGKSSLI AAATES P ++ PVLPPTRLP D FPDRVP
Sbjct  3    GGNSAAAGGKTGVRIVVVGDHGTGKSSLIAAAATESVPENLSPVLPPTRLPADFFPDRVP  62

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TIIDTS+S E+RG L EE+ RAD ++LTYACD P TL RLS++WL E RRLEVK PVIV
Sbjct  63   ITIIDTSASLESRGKLNEELKRADVIILTYACDFPLTLTRLSSFWLQEFRRLEVKVPVIV  122

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC +D RD+ Q I+LE VM PIMQQ+REIETCIECSA
Sbjct  123  VGCKVDLRDENQPISLEPVMGPIMQQYREIETCIECSA  160



>ref|XP_011032722.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X2 [Populus euphratica]
Length=647

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
            GG+S A G  +GVR++V GD  TGKSSLI AAATES P ++ PVLPPTRLP D FPDRVP
Sbjct  3    GGNSAAAGGKTGVRIVVVGDHGTGKSSLIAAAATESVPENLSPVLPPTRLPADFFPDRVP  62

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TIIDTS+S E+RG L EE+ RAD ++LTYACD P TL RLS++WL E RRLEVK PVIV
Sbjct  63   ITIIDTSASLESRGKLNEELKRADVIILTYACDFPLTLTRLSSFWLQEFRRLEVKVPVIV  122

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC +D RD+ Q I+LE VM PIMQQ+REIETCIECSA
Sbjct  123  VGCKVDLRDENQPISLEPVMGPIMQQYREIETCIECSA  160



>ref|XP_011032721.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X1 [Populus euphratica]
Length=649

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
            GG+S A G  +GVR++V GD  TGKSSLI AAATES P ++ PVLPPTRLP D FPDRVP
Sbjct  3    GGNSAAAGGKTGVRIVVVGDHGTGKSSLIAAAATESVPENLSPVLPPTRLPADFFPDRVP  62

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TIIDTS+S E+RG L EE+ RAD ++LTYACD P TL RLS++WL E RRLEVK PVIV
Sbjct  63   ITIIDTSASLESRGKLNEELKRADVIILTYACDFPLTLTRLSSFWLQEFRRLEVKVPVIV  122

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC +D RD+ Q I+LE VM PIMQQ+REIETCIECSA
Sbjct  123  VGCKVDLRDENQPISLEPVMGPIMQQYREIETCIECSA  160



>ref|XP_010456750.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=603

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G+ +  G+   VR++V GD  TGKSSLI+AAAT++F  +VPPVLP T+LP + FPD +P
Sbjct  6    AGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDAFSPNVPPVLPDTKLPAEFFPDNIP  65

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TLDRLS YWLPELRRLEVK P+IV
Sbjct  66   VTIVDTSSKPEDRDMVAEELKRADAVVLTYACDRPETLDRLSEYWLPELRRLEVKIPIIV  125

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  126  AGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_008665658.1| PREDICTED: mitochondrial Rho GTPase 1-like [Zea mays]
 tpg|DAA52126.1| TPA: hypothetical protein ZEAMMB73_406369 [Zea mays]
Length=647

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            S VRV+V GDP TGKSSLI+A ATE FP +VP V+PPTRLP D FPDRVP+TIIDTSSSP
Sbjct  17   SSVRVVVIGDPGTGKSSLIVALATEQFPENVPRVMPPTRLPADYFPDRVPITIIDTSSSP  76

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++KAPVIVVGC LD RD+
Sbjct  77   EQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQLKAPVIVVGCKLDLRDE  136

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  137  QQ-VSLEQVMAPIMQSFREIETCIECSA  163



>ref|NP_001144985.1| uncharacterized protein LOC100278140 [Zea mays]
 gb|ACG44216.1| hypothetical protein [Zea mays]
Length=647

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 131/164 (80%), Gaps = 4/164 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNI---SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDI  284
            MA   S     N+   SGVRV+V GDP TGKSSLI+A ATE FP +V  V+PPTRLP D 
Sbjct  1    MASATSPAMAANLAGKSGVRVVVIGDPGTGKSSLIVALATEQFPENVLRVMPPTRLPADY  60

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEV  464
            FPDRVP+TIIDTSSSPE +  L  E   ADAVVLTYACD+PATL+RLS++WLPELRRL++
Sbjct  61   FPDRVPITIIDTSSSPEQKPKLIAECQAADAVVLTYACDRPATLERLSSFWLPELRRLQL  120

Query  465  KAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            KAPVIVVGC LD RD+QQ ++LEQVM PIMQ FREIETCIECSA
Sbjct  121  KAPVIVVGCKLDLRDEQQ-VSLEQVMAPIMQSFREIETCIECSA  163



>ref|XP_006287226.1| hypothetical protein CARUB_v10000404mg, partial [Capsella rubella]
 gb|EOA20124.1| hypothetical protein CARUB_v10000404mg, partial [Capsella rubella]
Length=664

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 133/175 (76%), Gaps = 6/175 (3%)
 Frame = +3

Query  72   LGFTYKFIRSRGELMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPP  251
            L F+++  R         G+ +  G+   VR++V GD  TGKSSLI+AAAT+ FP +VPP
Sbjct  10   LFFSFQMAR------YSAGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDIFPPNVPP  63

Query  252  VLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLST  431
            VLP T+LP + FPD +P+TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TL+RLS 
Sbjct  64   VLPDTKLPVEFFPDNIPVTIVDTSSRPEDRDMVAEELKRADAVVLTYACDRPETLERLSE  123

Query  432  YWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            YWLPELRRLEVK P+IV GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  124  YWLPELRRLEVKIPIIVAGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  178



>ref|XP_010535310.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=177

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV+VAGD  TGKSSLI A A+++FP +VP VLPPT LP D + D +P+TIIDT SS +N
Sbjct  17   IRVVVAGDKGTGKSSLISALASDTFPDNVPRVLPPTTLPADFYSDLIPITIIDTPSSIDN  76

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE  +ADAVVLTYACD+P TLDRL++YWLPELRRLE+KAPVIVVGC LD RD++ 
Sbjct  77   RIKLIEEFRKADAVVLTYACDQPGTLDRLTSYWLPELRRLEIKAPVIVVGCKLDLRDERH  136

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             ++LEQ+M PIMQ++REIETCIECSA
Sbjct  137  PVSLEQIMAPIMQEYREIETCIECSA  162



>ref|XP_010421600.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
 ref|XP_010421601.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G+ +  G+   VR++V GD  TGKSSLI+AAAT+ F  +VPPVLP T+LP + FPD +P
Sbjct  6    AGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDVFSPNVPPVLPDTKLPAEFFPDNIP  65

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TLDRLS YWLPELRRLEVK P+IV
Sbjct  66   VTIVDTSSKPEDRDMVAEELKRADAVVLTYACDRPETLDRLSEYWLPELRRLEVKIPIIV  125

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  126  AGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_006287227.1| hypothetical protein CARUB_v10000404mg [Capsella rubella]
 gb|EOA20125.1| hypothetical protein CARUB_v10000404mg [Capsella rubella]
Length=649

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G+ +  G+   VR++V GD  TGKSSLI+AAAT+ FP +VPPVLP T+LP + FPD +P
Sbjct  6    AGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDIFPPNVPPVLPDTKLPVEFFPDNIP  65

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TL+RLS YWLPELRRLEVK P+IV
Sbjct  66   VTIVDTSSRPEDRDMVAEELKRADAVVLTYACDRPETLERLSEYWLPELRRLEVKIPIIV  125

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  126  AGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|NP_198106.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 ref|NP_001031953.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 sp|Q8RXF8.1|MIRO1_ARATH RecName: Full=Mitochondrial Rho GTPase 1; Short=AtMIRO1; AltName: 
Full=Miro-related GTPase 1 [Arabidopsis thaliana]
 gb|AAL91169.1| unknown protein [Arabidopsis thaliana]
 gb|AAO29970.1| unknown protein [Arabidopsis thaliana]
 gb|AED93698.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 gb|AED93699.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
Length=648

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G+   VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP  +LP + FPD +
Sbjct  5    AAGAVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDYKLPIEFFPDGI  64

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TL+RLS YWLPELRRLEVK P+I
Sbjct  65   PVTIVDTSSRPEDRDIVAEELKRADAVVLTYACDRPETLERLSEYWLPELRRLEVKIPII  124

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            V GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  125  VAGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_009129866.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
 ref|XP_009129867.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=645

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G++  VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP + FPD +P+TI+DTS
Sbjct  10   GSLKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFEFFPDGIPVTIVDTS  69

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S PE+R  + EE+ +ADAVVLTYACD+P TL+ L+TYWLPELRRLEVK P+IV GC LD 
Sbjct  70   SRPEDRNMVAEELKQADAVVLTYACDRPETLEGLTTYWLPELRRLEVKVPIIVAGCKLDF  129

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  130  RDDNNQVSLEQVMSPIMQQFREIETCIECSA  160



>emb|CDY05572.1| BnaA02g31190D [Brassica napus]
Length=645

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G++  VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP + FPD +P+TI+DTS
Sbjct  10   GSLKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFEFFPDGIPVTIVDTS  69

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S PE+R  + EE+ +ADAVVLTYACD+P TL+ L+TYWLPELRRLEVK P+IV GC LD 
Sbjct  70   SRPEDRNMVAEELKQADAVVLTYACDRPETLEGLTTYWLPELRRLEVKVPIIVAGCKLDF  129

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  130  RDDNNQVSLEQVMSPIMQQFREIETCIECSA  160



>ref|XP_006361849.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Solanum 
tuberosum]
Length=645

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD KTGKSSLIL AAT+++P +VPPVLPPTRLPDDI+PD+VP+TIIDTSSSPEN
Sbjct  16   VRIVVAGDAKTGKSSLILTAATDTYPPNVPPVLPPTRLPDDIYPDKVPVTIIDTSSSPEN  75

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            RG L EE+ +ADAVVLTYACDKPATLDRLST+WLPELRRLEV+ PV+VVGCMLDKRD+Q 
Sbjct  76   RGKLVEELKKADAVVLTYACDKPATLDRLSTFWLPELRRLEVRVPVVVVGCMLDKRDEQY  135

Query  519  AINLEQVMLPIMQQFREIETCIECSAY  599
             ++LEQVM PIMQQFREIETCIECSA+
Sbjct  136  PVSLEQVMSPIMQQFREIETCIECSAF  162



>ref|XP_004230188.1| PREDICTED: mitochondrial Rho GTPase 1 [Solanum lycopersicum]
Length=645

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD KTGKSSLIL AAT+++P +VPPVLPPTRLPDDI+PD+VP+TIIDTSSSPEN
Sbjct  16   VRIVVAGDAKTGKSSLILTAATDTYPPNVPPVLPPTRLPDDIYPDKVPVTIIDTSSSPEN  75

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            RG L EE+ +ADAVVLTYACDKPATLDRLST+WLPELRRLEV+ PV+VVGCMLDKRD+Q 
Sbjct  76   RGKLVEELKKADAVVLTYACDKPATLDRLSTFWLPELRRLEVRVPVVVVGCMLDKRDEQY  135

Query  519  AINLEQVMLPIMQQFREIETCIECSAY  599
             ++LEQVM PIMQQFREIETCIECSA+
Sbjct  136  PVSLEQVMSPIMQQFREIETCIECSAF  162



>ref|XP_002874365.1| EMB2473 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50624.1| EMB2473 [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G+   VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP  +LP + FPD +
Sbjct  5    AAGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDYKLPVEFFPDGI  64

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TL+RLS YWLPELRRLEVK P+I
Sbjct  65   PVTIVDTSSRPEDRDMVAEELKRADAVVLTYACDRPETLERLSEYWLPELRRLEVKIPII  124

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            V GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  125  VAGCRLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_010494001.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G+ +  G+   VR++V GD  TGKSSLI+AAAT++F  +VPPVLP  +LP + FPD +P
Sbjct  6    AGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDAFSPNVPPVLPDYKLPAEFFPDNIP  65

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TI+DTSS PE+R  + EE+ RADAVVLTYACD+P TLDRLS YWLPELRRLEVK P+IV
Sbjct  66   VTIVDTSSKPEDRDMVAEELKRADAVVLTYACDRPETLDRLSEYWLPELRRLEVKIPIIV  125

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  126  AGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>ref|XP_003556505.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
Length=646

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G+ N     +GVR++VAGD  TGKSSLI+ AA ++FP +V PVLPPTRLP+D++PDR
Sbjct  4    ATSGTVNPHSR-TGVRIVVAGDQGTGKSSLIITAAADNFPVNVLPVLPPTRLPEDLYPDR  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSS  E+   + EE+ RAD VVLTYACD+P TL+ LS +WLP LR+LEVK PV
Sbjct  63   VPITIIDTSSRAEDSDKVAEELQRADTVVLTYACDRPETLENLSIFWLPHLRKLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  123  IVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_010908350.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G+ + VRV+V GD  TGKSSLI++ ATE FP +VP V+PPTRLP D +PD VP TIIDTS
Sbjct  9    GSRTSVRVVVIGDSGTGKSSLIVSVATEIFPENVPDVMPPTRLPADYYPDCVPTTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEV+ PVIVVGC LD 
Sbjct  69   SSLENKSKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVRVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-VSLEQVMSPIMQQFREIETCIECSA  158



>emb|CDY25032.1| BnaC02g39760D [Brassica napus]
Length=645

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G++  VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP + FPD +P+TI+DTS
Sbjct  10   GSLKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFEFFPDGIPVTIVDTS  69

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S  E+R  + EE+ +ADAVVLTYACD+P TL+ L+TYWLPELRRLEVK P+IV GC LD 
Sbjct  70   SRQEDRNMVAEELKQADAVVLTYACDRPETLEGLTTYWLPELRRLEVKVPIIVAGCKLDF  129

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  130  RDDNNQVSLEQVMSPIMQQFREIETCIECSA  160



>ref|XP_010908349.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Elaeis 
guineensis]
Length=669

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G+ + VRV+V GD  TGKSSLI++ ATE FP +VP V+PPTRLP D +PD VP TIIDTS
Sbjct  9    GSRTSVRVVVIGDSGTGKSSLIVSVATEIFPENVPDVMPPTRLPADYYPDCVPTTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEV+ PVIVVGC LD 
Sbjct  69   SSLENKSKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVRVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM PIMQQFREIETCIECSA
Sbjct  129  RDEQQ-VSLEQVMSPIMQQFREIETCIECSA  158



>ref|XP_006394958.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394959.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394960.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394961.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32244.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32245.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32246.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32247.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
Length=650

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G+ +  G+   VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP + FPD +P
Sbjct  6    AGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFEFFPDGIP  65

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            +TI+DTSS  E+R  + EE+  ADAVVLTYACD+P TL+ LSTYWLPELRRLEVK P+IV
Sbjct  66   VTIVDTSSRVEDRDKVAEELKHADAVVLTYACDRPETLEGLSTYWLPELRRLEVKVPIIV  125

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  126  AGCKLDFRDDNNQVSLEQVMSPIMQQFREIETCIECSA  163



>dbj|BAJ85941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            GVRV+V GDP TGKSSL++A ATE FP +VP V+P TRLP D FPDRVP+TI+DTSSSPE
Sbjct  13   GVRVVVIGDPGTGKSSLVVAVATEQFPENVPKVMPHTRLPADYFPDRVPITIVDTSSSPE  72

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
             +  L  E   ADAVVLTYACD+ +TLDRLS+YWLPELRR+++KAPVIVVGC LD RDDQ
Sbjct  73   QKPKLIAECQAADAVVLTYACDRLSTLDRLSSYWLPELRRIQLKAPVIVVGCKLDLRDDQ  132

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
            Q  +LEQ M PIMQ FREIETCIECSA
Sbjct  133  QN-SLEQTMAPIMQSFREIETCIECSA  158



>ref|XP_003563951.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brachypodium distachyon]
Length=643

 Score =   219 bits (558),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            GVRV+V GD  TGKSSL++A ATE FP +VP ++PPTRLP D FPDRVP+TIIDTSSSPE
Sbjct  14   GVRVVVIGDQGTGKSSLVVAVATEQFPENVPKIMPPTRLPADYFPDRVPITIIDTSSSPE  73

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
             +  L  E   ADAVVLTYACD+ +TLDRLS+YWLPELRR+++KAPVIVVGC LD RDDQ
Sbjct  74   QKPKLIAECQAADAVVLTYACDRLSTLDRLSSYWLPELRRIQLKAPVIVVGCKLDLRDDQ  133

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
            Q  +LEQ M PIMQ FREIETCIECSA
Sbjct  134  QN-SLEQTMAPIMQSFREIETCIECSA  159



>ref|XP_006382604.1| hypothetical protein POPTR_0005s03670g [Populus trichocarpa]
 gb|ERP60401.1| hypothetical protein POPTR_0005s03670g [Populus trichocarpa]
Length=651

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            MA   ++   G  SGVR++VAGD  TGKSSLI+ A +E+FP+SVPPVLPPTR+PDD +PD
Sbjct  1    MAKAATTANPGVKSGVRIVVAGDRGTGKSSLIVTAISETFPSSVPPVLPPTRMPDDFYPD  60

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVP+TIIDTSS  E+ G + EE+ RADAVVLTYACD+P TLDRLST+WLPELR+LEVK P
Sbjct  61   RVPITIIDTSSKVEDAGKVAEELKRADAVVLTYACDRPETLDRLSTFWLPELRQLEVKVP  120

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            VIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  VIVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAF  162



>ref|XP_009787210.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana sylvestris]
Length=643

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M GG  S  + N   VRV+V GD  TGKSSLI AAATE+FP  VPPVLPPTRLP D++PD
Sbjct  1    MLGGSISGGRTN---VRVVVVGDRATGKSSLITAAATETFPEEVPPVLPPTRLPADLYPD  57

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             VP+TIIDTSSS E+RG + EE+ RADAVVLTYACD+P+TL+RL+T+WL E RRLE+K P
Sbjct  58   NVPVTIIDTSSSLESRGKVAEELKRADAVVLTYACDQPSTLNRLTTFWLYEFRRLEIKVP  117

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LDKRD++  +NLEQVM PIMQQFREIETCIECSA
Sbjct  118  VIVVGCKLDKRDEEHHMNLEQVMAPIMQQFREIETCIECSA  158



>ref|XP_006402304.1| hypothetical protein EUTSA_v10005831mg [Eutrema salsugineum]
 gb|ESQ43757.1| hypothetical protein EUTSA_v10005831mg [Eutrema salsugineum]
Length=645

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G G  ++ G    +RV VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D +P
Sbjct  1    MLGGFGGKSSAGGRKSLRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TIIDT SS +NR  L EE  +AD V+LTYACD+PATLDRLS+YWLPELRRLE+KA
Sbjct  61   DHIPITIIDTPSSIDNRIKLIEEFRKADVVILTYACDQPATLDRLSSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++   NLE +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERSPANLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_006349667.1| PREDICTED: mitochondrial Rho GTPase 1-like [Solanum tuberosum]
Length=643

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M GG  S  + N   VRV+V GD  TGKSSLI AAA+E+FP  VPPVLPPTRLP D++PD
Sbjct  1    MLGGSISGGRTN---VRVVVVGDRATGKSSLITAAASETFPEEVPPVLPPTRLPADLYPD  57

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             VP+TIIDTSSS E+RG + EE+ RADAVVLTYACD+P+TL+RL+T+WL E RRLE+K P
Sbjct  58   NVPVTIIDTSSSLESRGKVAEELKRADAVVLTYACDQPSTLNRLTTFWLYEFRRLEIKVP  117

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LDKRD++  +NLEQVM PIMQQFREIETCIECSA
Sbjct  118  VIVVGCKLDKRDEEHHMNLEQVMAPIMQQFREIETCIECSA  158



>ref|XP_009631945.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana tomentosiformis]
Length=643

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
             S+  G  + VRV+V GD  TGKSSLI AAATE+FP  VPPVLPPTRLP D++PD VP+T
Sbjct  3    GSSISGGRTNVRVVVVGDRATGKSSLITAAATETFPEEVPPVLPPTRLPADLYPDNVPVT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSSS E+RG + EE+ RADAVVLTYACD+P+TL+RL+T+WL E RRLE+K PVIVVG
Sbjct  63   IIDTSSSLESRGKVAEELKRADAVVLTYACDQPSTLNRLTTFWLYEFRRLEIKVPVIVVG  122

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            C LDKRD++  +NLEQVM PIMQQFREIETCIECSA
Sbjct  123  CKLDKRDEEHHMNLEQVMAPIMQQFREIETCIECSA  158



>ref|XP_008786933.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1-like, 
partial [Phoenix dactylifera]
Length=464

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 123/151 (81%), Gaps = 6/151 (4%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G+ + VRV+V GDP TGKSSLI++ ATE+FP +VP VLPPTRLP D +PDRVP TIIDTS
Sbjct  9    GSRTSVRVVVIGDPGTGKSSLIVSVATETFPENVPDVLPPTRLPADYYPDRVPTTIIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SSPEN+  L  E   ADA+VLTYACD+P+TLDRLSTYWLPELRRLEVK PVIVVGC LD 
Sbjct  69   SSPENKSKLISECQMADAIVLTYACDRPSTLDRLSTYWLPELRRLEVKVPVIVVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+QQ ++LEQVM P      EIETCIECSA
Sbjct  129  RDEQQ-VSLEQVMSPX-----EIETCIECSA  153



>ref|XP_008235402.1| PREDICTED: mitochondrial Rho GTPase 1 [Prunus mume]
Length=636

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAGD  TGKS+LI A ATE+F  +VPPVLPPTRLP D++ D VPLT+IDTS
Sbjct  9    GKRTGVRVVVAGDRGTGKSTLISAVATEAFDRNVPPVLPPTRLPADLYNDLVPLTVIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VVLTYACD+P TL RLSTYWLPELR L VK PVI+VGC LD 
Sbjct  69   SSLENSSKRNEELKRADVVVLTYACDQPMTLSRLSTYWLPELRHLGVKVPVILVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +D+Q  +++EQVM PIMQQFREIETCIECSA
Sbjct  129  QDEQAPMSMEQVMSPIMQQFREIETCIECSA  159



>gb|KJB23093.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=507

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA+++FP  VP VLPPTRLP D +PD VP+TI+DTSSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDAFPEYVPAVLPPTRLPSDFYPDGVPVTIVDTSSSMESRIKLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLS++WLPELR+LE+KAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSSFWLPELRKLEIKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>ref|XP_007199739.1| hypothetical protein PRUPE_ppa002696mg [Prunus persica]
 gb|EMJ00938.1| hypothetical protein PRUPE_ppa002696mg [Prunus persica]
Length=644

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAGD  TGKS+LI A ATE+F  +VPPVLPPTRLP D++ D VPLT+IDTS
Sbjct  9    GKRTGVRVVVAGDRGTGKSTLISAVATEAFDRNVPPVLPPTRLPADLYNDLVPLTVIDTS  68

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VVLTYACD+P TL RLSTYWLPELR L VK PVI+VGC LD 
Sbjct  69   SSLENSSKRNEELKRADVVVLTYACDQPMTLSRLSTYWLPELRHLGVKVPVILVGCKLDL  128

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +D+Q  +++EQVM PIMQQFREIETCIECSA
Sbjct  129  QDEQAPMSMEQVMSPIMQQFREIETCIECSA  159



>gb|KFK35452.1| hypothetical protein AALP_AA5G286100 [Arabis alpina]
Length=645

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G G  ++ G    +R+ VAG+  TGKSSLI A A+E+FP +VP VLPPT LP D +P
Sbjct  1    MLGGHGGKSSAGGRKSLRIAVAGEKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TIIDT SS +NR  L EE  +ADAV+LTYACD+PATLDRLS+YWLPELRRLE+KA
Sbjct  61   DYIPITIIDTPSSIDNRIKLIEEFRKADAVILTYACDQPATLDRLSSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++  + LE +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERLPVRLEDIMAPIMKEYREIETCIECSA  162



>gb|KFK35451.1| hypothetical protein AALP_AA5G286100 [Arabis alpina]
Length=642

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G G  ++ G    +R+ VAG+  TGKSSLI A A+E+FP +VP VLPPT LP D +P
Sbjct  1    MLGGHGGKSSAGGRKSLRIAVAGEKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TIIDT SS +NR  L EE  +ADAV+LTYACD+PATLDRLS+YWLPELRRLE+KA
Sbjct  61   DYIPITIIDTPSSIDNRIKLIEEFRKADAVILTYACDQPATLDRLSSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++  + LE +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERLPVRLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_007050628.1| Mitochondrial Rho GTPase [Theobroma cacao]
 gb|EOX94785.1| Mitochondrial Rho GTPase [Theobroma cacao]
Length=641

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA++SFP  VP VLPPTRLP D +PD VP+TI+D+SSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDSFPEYVPAVLPPTRLPSDFYPDGVPVTIVDSSSSMESRVRLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLST+WLPELR+LEVKAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSTFWLPELRKLEVKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>ref|XP_004158944.1| PREDICTED: mitochondrial Rho GTPase 1-A-like [Cucumis sativus]
Length=453

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD  TGKSSLI AAATESFP +VP VLPPT LP D + D VPLTIID+SSS +N
Sbjct  11   VRIVVAGDRGTGKSSLIAAAATESFPDNVPSVLPPTHLPADFYADGVPLTIIDSSSSMDN  70

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +  L+EE+ RADAV+LTYACD+P TL+RL++YWL ELR+LEVKAPVI+VGC LD RD+  
Sbjct  71   KSKLYEELKRADAVLLTYACDQPMTLNRLTSYWLNELRQLEVKAPVILVGCKLDLRDEHH  130

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             +++E ++ PIM+QFREIETCIECSA
Sbjct  131  PMSMEDIVAPIMKQFREIETCIECSA  156



>ref|XP_011036782.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011036783.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Populus 
euphratica]
Length=694

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +3

Query  75   GFTYKFIRSRGELMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPV  254
            G    F   +   M    ++   G  SGVR++VAGD  TGKSSLI+ A +E+FP+SVPPV
Sbjct  31   GIPSNFSIKQNHKMTKAATTANPGFKSGVRIVVAGDRGTGKSSLIVTAISETFPSSVPPV  90

Query  255  LPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTY  434
            LPPTR+PDD +PDRVP+TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+
Sbjct  91   LPPTRMPDDFYPDRVPITIIDTSSKVEDASKVAEELKRADAVVLTYACDRPETLDRLSTF  150

Query  435  WLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            WLPELR+LEVK PVIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  151  WLPELRQLEVKVPVIVVGCKLDLRDETQQVSLEQVMSPIMQQFREIETCIECSAF  205



>ref|XP_010090397.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXB39367.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=603

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +3

Query  114  MAGG-GSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            M+GG    +  G   GVRV+VAGD  TGKSSLI+ AA+ESFP +VPPVLPPTRLP D FP
Sbjct  1    MSGGFAGYSTSGARPGVRVVVAGDRGTGKSSLIVTAASESFPENVPPVLPPTRLPADFFP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D VP+TIIDTSSS E+RG   EE+ RADAVVLTYACD+P TL R+ TYWLPELR+LEVK 
Sbjct  61   DFVPVTIIDTSSSSESRGRRNEELKRADAVVLTYACDQPVTLTRIRTYWLPELRQLEVKV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    +EQVM PIM QFREIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERDTATIEQVMTPIMLQFREIETCIECSA  162



>gb|KJB23092.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=620

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA+++FP  VP VLPPTRLP D +PD VP+TI+DTSSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDAFPEYVPAVLPPTRLPSDFYPDGVPVTIVDTSSSMESRIKLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLS++WLPELR+LE+KAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSSFWLPELRKLEIKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>ref|XP_008451367.1| PREDICTED: mitochondrial Rho GTPase 1 [Cucumis melo]
Length=641

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + VR++VAGD  TGKSSLI AAATESFP +VP VLPPT LP D + D VPLTIID+S
Sbjct  6    GVRTSVRIVVAGDRGTGKSSLIAAAATESFPDNVPSVLPPTHLPADFYADGVPLTIIDSS  65

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS +N+  LFEE+ RADAV+LTYACD+P TL+RL++YWL ELR+LEVKAPVI+VGC LD 
Sbjct  66   SSMDNKSKLFEELKRADAVLLTYACDQPMTLNRLTSYWLNELRQLEVKAPVILVGCKLDL  125

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+   +++E ++ PIM+QFREIETCIECSA
Sbjct  126  RDEHHPMSMEDIVAPIMKQFREIETCIECSA  156



>gb|KJB23094.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=643

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA+++FP  VP VLPPTRLP D +PD VP+TI+DTSSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDAFPEYVPAVLPPTRLPSDFYPDGVPVTIVDTSSSMESRIKLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLS++WLPELR+LE+KAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSSFWLPELRKLEIKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>gb|KJB23090.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=641

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA+++FP  VP VLPPTRLP D +PD VP+TI+DTSSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDAFPEYVPAVLPPTRLPSDFYPDGVPVTIVDTSSSMESRIKLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLS++WLPELR+LE+KAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSSFWLPELRKLEIKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>ref|XP_011036784.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X3 [Populus 
euphratica]
Length=651

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M    ++   G  SGVR++VAGD  TGKSSLI+ A +E+FP+SVPPVLPPTR+PDD +PD
Sbjct  1    MTKAATTANPGFKSGVRIVVAGDRGTGKSSLIVTAISETFPSSVPPVLPPTRMPDDFYPD  60

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVP+TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+WLPELR+LEVK P
Sbjct  61   RVPITIIDTSSKVEDASKVAEELKRADAVVLTYACDRPETLDRLSTFWLPELRQLEVKVP  120

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            VIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  VIVVGCKLDLRDETQQVSLEQVMSPIMQQFREIETCIECSAF  162



>gb|KJB23091.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=662

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  AGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLF  353
            AGD  TGKSSLI AAA+++FP  VP VLPPTRLP D +PD VP+TI+DTSSS E+R  L 
Sbjct  18   AGDRGTGKSSLISAAASDAFPEYVPAVLPPTRLPSDFYPDGVPVTIVDTSSSMESRIKLI  77

Query  354  EEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLE  533
            +E+ RADAVVLTYACD+P TL RLS++WLPELR+LE+KAPVIVVGC LD RD++Q +NLE
Sbjct  78   DELKRADAVVLTYACDQPMTLSRLSSFWLPELRKLEIKAPVIVVGCKLDLRDERQPMNLE  137

Query  534  QVMLPIMQQFREIETCIECSA  596
            QVM PIMQQFREIETCIECS+
Sbjct  138  QVMAPIMQQFREIETCIECSS  158



>ref|XP_006444083.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 gb|ESR57323.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
Length=337

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>ref|XP_009151199.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=649

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G+   VR++V GD  TGKSSLI+AAA++SFP +VPPVLP T LP + FPD V
Sbjct  5    AAGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAASDSFPPNVPPVLPDTNLPLEFFPDGV  64

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+TI+DTSS PE+R  + EE+  ADAVVLTY C +P TL+ LSTYWLPELRRLEVK P+I
Sbjct  65   PVTIVDTSSRPEDREMVAEELRNADAVVLTYDCGRPETLEGLSTYWLPELRRLEVKVPII  124

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            V GC LD RDD   ++LEQVM PIM QFREIETCIECSA
Sbjct  125  VAGCKLDLRDDNSQVSLEQVMSPIMHQFREIETCIECSA  163



>ref|XP_004495731.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cicer arietinum]
Length=644

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M    ++  +G  +GVR++VAGD  TGKSSLI  AA + FP +V PVLPPT LP D +PD
Sbjct  1    MVRANATTLRGR-TGVRIVVAGDKGTGKSSLITTAAYDIFPVNVAPVLPPTALPVDQYPD  59

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
            RVP+TIIDT+S  E R  + EE+ +A+ VVLTYACD+P TLD LSTYWLP LR LEVK P
Sbjct  60   RVPVTIIDTTSRVEERYKVAEELKKAETVVLTYACDRPETLDSLSTYWLPHLRDLEVKVP  119

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RDD   ++LEQVM PIMQQFREIETCIECSA
Sbjct  120  VIVVGCKLDLRDDNHQVSLEQVMSPIMQQFREIETCIECSA  160



>emb|CDX80639.1| BnaC07g28050D [Brassica napus]
Length=649

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G+   VR++V GD  TGKSSLI+AAA++SFP +VPPVLP T LP + FPD V
Sbjct  5    AAGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAASDSFPPNVPPVLPDTNLPLEFFPDGV  64

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+TI+DTSS PE+R  + EE+  ADAVVLTY C +P TL+ LSTYWLPELRRLEVK P+I
Sbjct  65   PVTIVDTSSRPEDREMVAEELRNADAVVLTYDCGRPETLEGLSTYWLPELRRLEVKVPII  124

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            V GC LD RDD   ++LEQVM PIM QFREIETCIECSA
Sbjct  125  VAGCKLDLRDDNSQVSLEQVMSPIMHQFREIETCIECSA  163



>emb|CDX86152.1| BnaA06g28690D [Brassica napus]
Length=649

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRV  299
              G+ +  G+   VR++V GD  TGKSSLI+AAA++SFP +VPPVLP T LP + FPD V
Sbjct  5    AAGTVDCPGSPKSVRIVVVGDKGTGKSSLIVAAASDSFPPNVPPVLPDTNLPLEFFPDGV  64

Query  300  PLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVI  479
            P+TI+DTSS PE+R  + EE+  ADAVVLTY C +P TL+ LSTYWLPELRRLEVK P+I
Sbjct  65   PVTIVDTSSRPEDREMVAEELRNADAVVLTYDCGRPETLEGLSTYWLPELRRLEVKVPII  124

Query  480  VVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            V GC LD RDD   ++LEQVM PIM QFREIETCIECSA
Sbjct  125  VAGCKLDLRDDNSQVSLEQVMSPIMHQFREIETCIECSA  163



>ref|XP_006290901.1| hypothetical protein CARUB_v10017013mg [Capsella rubella]
 gb|EOA23799.1| hypothetical protein CARUB_v10017013mg [Capsella rubella]
Length=523

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G    ++ G  + +RV VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D FP
Sbjct  1    MLGGFAGKSSAGGRTRLRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAFP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TI+DT SS +NR  L EE  +AD V+LTYACD+P+TLDRL++YWLPELRRLE+KA
Sbjct  61   DYIPITIVDTPSSIDNRIKLIEEFRKADVVILTYACDQPSTLDRLTSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    LE +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERSPARLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_009111756.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=641

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP   FPD +P+TI+DTSS PE+
Sbjct  10   VRIVVIGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFQFFPDGIPVTIVDTSSRPED  69

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +G + EE+  ADAVVLTY CD+P TL+RLSTYWLPELR LEVK P+IV GC LD RDD  
Sbjct  70   KGMVAEELKLADAVVLTYDCDRPETLERLSTYWLPELRLLEVKVPIIVAGCKLDLRDDNS  129

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             + LE+VM PIM QFREIETCIECSA
Sbjct  130  PVVLEEVMAPIMHQFREIETCIECSA  155



>gb|KGN44818.1| hypothetical protein Csa_7G389500 [Cucumis sativus]
Length=641

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD  TGKSSLI AAATESFP +VP VLPPT LP D + D VPLTIID+SSS +N
Sbjct  11   VRIVVAGDRGTGKSSLIAAAATESFPDNVPSVLPPTHLPADFYADGVPLTIIDSSSSMDN  70

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +  L+EE+ RADAV+LTYACD+P TL+RL++YWL ELR+LEVKAPVI+VGC LD RD+  
Sbjct  71   KSKLYEELKRADAVLLTYACDQPMTLNRLTSYWLNELRQLEVKAPVILVGCKLDLRDEHH  130

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             +++E ++ PIM+QFREIETCIECSA
Sbjct  131  PMSMEDIVAPIMKQFREIETCIECSA  156



>ref|XP_002878499.1| hypothetical protein ARALYDRAFT_486817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54758.1| hypothetical protein ARALYDRAFT_486817 [Arabidopsis lyrata subsp. 
lyrata]
Length=643

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            +M GG SS   G+ + +RV VAGD  TGKSSLI A A+E+FP +VP VLPP  LP D FP
Sbjct  1    MMLGGKSST--GSRTSLRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPITLPADAFP  58

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TI+DT SS +NR  L EE  +AD V+LTYACD+PATLDRLS+YWLPELRRLE+KA
Sbjct  59   DYIPITIVDTPSSIDNRIKLIEEFRKADVVILTYACDQPATLDRLSSYWLPELRRLEIKA  118

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    LE +M PIM+++REIETCIECSA
Sbjct  119  PVIVVGCKLDLRDERSPARLEVIMAPIMKEYREIETCIECSA  160



>ref|XP_004148893.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1-like 
[Cucumis sativus]
Length=639

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++VAGD  TGKSSLI AAATESFP +VP VLPPT LP D + D VPLTIID+SSS +N
Sbjct  11   VRIVVAGDRGTGKSSLIAAAATESFPDNVPSVLPPTHLPADFYADGVPLTIIDSSSSMDN  70

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +  L+EE+ RADAV+LTYACD+P TL+RL++YWL ELR+LEVKAPVI+VGC LD RD+  
Sbjct  71   KSKLYEELKRADAVLLTYACDQPMTLNRLTSYWLNELRQLEVKAPVILVGCKLDLRDEHH  130

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             +++E ++ PIM+QFREIETCIECSA
Sbjct  131  PMSMEDIVAPIMKQFREIETCIECSA  156



>emb|CDY69035.1| BnaA09g52280D, partial [Brassica napus]
Length=683

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            S VR++V GD  TGKSSLI+AAAT+SFP +VPPVLP T+LP   FPD +P+TI+DTSS P
Sbjct  50   SPVRIVVIGDKGTGKSSLIVAAATDSFPPNVPPVLPDTKLPFQFFPDGIPVTIVDTSSRP  109

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E++G + EE+  ADAVVLTY CD+P TL+RLSTYWLPELR LEVK P+IV GC LD RDD
Sbjct  110  EDKGMVAEELKLADAVVLTYDCDRPETLERLSTYWLPELRLLEVKVPIIVAGCKLDLRDD  169

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
               + LE+VM PIM QFREIETCIECSA
Sbjct  170  NSPVVLEEVMAPIMHQFREIETCIECSA  197



>ref|XP_010552773.1| PREDICTED: mitochondrial Rho GTPase 1 [Tarenaya hassleriana]
Length=645

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV+VAGD  TGKSSLI A A+++FP +VP VLPPT LP D + D +P+TIIDT SS +N
Sbjct  17   IRVVVAGDKGTGKSSLISALASDTFPDNVPRVLPPTTLPADFYSDLIPITIIDTPSSIDN  76

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE  +ADAVVLTYACD+P TLDRL++YWLPELRRLE+KAPVIVVGC LD RD++ 
Sbjct  77   RIKLIEEFRKADAVVLTYACDQPGTLDRLTSYWLPELRRLEIKAPVIVVGCKLDLRDERH  136

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             ++LEQ+M PIMQ++REIETCIECSA
Sbjct  137  PVSLEQIMAPIMQEYREIETCIECSA  162



>emb|CAB87760.1| rac-GTP binding protein-like [Arabidopsis thaliana]
Length=676

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M  GG S+A G  S +RV VAGD  TGKSSLI A A+E+FP +VP VLPP  LP D FPD
Sbjct  1    MMLGGKSSAGGRTS-LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPITLPADAFPD  59

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             +P+TI+DT SS +NR  L EE  +AD V+LTYACD+P+TLDRLS+YWLPELRRLE+KAP
Sbjct  60   YIPITIVDTPSSIDNRIKLIEEFRKADVVLLTYACDQPSTLDRLSSYWLPELRRLEIKAP  119

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RD++    LE +M PIM+++REIETCIECSA
Sbjct  120  VIVVGCKLDLRDERSPARLEDIMSPIMKEYREIETCIECSA  160



>gb|AAL25592.1| AT3g63150/T20O10_250 [Arabidopsis thaliana]
 gb|AAM98282.1| At3g63150/T20O10_250 [Arabidopsis thaliana]
Length=643

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M  GG S+A G  S +RV VAGD  TGKSSLI A A+E+FP +VP VLPP  LP D FPD
Sbjct  1    MMLGGKSSAGGRTS-LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPITLPADAFPD  59

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             +P+TI+DT SS +NR  L EE  +AD V+LTYACD+P+TLDRLS+YWLPELRRLE+KAP
Sbjct  60   YIPITIVDTPSSIDNRIKLIEEFRKADVVLLTYACDQPSTLDRLSSYWLPELRRLEIKAP  119

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RD++    LE +M PIM+++REIETCIECSA
Sbjct  120  VIVVGCKLDLRDERSPARLEDIMSPIMKEYREIETCIECSA  160



>ref|XP_007207133.1| hypothetical protein PRUPE_ppa002661mg [Prunus persica]
 gb|EMJ08332.1| hypothetical protein PRUPE_ppa002661mg [Prunus persica]
Length=647

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G+ N     + VR++VAGD  TGKSSLI+ AATE+FPA+VPP+LPPTRLP+D +P+R
Sbjct  4    AAAGTDNP-ATPTAVRIVVAGDRGTGKSSLIVTAATENFPANVPPLLPPTRLPEDFYPER  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSS PE+   + EE+ RADA+VLTYACD+P TLDRLST+WLP+LR+LEVK PV
Sbjct  63   VPITIIDTSSRPEDNSKVAEELKRADAIVLTYACDQPQTLDRLSTFWLPKLRQLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  123  IVVGCRLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAF  163



>ref|XP_006444084.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 gb|ESR57324.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
Length=375

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>ref|XP_006444082.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 gb|ESR57322.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
Length=454

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>ref|NP_567139.1| MIRO-related GTP-ase 2 [Arabidopsis thaliana]
 sp|F4J0W4.1|MIRO2_ARATH RecName: Full=Mitochondrial Rho GTPase 2; Short=AtMIRO2; AltName: 
Full=Calcium-binding GTPase; Short=AtCBG; AltName: Full=Miro-related 
GTPase 2 [Arabidopsis thaliana]
 gb|AEE80441.1| MIRO-related GTP-ase 2 [Arabidopsis thaliana]
Length=643

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPD  293
            M  GG S+A G  S +RV VAGD  TGKSSLI A A+E+FP +VP VLPP  LP D FPD
Sbjct  1    MMLGGKSSAGGRTS-LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPITLPADAFPD  59

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             +P+TI+DT SS +NR  L EE  +AD V+LTYACD+P+TLDRLS+YWLPELRRLE+KAP
Sbjct  60   YIPITIVDTPSSIDNRIKLIEEFRKADVVLLTYACDQPSTLDRLSSYWLPELRRLEIKAP  119

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VIVVGC LD RD++    LE +M PIM+++REIETCIECSA
Sbjct  120  VIVVGCKLDLRDERSPARLEDIMSPIMKEYREIETCIECSA  160



>ref|XP_008246476.1| PREDICTED: mitochondrial Rho GTPase 1-like [Prunus mume]
Length=647

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A  G+ N     + VR++VAGD  TGKSSLI+ AATE+FPA+VPP+LPPTRLP+D +P+R
Sbjct  4    AAAGTDNP-ATPTAVRIVVAGDRGTGKSSLIVTAATENFPANVPPLLPPTRLPEDFYPER  62

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSS PE+   + EE+ RADA+VLTYACD+P TLDRLST+WLP+LR+LEVK PV
Sbjct  63   VPITIIDTSSRPEDNSKVAEELKRADAIVLTYACDQPQTLDRLSTFWLPKLRQLEVKVPV  122

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  123  IVVGCRLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAF  163



>gb|KDO68750.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=507

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>gb|AFK45596.1| unknown [Medicago truncatula]
Length=452

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            +GVR++VAGD  TGKSSLI  A+TE+F  +V PVLPPT L  D++PDRVP+TIIDTSS  
Sbjct  15   TGVRIVVAGDQGTGKSSLISTASTENFRPNVAPVLPPTTLAVDLYPDRVPITIIDTSSRV  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
             +   + EE+ RAD VVLTYACD+P TL+ LST WLP LR LEV  PVIVVGC LD RD+
Sbjct  75   ADSNRVAEELQRADTVVLTYACDRPETLENLSTVWLPHLRNLEVNVPVIVVGCKLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_010413192.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G G  +     + +R+ VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D FP
Sbjct  1    MLGGFGGKSPPVGRTSLRIAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAFP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TI+DT SS +NR  L EE  +ADAV+LTYACD+P+TLDRLS+YWLPELRRLE+KA
Sbjct  61   DFIPITIVDTPSSIDNRIKLIEEFRKADAVILTYACDQPSTLDRLSSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    L+ +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERTPTRLDDIMAPIMKEYREIETCIECSA  162



>ref|XP_009138638.1| PREDICTED: mitochondrial Rho GTPase 1 [Brassica rapa]
Length=645

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D +PD +P+TIIDT SS +N
Sbjct  17   LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYPDYIPITIIDTPSSIDN  76

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE  +AD V+LTYACD+PATLDRLS+YWLPELRRL++KAPVIVVGC LD RD++ 
Sbjct  77   RIKLIEEFRKADVVILTYACDQPATLDRLSSYWLPELRRLQIKAPVIVVGCKLDLRDERS  136

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             + LE +M PIM+++REIETCIECSA
Sbjct  137  PVRLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_002993625.1| hypothetical protein SELMODRAFT_451618 [Selaginella moellendorffii]
 gb|EFJ05317.1| hypothetical protein SELMODRAFT_451618 [Selaginella moellendorffii]
Length=640

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  AKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIID  317
            A   IS VRV+V GDP TGKSSLI+AAA ESFP   PPVL PT+LP D  PDRVPLTIID
Sbjct  2    AASGISNVRVVVVGDPGTGKSSLIVAAAAESFPDKAPPVLLPTKLPPDFLPDRVPLTIID  61

Query  318  TSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCML  497
            T S PE+R  + +E  +AD +VLTYACD+P+TL+ + TYWLPELR LEVK P+IVVGC L
Sbjct  62   TPSRPEDRELVEQECKKADTIVLTYACDQPSTLESIQTYWLPELRALEVKVPIIVVGCKL  121

Query  498  DKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            D R D++ + LEQVM PIM  FREIETCIECSA
Sbjct  122  DLRQDKEPM-LEQVMAPIMHDFREIETCIECSA  153



>emb|CDX93929.1| BnaC04g20880D [Brassica napus]
Length=645

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D +PD +P+TIIDT SS +N
Sbjct  17   LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYPDYIPITIIDTPSSIDN  76

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE  +AD V+LTYACD+PATLDRLS+YWLPELRRL++KAPVIVVGC LD RD++ 
Sbjct  77   RIKLIEEFRKADVVILTYACDQPATLDRLSSYWLPELRRLQIKAPVIVVGCKLDLRDERS  136

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             + LE +M PIM+++REIETCIECSA
Sbjct  137  PVRLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_002973259.1| MIRO family protein [Selaginella moellendorffii]
 gb|EFJ25633.1| MIRO family protein [Selaginella moellendorffii]
Length=640

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  AKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIID  317
            A   IS VRV+V GDP TGKSSLI+AAA ESFP   PPVL PT+LP D  PDRVPLTIID
Sbjct  2    AASGISNVRVVVVGDPGTGKSSLIVAAAAESFPDKAPPVLLPTKLPPDFLPDRVPLTIID  61

Query  318  TSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCML  497
            T S PE+R  + +E  +AD +VLTYACD+P+TL+ + TYWLPELR LEVK P+IVVGC L
Sbjct  62   TPSRPEDRELVEQECKKADTIVLTYACDQPSTLESIQTYWLPELRALEVKVPIIVVGCKL  121

Query  498  DKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            D R D++ + LEQVM PIM  FREIETCIECSA
Sbjct  122  DLRQDKEPM-LEQVMAPIMHDFREIETCIECSA  153



>ref|XP_008454749.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis melo]
 gb|ABR67417.1| ATP/GTP/Ca++ binding protein [Cucumis melo subsp. melo]
Length=647

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +3

Query  114  MAGGGSSNAK-GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   +SN   G  + VR+++AGD  TGKSSLI+ AA ++FP +VPPVLPPTRLP+D +P
Sbjct  1    MARAPASNVHSGGRTEVRIVIAGDRGTGKSSLIVTAAADNFPVNVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+WLP+LR+LEV+ 
Sbjct  61   DRVPTTIIDTSSRTEDSAKVAEELKRADAVVLTYACDQPNTLDRLSTFWLPKLRQLEVRV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  PVIVVGCKLDLRDENQQVSLEQVMSPIMQQFREIETCIECSAF  163



>ref|XP_006444081.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 ref|XP_006479729.1| PREDICTED: mitochondrial Rho GTPase 1-like [Citrus sinensis]
 gb|ESR57321.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 gb|KDO68747.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=643

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>ref|XP_004302432.1| PREDICTED: mitochondrial Rho GTPase 1-like [Fragaria vesca subsp. 
vesca]
Length=649

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +3

Query  117  AGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDR  296
            A G ++   G  + VR++VAGD  TGKSSLI+ AA E++PA+VPP+LPPTRLP+D +P+R
Sbjct  5    AAGNANQHHGGRTAVRIVVAGDQGTGKSSLIVTAAAENYPANVPPLLPPTRLPEDFYPER  64

Query  297  VPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPV  476
            VP+TIIDTSS PE+   + E++  ADAVVLTYACD+P TLDRLST+WLP+LR+LEV+ PV
Sbjct  65   VPITIIDTSSKPEDNVKVAEDLKAADAVVLTYACDQPHTLDRLSTFWLPKLRQLEVRVPV  124

Query  477  IVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            IVVGC LD RD+   ++LEQVM PIMQQFREIETCIECSA+
Sbjct  125  IVVGCKLDLRDENHEVSLEQVMSPIMQQFREIETCIECSAF  165



>ref|XP_008368856.1| PREDICTED: mitochondrial Rho GTPase 1 [Malus domestica]
Length=642

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAGD  TGKS+LI A AT++F  +VPPVLPPTRL  D+FPD VPLTIIDTS
Sbjct  8    GQRTGVRVVVAGDRGTGKSTLIAAVATDAFDPNVPPVLPPTRLAADMFPDFVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VV+TYACD+P TL RL+TYWL ELR LEVK PVI+VGC LD 
Sbjct  68   SSLENCSKRNEELKRADVVVITYACDQPMTLTRLTTYWLLELRHLEVKVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM  FREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMSPIMHXFREIQTCIECSA  158



>gb|KDO68749.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=670

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI AAATES P  VPPV  PTRLP D +PDRVP+TIIDTSSS EN+G L EE+ R
Sbjct  23   TGKSSLIAAAATESVPEKVPPVHAPTRLPPDFYPDRVPVTIIDTSSSLENKGKLNEELKR  82

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTYAC++ +TL RLS+YWLPELRRLE+K P+IV GC LD R D  A +LE+VM P
Sbjct  83   ADAVVLTYACNQQSTLSRLSSYWLPELRRLEIKVPIIVAGCKLDLRGDHNATSLEEVMGP  142

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETC+ECSA
Sbjct  143  IMQQFREIETCVECSA  158



>gb|EEC71783.1| hypothetical protein OsI_04400 [Oryza sativa Indica Group]
Length=618

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 122/156 (78%), Gaps = 4/156 (3%)
 Frame = +3

Query  138  AKGNISG---VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            A  N++G   +RV+V GDP TGKSSL+++AATE FP  VP VLPPTRLP D F DR+P+T
Sbjct  2    ALANLAGKQSLRVVVIGDPGTGKSSLVVSAATERFPGDVPRVLPPTRLPVDYFADRIPIT  61

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            I+DTSSSPE R  L  E   AD VVLTYACD+PATL+RLS++W PELRRL+++APVIVVG
Sbjct  62   IVDTSSSPEQRSKLIAECQSADVVVLTYACDQPATLERLSSFWFPELRRLQLEAPVIVVG  121

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            C LD R ++Q   L+ VM PIM  FREIETCIECSA
Sbjct  122  CKLDLRGEEQG-TLDAVMAPIMVAFREIETCIECSA  156



>ref|XP_010091557.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXC36980.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=647

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVR++VAGD  TGKSSLI+ AA E+FP +VPP+LPPTRLP+D +PDRVP+TIIDTS
Sbjct  12   GGRTGVRIVVAGDRGTGKSSLIVTAAAENFPVNVPPLLPPTRLPEDFYPDRVPITIIDTS  71

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S PE+ G + EE+ RADAVVLTYACD+P TLDRLST+WLP LR+LEV+ PVIVVGC LD 
Sbjct  72   SRPEDNGRVAEELRRADAVVLTYACDQPQTLDRLSTFWLPTLRQLEVRVPVIVVGCKLDL  131

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+ Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  132  RDENQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_008386506.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=642

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+V+G+  TGKS+LI A AT++F  +VPPVLPPTRL  D+FPD VPLTIIDTS
Sbjct  8    GKRTGVRVVVSGERGTGKSTLIAAVATDAFDPAVPPVLPPTRLAADMFPDHVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VVLTYACD+P TL RL+TYWL ELR LEV+ PVI+VGC LD 
Sbjct  68   SSLENCSKRNEELKRADVVVLTYACDQPMTLTRLTTYWLLELRHLEVRVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM +FREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMAPIMHRFREIQTCIECSA  158



>emb|CDX89176.1| BnaA04g00100D [Brassica napus]
Length=645

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV VAGD  TGKSSLI A A+E+FP +VP VLPPT LP D +P+ +P+TIIDT SS +N
Sbjct  17   LRVAVAGDKGTGKSSLISAVASETFPDNVPRVLPPTTLPADAYPEYIPITIIDTPSSIDN  76

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE  +AD V+LTYACD+PATLDRLS+YWLPELRRL++KAPVIVVGC LD RD++ 
Sbjct  77   RIKLIEEFRKADVVILTYACDQPATLDRLSSYWLPELRRLQIKAPVIVVGCKLDLRDERS  136

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             + LE +M PIM+++REIETCIECSA
Sbjct  137  PVRLEDIMAPIMKEYREIETCIECSA  162



>ref|XP_010468881.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            ++ G G  +     + +R+ VAGD  TGKSSLI A A+E+FP +VP VLPP  LP D FP
Sbjct  1    MLGGFGGKSPPVGRTSLRIAVAGDKGTGKSSLISAVASETFPDNVPRVLPPITLPADAFP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TI+DT SS +NR  L EE  +ADAV+LTYACD+P+TLDRLS+YWLPELRRLE+KA
Sbjct  61   DFIPITIVDTPSSIDNRIKLIEEFRKADAVILTYACDQPSTLDRLSSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    L+ +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERTPTRLDDIMAPIMKEYREIETCIECSA  162



>ref|XP_002520752.1| rac-GTP binding protein, putative [Ricinus communis]
 gb|EEF41714.1| rac-GTP binding protein, putative [Ricinus communis]
Length=644

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  180  DPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEE  359
            D  TGKSSLI AAATE++P +VP VLPPTRLP D FPDR+P+TIIDTS++ E+RG L EE
Sbjct  21   DRFTGKSSLIAAAATETYPENVPRVLPPTRLPADFFPDRIPITIIDTSAALESRGKLIEE  80

Query  360  MMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQV  539
            + RAD VVLTY+CD+P TL RLS++WL ELRRLEVK PVIVVGC LD RD+   ++LEQV
Sbjct  81   LKRADVVVLTYSCDQPLTLSRLSSFWLEELRRLEVKVPVIVVGCKLDLRDEAYPVSLEQV  140

Query  540  MLPIMQQFREIETCIECSA  596
            M PIMQQ REIETCIECSA
Sbjct  141  MGPIMQQHREIETCIECSA  159



>ref|XP_001775852.1| predicted protein [Physcomitrella patens]
 gb|EDQ59391.1| predicted protein [Physcomitrella patens]
Length=638

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +3

Query  162  RVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENR  341
            +V+V GD  TGKSSLI A AT+SFP   PPVLPPTRLP D +PDRVPLTIIDTSS  E++
Sbjct  10   QVVVVGDQGTGKSSLIAAVATDSFPEKCPPVLPPTRLPHDFYPDRVPLTIIDTSSRQEDK  69

Query  342  GTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQA  521
              +  E  +ADA+VL YACD+P TL+RLSTYWLPELR L++K P+IVVGC LD RDD Q 
Sbjct  70   SKMEMECKKADAIVLAYACDRPQTLERLSTYWLPELRALQIKVPIIVVGCKLDLRDDCQP  129

Query  522  INLEQVMLPIMQQFREIETCIECSA  596
             +LEQVM P+M +FREIETCIECSA
Sbjct  130  -SLEQVMAPLMHEFREIETCIECSA  153



>ref|XP_003591106.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES61357.1| Rho GTPase-like protein [Medicago truncatula]
Length=646

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            +GVR++VAGD  TGKSSLI  A+TE+F  +V PVLPPT L  D++PDRVP+TIIDTSS  
Sbjct  15   TGVRIVVAGDQGTGKSSLISTASTENFRPNVAPVLPPTTLAVDLYPDRVPITIIDTSSRV  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
             +   + EE+ RAD VVLTYACD+P TL+ LST WLP LR LEV  PVIVVGC LD RD+
Sbjct  75   ADSNRVAEELQRADTVVLTYACDRPETLENLSTVWLPHLRNLEVNVPVIVVGCKLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSA  162



>gb|KHN20217.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=646

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            +GVR++VAGD  TGKSSLI+ AA E+FP +VPPVLPPTRLP+D++PDRVP+TIIDTSS  
Sbjct  15   TGVRIVVAGDQGTGKSSLIITAAAENFPVNVPPVLPPTRLPEDLYPDRVPITIIDTSSRA  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+   + EE+ RAD VVLTYACD+P TL+ LS +WLP LR+LEVK PVIVVGC LD RD+
Sbjct  75   EDSDKVAEELQRADTVVLTYACDRPETLENLSIFWLPHLRKLEVKVPVIVVGCKLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_003536081.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
 gb|KHN16127.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=646

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            +GVR++VAGD  TGKSSLI+ AA E+FP +VPPVLPPTRLP+D++PDRVP+TIIDTSS  
Sbjct  15   TGVRIVVAGDQGTGKSSLIITAAAENFPVNVPPVLPPTRLPEDLYPDRVPITIIDTSSRA  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+   + EE+ RAD VVLTYACD+P TL+ LS +WLP LR+LEVK PVIVVGC LD RD+
Sbjct  75   EDSDKVAEELQRADTVVLTYACDRPETLENLSIFWLPHLRKLEVKVPVIVVGCKLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_004139182.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus]
Length=647

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +3

Query  114  MAGGGSSNAKG-NISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   +SN      + VR+++AGD  TGKSSLI+ AA ++FP +VPPVLPPTRLP+D +P
Sbjct  1    MARAPASNVHSRGRTEVRIVIAGDRGTGKSSLIVTAAADNFPVNVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+WLP+LR+LEV+ 
Sbjct  61   DRVPTTIIDTSSRTEDSAKVAEELKRADAVVLTYACDQPNTLDRLSTFWLPKLRQLEVRV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  PVIVVGCKLDLRDEDQQVSLEQVMSPIMQQFREIETCIECSAF  163



>ref|XP_004156425.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus]
Length=648

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +3

Query  114  MAGGGSSNAKG-NISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   +SN      + VR+++AGD  TGKSSLI+ AA ++FP +VPPVLPPTRLP+D +P
Sbjct  1    MARAPASNVHSRGRTEVRIVIAGDRGTGKSSLIVTAAADNFPVNVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+WLP+LR+LEV+ 
Sbjct  61   DRVPTTIIDTSSRTEDSAKVAEELKRADAVVLTYACDQPNTLDRLSTFWLPKLRQLEVRV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  PVIVVGCKLDLRDEDQQVSLEQVMSPIMQQFREIETCIECSAF  163



>ref|XP_009355476.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=649

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAG+  TGKS+LI A AT++F  +VP VLP TRL  D+FPD VPLTIIDTS
Sbjct  8    GKRAGVRVVVAGERGTGKSTLIAAVATDAFDPAVPRVLPATRLAADMFPDHVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VVLTYACD+P TL RL+TYWL ELR LEVK PVI+VGC LD 
Sbjct  68   SSLENCSKRNEELNRADVVVLTYACDQPMTLTRLTTYWLLELRHLEVKVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM QFREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMAPIMHQFREIQTCIECSA  158



>gb|KGN60899.1| hypothetical protein Csa_2G021700 [Cucumis sativus]
Length=647

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +3

Query  114  MAGGGSSNAKG-NISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            MA   +SN      + VR+++AGD  TGKSSLI+ AA ++FP +VPPVLPPTRLP+D +P
Sbjct  1    MARAPASNVHSRGRTEVRIVIAGDRGTGKSSLIVTAAADNFPVNVPPVLPPTRLPEDFYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            DRVP TIIDTSS  E+   + EE+ RADAVVLTYACD+P TLDRLST+WLP+LR+LEV+ 
Sbjct  61   DRVPTTIIDTSSRTEDSAKVAEELKRADAVVLTYACDQPNTLDRLSTFWLPKLRQLEVRV  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q ++LEQVM PIMQQFREIETCIECSA+
Sbjct  121  PVIVVGCKLDLRDEDQQVSLEQVMSPIMQQFREIETCIECSAF  163



>ref|XP_009355477.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=642

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAG+  TGKS+LI A AT++F  +VP VLP TRL  D+FPD VPLTIIDTS
Sbjct  8    GKRAGVRVVVAGERGTGKSTLIAAVATDAFDPAVPRVLPATRLAADMFPDHVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     EE+ RAD VVLTYACD+P TL RL+TYWL ELR LEVK PVI+VGC LD 
Sbjct  68   SSLENCSKRNEELNRADVVVLTYACDQPMTLTRLTTYWLLELRHLEVKVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM QFREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMAPIMHQFREIQTCIECSA  158



>ref|XP_010512723.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            L   GG S + G  S +R+ VAGD  TGKSSLI A A+ +FP +VP VLPPT LP D FP
Sbjct  2    LGGFGGKSPSVGRTS-LRIAVAGDKGTGKSSLISAVASATFPDNVPRVLPPTTLPADAFP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+TI+DT SS +NR  L EE  +AD V+LTYACD+P+TLDRL +YWLPELRRLE+KA
Sbjct  61   DFIPITIVDTPSSIDNRIKLIEEFRKADVVILTYACDQPSTLDRLCSYWLPELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIVVGC LD RD++    L+ +M PIM+++REIETCIECSA
Sbjct  121  PVIVVGCKLDLRDERTPTRLDDIMAPIMKEYREIETCIECSA  162



>ref|XP_007144734.1| hypothetical protein PHAVU_007G180300g [Phaseolus vulgaris]
 gb|ESW16728.1| hypothetical protein PHAVU_007G180300g [Phaseolus vulgaris]
Length=646

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            +GVR++VAGD  TGKSSLI+ AA ++FP +VPPVLPPTRLP+D++PDRVP+TIIDTSS  
Sbjct  15   TGVRIVVAGDQGTGKSSLIITAAADNFPVNVPPVLPPTRLPEDLYPDRVPITIIDTSSRA  74

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E+   + EE+ RAD VVLTYACD+P TL+ LS +WLP LR+LEVK PVIVVGC LD RD+
Sbjct  75   EDSDKVAEELQRADTVVLTYACDRPETLENLSIFWLPHLRKLEVKVPVIVVGCRLDLRDE  134

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  135  NQQVSLEQVMSPIMQQFREIETCIECSA  162



>ref|XP_011079844.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1 [Sesamum 
indicum]
Length=645

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 124/162 (77%), Gaps = 8/162 (5%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAAT---ESFPASVPPVLPPTRLPDDIFP  290
            GG  S A+   + VR++V GD  TGKSSL         E+F   VPPVLPPTRLP D +P
Sbjct  4    GGPISGAR---TSVRIVVVGDRGTGKSSLPPPTPAAAAETFRQEVPPVLPPTRLPADYYP  60

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D VP+ IIDTSSS ENRG L EE+ RADAVVLTYACD+P+TL+RLS++WL ELRRLE+KA
Sbjct  61   DNVPIVIIDTSSSLENRGRLAEELKRADAVVLTYACDQPSTLNRLSSFWLHELRRLEIKA  120

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIV GC LD+R ++  +++E  M+P+MQQFREIETCIECSA
Sbjct  121  PVIVAGCKLDRRTEEYNLSIE--MVPLMQQFREIETCIECSA  160



>ref|XP_006588627.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Glycine 
max]
Length=514

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +3

Query  99   SRGELMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPD  278
            SR   M G  S++ +     VR+ V GD  TGKS+LI A A+ESFP SVPPVLPPTRLP 
Sbjct  3    SRFATMVGPSSASGRRE---VRIAVVGDGATGKSTLIAAMASESFPKSVPPVLPPTRLPR  59

Query  279  DIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRL  458
            ++FPD VPLT+IDT SS   +GT  EE+  AD VVLTYACD+P + +R++TYWLPEL +L
Sbjct  60   NLFPDSVPLTLIDTPSSLAKQGTRNEELKLADTVVLTYACDEPVSFERVTTYWLPELHKL  119

Query  459  EVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            EVKAPVIVVGC LD RD+ Q ++LE +   IM+QF E+ TC+ECSA
Sbjct  120  EVKAPVIVVGCKLDLRDENQLVSLESLTTHIMKQFTEVVTCVECSA  165



>ref|XP_002275434.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 emb|CBI32339.3| unnamed protein product [Vitis vinifera]
Length=639

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI  AATE+FP +V PVLPPTRLP D +PDRVP+TIIDTSSS E+R  L EE+ R
Sbjct  20   TGKSSLISTAATETFPETVQPVLPPTRLPADFYPDRVPVTIIDTSSSLEHRAKLAEELKR  79

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADAVVLTY+CD    L R  T+WL ELRRLEV+APVIVVGC LD RD++Q I+LEQVM P
Sbjct  80   ADAVVLTYSCDN-TNLSRPITFWLHELRRLEVRAPVIVVGCKLDLRDERQRISLEQVMSP  138

Query  549  IMQQFREIETCIECSA  596
            IMQQFREIETCIECSA
Sbjct  139  IMQQFREIETCIECSA  154



>emb|CDX99980.1| BnaC09g03210D [Brassica napus]
Length=701

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 127/185 (69%), Gaps = 16/185 (9%)
 Frame = +3

Query  72   LGFTYKFIRSRGEL----------MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAA  221
            +GF   F+  R  L          MA    +N+      VR++V GD  TGKSSLI+AAA
Sbjct  45   VGFCLSFLNERLSLSISSSSLSFQMAAASPNNS------VRIVVIGDKGTGKSSLIVAAA  98

Query  222  TESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACD  401
            T+SFP + PPVLP T+LP   FPD +P+T++DTSS PE++G + EE+  ADAVVLTY CD
Sbjct  99   TDSFPPNAPPVLPDTKLPFQFFPDGIPVTLVDTSSRPEDKGMVAEELKLADAVVLTYDCD  158

Query  402  KPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETC  581
            +P TL+ LS  WLPELR LEVK P+IV GC LD RDD   + LE+VM PIM QFREIETC
Sbjct  159  RPETLEGLSLRWLPELRLLEVKVPIIVAGCKLDLRDDNSPVVLEEVMAPIMHQFREIETC  218

Query  582  IECSA  596
            IECSA
Sbjct  219  IECSA  223



>ref|XP_003536499.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Glycine 
max]
Length=650

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = +3

Query  99   SRGELMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPD  278
            SR   M G  S++ +     VR+ V GD  TGKS+LI A A+ESFP SVPPVLPPTRLP 
Sbjct  3    SRFATMVGPSSASGRRE---VRIAVVGDGATGKSTLIAAMASESFPKSVPPVLPPTRLPR  59

Query  279  DIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRL  458
            ++FPD VPLT+IDT SS   +GT  EE+  AD VVLTYACD+P + +R++TYWLPEL +L
Sbjct  60   NLFPDSVPLTLIDTPSSLAKQGTRNEELKLADTVVLTYACDEPVSFERVTTYWLPELHKL  119

Query  459  EVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            EVKAPVIVVGC LD RD+ Q ++LE +   IM+QF E+ TC+ECSA
Sbjct  120  EVKAPVIVVGCKLDLRDENQLVSLESLTTHIMKQFTEVVTCVECSA  165



>emb|CDY19722.1| BnaA09g03750D [Brassica napus]
Length=842

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++V GD  TGKSSLI AAAT SFPA+VPPVLP T+LP   FPD +P+TI+DTSS  E+
Sbjct  16   VRIVVIGDKGTGKSSLIAAAATNSFPANVPPVLPDTKLPLQFFPDGIPVTIVDTSSRQED  75

Query  339  RGTLFEEMMRADAVVLTYAC-DKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
            RG + EE+  ADAVVLT+A  D+P TL RLSTYWLPELRRLEVK P+IV GC LD   D+
Sbjct  76   RGMVAEELKHADAVVLTHASDDRPETLQRLSTYWLPELRRLEVKVPIIVAGCKLDL--DK  133

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
              ++ EQVM PIM QFREIETCIECSA
Sbjct  134  NQVSFEQVMSPIMNQFREIETCIECSA  160



>ref|XP_007144632.1| hypothetical protein PHAVU_007G171800g [Phaseolus vulgaris]
 gb|ESW16626.1| hypothetical protein PHAVU_007G171800g [Phaseolus vulgaris]
Length=643

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+ VAGD  TGKS+L+ A A+ESFP SVPPV PPTRLP +++PD VPLT++DT SS E 
Sbjct  13   VRIAVAGDGGTGKSTLVAAIASESFPKSVPPVFPPTRLPHNLYPDSVPLTLVDTPSSFEK  72

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +    EE+ RADAVVLTYACD+P + +RLS YWLPELR+L+VKAPVIVVGC LD R++  
Sbjct  73   QDARNEELKRADAVVLTYACDEPLSFERLSAYWLPELRKLQVKAPVIVVGCKLDLRNENH  132

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             ++LE +   IMQQF EI TC+ECSA
Sbjct  133  LVSLESLTTNIMQQFTEIVTCVECSA  158



>ref|XP_009111753.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=664

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++V GD  TGKSSLI AAAT SFP +VPPVLP T+LP   FPD + +TI+DTSS PE+
Sbjct  16   VRIVVIGDKGTGKSSLIAAAATNSFPPNVPPVLPDTKLPLQFFPDGIAVTIVDTSSRPED  75

Query  339  RGTLFEEMMRADAVVLTYAC-DKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
            RG + EE+  ADAVVLT+A  D+P TL RLSTYWLPELRRLEVK P+IV GC LD   D+
Sbjct  76   RGMVAEELKHADAVVLTHASDDRPETLQRLSTYWLPELRRLEVKVPIIVAGCKLDL--DK  133

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
              ++ EQVM PIM QFREIETCIECSA
Sbjct  134  NQVSFEQVMSPIMNQFREIETCIECSA  160



>ref|XP_006604432.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X3 [Glycine 
max]
Length=520

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
               S++ G  SGVRV+VAGD  TGKSSLI A ATESF  +VPPVLPPT L  D++PD VP
Sbjct  2    ANHSSSFGGRSGVRVVVAGDRSTGKSSLIAAIATESFAEAVPPVLPPTLLAPDLYPDTVP  61

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            LT++DT SS E +    EE+  AD VVLTYAC+  A+  RLS+YW PEL++LEVK PVIV
Sbjct  62   LTVVDTPSSLEKQRKRNEELKAADVVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVIV  121

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC LD RD+ Q ++LE VM  ++QQF+EI TCIECSA
Sbjct  122  VGCKLDLRDESQQVSLECVMTQLLQQFKEIVTCIECSA  159



>ref|XP_003554248.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Glycine 
max]
Length=644

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
               S++ G  SGVRV+VAGD  TGKSSLI A ATESF  +VPPVLPPT L  D++PD VP
Sbjct  2    ANHSSSFGGRSGVRVVVAGDRSTGKSSLIAAIATESFAEAVPPVLPPTLLAPDLYPDTVP  61

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            LT++DT SS E +    EE+  AD VVLTYAC+  A+  RLS+YW PEL++LEVK PVIV
Sbjct  62   LTVVDTPSSLEKQRKRNEELKAADVVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVIV  121

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC LD RD+ Q ++LE VM  ++QQF+EI TCIECSA
Sbjct  122  VGCKLDLRDESQQVSLECVMTQLLQQFKEIVTCIECSA  159



>ref|XP_006604431.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Glycine 
max]
Length=621

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
               S++ G  SGVRV+VAGD  TGKSSLI A ATESF  +VPPVLPPT L  D++PD VP
Sbjct  2    ANHSSSFGGRSGVRVVVAGDRSTGKSSLIAAIATESFAEAVPPVLPPTLLAPDLYPDTVP  61

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            LT++DT SS E +    EE+  AD VVLTYAC+  A+  RLS+YW PEL++LEVK PVIV
Sbjct  62   LTVVDTPSSLEKQRKRNEELKAADVVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVIV  121

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC LD RD+ Q ++LE VM  ++QQF+EI TCIECSA
Sbjct  122  VGCKLDLRDESQQVSLECVMTQLLQQFKEIVTCIECSA  159



>gb|KJB26440.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=619

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 117/157 (75%), Gaps = 26/157 (17%)
 Frame = +3

Query  129  SSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLT  308
            SSN +G  +GVR++VAGD  TGKSSLI+ AA E+FP +VP +LPPTRLP+D +PDRVP+T
Sbjct  4    SSNPEGK-TGVRIVVAGDRGTGKSSLIVTAAAETFPTNVPRLLPPTRLPEDFYPDRVPIT  62

Query  309  IIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVG  488
            IIDTSS+PE+RG L EE+ RADAVVLTYACD+P TL+RLST+WLPELR+LE         
Sbjct  63   IIDTSSNPEDRGKLAEELKRADAVVLTYACDQPETLNRLSTFWLPELRQLE---------  113

Query  489  CMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
                            VM PIMQQFREIETCIECSAY
Sbjct  114  ----------------VMSPIMQQFREIETCIECSAY  134



>ref|XP_006644996.1| PREDICTED: mitochondrial Rho GTPase 1-like [Oryza brachyantha]
Length=646

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFP-ASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            +RV+V GDP TGKSSL+ +AATE FP   VP VLPPTRLP D F DRVP+TI+DTSSSPE
Sbjct  16   LRVVVIGDPGTGKSSLVASAATERFPDEDVPGVLPPTRLPVDYFADRVPITIVDTSSSPE  75

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
             +  L  E   AD VVLTYACD+PATL RLS++WLPEL+ L++KAPVIVVGC LD RD++
Sbjct  76   QKPKLIAECQSADVVVLTYACDRPATLQRLSSFWLPELQSLQLKAPVIVVGCKLDLRDEK  135

Query  516  QAINLEQVMLPIMQQFREIETCIECSAY  599
            Q  +LE +M PIM  F+EIETCIECS +
Sbjct  136  Q-YSLEAMMEPIMGTFQEIETCIECSLF  162



>gb|EYU46588.1| hypothetical protein MIMGU_mgv1a002738mg [Erythranthe guttata]
Length=642

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 130/162 (80%), Gaps = 5/162 (3%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            +++GG  S A+   + VR++V GD  TGKSSLI AAA E+F   VPP+LPPTRLP D +P
Sbjct  1    MLSGGPISGAR---TSVRIVVVGDRGTGKSSLIAAAAAETFRPDVPPLLPPTRLPADFYP  57

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            +  P+ IIDTSSS ENRG L EE+ RADAVVLTYACD+PATL+RLS++WL ELRRLE++A
Sbjct  58   ENTPIVIIDTSSSLENRGRLAEELKRADAVVLTYACDQPATLNRLSSFWLHELRRLEIRA  117

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            PVIV GC LD+RD +  +++E  MLP+MQQFREIETCIECSA
Sbjct  118  PVIVAGCKLDRRDAEYNLSVE--MLPLMQQFREIETCIECSA  157



>ref|XP_007162421.1| hypothetical protein PHAVU_001G150700g [Phaseolus vulgaris]
 gb|ESW34415.1| hypothetical protein PHAVU_001G150700g [Phaseolus vulgaris]
Length=643

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  SGVRV+VAGD  TGKSSLI A ATESFP SV PV+PPT LP D++PD VPLT+IDT 
Sbjct  8    GGRSGVRVVVAGDRATGKSSLIAAIATESFPESVTPVIPPTLLPPDLYPDNVPLTVIDTP  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS + +    EE+ RADAVVLTYAC+  A+  RLS+YW PEL++LEVK PV+VVGC LD 
Sbjct  68   SSLDKQSKRNEELKRADAVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVVVVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            RD+ Q ++LE++M  ++QQF+EI TCIECSA
Sbjct  128  RDESQQVSLERLMTQLLQQFKEIVTCIECSA  158



>ref|XP_010094555.1| Mitochondrial Rho GTPase 2 [Morus notabilis]
 gb|EXB56309.1| Mitochondrial Rho GTPase 2 [Morus notabilis]
Length=600

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 3/157 (2%)
 Frame = +3

Query  126  GSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPL  305
            GS N  G    VR++VAGD  T K+SLI   A + +  +VP + PPT +P+D +P RVP+
Sbjct  4    GSLNRSGR---VRIVVAGDHGTRKTSLINTVAAKKYSVNVPALSPPTVVPEDSYPGRVPI  60

Query  306  TIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVV  485
            T+IDTSS P++ G + +E+ RAD VVLTYACD+P TLDRLS++WLP++R+LEVK PVIVV
Sbjct  61   TMIDTSSLPQHIGNVAKELKRADTVVLTYACDQPQTLDRLSSFWLPQIRQLEVKVPVIVV  120

Query  486  GCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            GC  D RD+ Q  NLEQVM PI QQF  IET IECSA
Sbjct  121  GCKHDLRDENQQFNLEQVMSPIKQQFPVIETYIECSA  157



>ref|XP_009367695.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=642

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAG+  TGKS+LI A AT++F  +VPPVLPP RL  D+FPD VPLTIIDTS
Sbjct  8    GKRTGVRVVVAGERGTGKSTLIAAVATDAFDPAVPPVLPPXRLAADMFPDHVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     +E+ RAD VVLTYACD+P TL RL+TYWL ELR LEVK PVI+VGC LD 
Sbjct  68   SSLENCSKRNDELNRADVVVLTYACDQPMTLTRLTTYWLLELRHLEVKVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM QFREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMAPIMHQFREIQTCIECSA  158



>ref|XP_009367694.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=649

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  +GVRV+VAG+  TGKS+LI A AT++F  +VPPVLPP RL  D+FPD VPLTIIDTS
Sbjct  8    GKRTGVRVVVAGERGTGKSTLIAAVATDAFDPAVPPVLPPXRLAADMFPDHVPLTIIDTS  67

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            SS EN     +E+ RAD VVLTYACD+P TL RL+TYWL ELR LEVK PVI+VGC LD 
Sbjct  68   SSLENCSKRNDELNRADVVVLTYACDQPMTLTRLTTYWLLELRHLEVKVPVILVGCKLDL  127

Query  504  RDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            R+ Q+ +++EQVM PIM QFREI+TCIECSA
Sbjct  128  RNPQEQMSMEQVMAPIMHQFREIQTCIECSA  158



>ref|XP_004495205.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cicer arietinum]
Length=643

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            S VR++V GD KTGKS+LI   A++S+  +VP  L P RLP++ FPD V L +IDT SS 
Sbjct  14   SEVRIVVLGDMKTGKSTLIATMASDSYQNNVPSFLSPLRLPNNSFPDSVSLVVIDTPSSE  73

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
                 + EE+ RADAV++TY C+KPAT +R+ST+WLP+L+RLEVKAPVIVVGC LD RD 
Sbjct  74   RQLDMVTEELSRADAVIVTYDCNKPATFERVSTHWLPKLQRLEVKAPVIVVGCKLDLRDV  133

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             + +NLE +   IMQQFRE+ TCIECSA
Sbjct  134  SKEVNLESLTTNIMQQFREVVTCIECSA  161



>gb|KHN45356.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=654

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = +3

Query  165  VIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRG  344
            V V GD  TGKSSLI A ATESF  +VPPVLPPT L  D++PD VPLT++DT SS E + 
Sbjct  26   VAVDGDRATGKSSLIAAIATESFAEAVPPVLPPTLLAPDLYPDTVPLTVVDTPSSLEKQR  85

Query  345  TLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAI  524
               EE+  AD VVLTYAC+  A+  RLS+YW PEL++LEVK PVIVVGC LD RD+ Q +
Sbjct  86   KRNEELKAADVVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVIVVGCKLDLRDESQQV  145

Query  525  NLEQVMLPIMQQFREIETCIECSA  596
            +LE VM  ++QQF+EI TCIECSA
Sbjct  146  SLECVMTQLLQQFKEIVTCIECSA  169



>ref|XP_001767645.1| predicted protein [Physcomitrella patens]
 gb|EDQ67604.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            + ++V+V GD   GKSS+IL  AT+SF   VP VLPPTRLP D +PD VPL+I DTS+ P
Sbjct  11   TSIQVVVIGDAGVGKSSMILTIATDSFAEGVPHVLPPTRLPTDFYPDGVPLSIFDTSARP  70

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLE------VKAPVIVVGCM  494
            E++  L  E+ +AD VVLTYACD+P TL RLS YWLPELRRLE      +  PVIVVGC 
Sbjct  71   EDKSKLDMELKKADVVVLTYACDQPVTLARLSKYWLPELRRLEATLLLQLNLPVIVVGCK  130

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            LD RD+++  +LE+ M P+MQ+F+EIETC+ CSA
Sbjct  131  LDLRDERKP-SLEESMAPLMQEFQEIETCMMCSA  163



>ref|XP_003590652.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES60903.1| Rho GTPase [Medicago truncatula]
Length=640

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GK++LI A A++SFPA+VPP+L PT LP + F D VPL +IDT SS   
Sbjct  13   VRIVIVGDKSAGKTTLISAMASDSFPATVPPLLRPTHLPSNSFTDSVPLILIDTPSSVGE  72

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +G + EE+ RAD+V++TYACD   + +R+ST+WLP+L++LEVKAPV+VVGC LD RD+ +
Sbjct  73   QGKVVEELKRADSVIVTYACDNTMSFERVSTHWLPQLQKLEVKAPVLVVGCKLDLRDESR  132

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
             ++LE +   IM QFRE+ TCIECSA
Sbjct  133  QVSLESLTTGIMNQFREVVTCIECSA  158



>ref|XP_001779282.1| predicted protein [Physcomitrella patens]
 gb|EDQ55884.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +3

Query  195  KSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRAD  374
            KSS+ILA AT+SF   VP VLPPTRLP D +PD VPL+I D+SS PE++  L  E+ +AD
Sbjct  25   KSSMILAIATDSFAEGVPHVLPPTRLPTDFYPDCVPLSIYDSSSRPEDKSKLDMELKKAD  84

Query  375  AVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIM  554
             VVLTYACD+P TL RLS+YWLPELRRL++  PVIVVGC LD RD  Q  +LE++M P+M
Sbjct  85   VVVLTYACDQPETLTRLSSYWLPELRRLKLNLPVIVVGCKLDLRDVCQP-SLEEMMAPLM  143

Query  555  QQFREIETCIECSA  596
            Q+FREIETCIECSA
Sbjct  144  QKFREIETCIECSA  157



>ref|XP_004493664.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Cicer 
arietinum]
Length=648

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            SGVRV+VAGD  TGKSSLI A A++SF   VP +LPPT L  D FPD VPLTIIDTSSS 
Sbjct  9    SGVRVVVAGDRGTGKSSLIAAIASDSFSDDVPSLLPPTLLSADFFPDNVPLTIIDTSSSL  68

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +    EE+  AD VVLTYAC+   +  RLS+YW  EL+ LEVKAPVIVVGC LD RD+
Sbjct  69   EKQNKRNEELKGADVVVLTYACNDSQSFLRLSSYWFRELQSLEVKAPVIVVGCKLDLRDE  128

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LE++M  ++Q+ + + TCIECSA
Sbjct  129  SQQVSLERLMTQLLQERKSVGTCIECSA  156



>ref|XP_004493665.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Cicer 
arietinum]
Length=641

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  153  SGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSP  332
            SGVRV+VAGD  TGKSSLI A A++SF   VP +LPPT L  D FPD VPLTIIDTSSS 
Sbjct  9    SGVRVVVAGDRGTGKSSLIAAIASDSFSDDVPSLLPPTLLSADFFPDNVPLTIIDTSSSL  68

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +    EE+  AD VVLTYAC+   +  RLS+YW  EL+ LEVKAPVIVVGC LD RD+
Sbjct  69   EKQNKRNEELKGADVVVLTYACNDSQSFLRLSSYWFRELQSLEVKAPVIVVGCKLDLRDE  128

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
             Q ++LE++M  ++Q+ + + TCIECSA
Sbjct  129  SQQVSLERLMTQLLQERKSVGTCIECSA  156



>gb|KHN03795.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=735

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  219  ATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYAC  398
            A+ESFP SVPPVLPPTRLP ++FPD VPLT+IDT SS   +GT  EE+  AD VVLTYAC
Sbjct  2    ASESFPKSVPPVLPPTRLPRNLFPDSVPLTLIDTPSSLAKQGTRNEELKLADTVVLTYAC  61

Query  399  DKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIET  578
            D+P + +R++TYWLPEL +LEVKAPVIVVGC LD RD+ Q ++LE +   IM+QF E+ T
Sbjct  62   DEPVSFERVTTYWLPELHKLEVKAPVIVVGCKLDLRDENQLVSLESLTTHIMKQFTEVVT  121

Query  579  CIECSA  596
            C+ECSA
Sbjct  122  CVECSA  127



>ref|XP_006298991.1| hypothetical protein CARUB_v10015117mg [Capsella rubella]
 gb|EOA31889.1| hypothetical protein CARUB_v10015117mg [Capsella rubella]
Length=648

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
             G  N++G+   +R++V G+  TGKSSLILAAA  +F  ++ P+LP T LP + FPDR+P
Sbjct  3    NGVGNSRGSSKPMRIVVVGEKGTGKSSLILAAARNTFHPNIAPLLPYTNLPSEFFPDRIP  62

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
             T+IDTSS  E++G + +E+ +ADA+VLT+A D+P TLDRLS +WLP  R+LEV+ P+IV
Sbjct  63   ATVIDTSSRLEDKGKVVKEVKQADAIVLTFAFDRPETLDRLSDHWLPLFRQLEVRVPIIV  122

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             GC +D       I++EQ+  P+MQQ+RE+ET I+ SA
Sbjct  123  AGCNIDSNGACNQISIEQITSPMMQQYREVETSIQWSA  160



>gb|EMS67255.1| Mitochondrial Rho GTPase 1 [Triticum urartu]
Length=623

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +3

Query  255  LPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTY  434
            +P TRLP D FPDRVP+TI+DTSSSPE +  L  E   ADAVVLTYACD+ +TLDRLS+Y
Sbjct  1    MPHTRLPADYFPDRVPITIVDTSSSPEQKPKLIAECQAADAVVLTYACDRLSTLDRLSSY  60

Query  435  WLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            WLPELRR+++KAPVIVVGC LD RDDQQ  +LEQ M PIMQ FREIETCIECSA
Sbjct  61   WLPELRRIQLKAPVIVVGCKLDLRDDQQN-SLEQTMAPIMQSFREIETCIECSA  113



>gb|EMT05838.1| Mitochondrial Rho GTPase 1 [Aegilops tauschii]
Length=611

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +3

Query  255  LPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTY  434
            +P TRLP D FPDRVP+TI+DTSSSPE +  L  E   ADAVVLTYACD+ +TLDRLS+Y
Sbjct  1    MPHTRLPADYFPDRVPITIVDTSSSPEQKPKLIAECQAADAVVLTYACDRLSTLDRLSSY  60

Query  435  WLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            WLPELRR+++KAPVIVVGC LD RDDQQ  +LEQ M PIMQ FREIETCIECSA
Sbjct  61   WLPELRRIQLKAPVIVVGCKLDLRDDQQN-SLEQTMAPIMQAFREIETCIECSA  113



>gb|KHN18884.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=425

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  219  ATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYAC  398
            ATE FP SVPPVLPPTRLP ++FPD VPLT+I++ SS   +G   EE+ RADAVVLTYAC
Sbjct  24   ATEPFPKSVPPVLPPTRLPHNLFPDSVPLTLIESPSSLAKQGARNEELKRADAVVLTYAC  83

Query  399  DKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIET  578
            D+P + +R+ TYWLPEL++LEVK PVIVVGC LD RD+ Q ++LE +   IM+ F E+ T
Sbjct  84   DEPVSFERVITYWLPELQKLEVKVPVIVVGCKLDLRDENQLVSLESLTTHIMKHFIEVVT  143

Query  579  CIECSA  596
            C+ECSA
Sbjct  144  CVECSA  149



>ref|XP_006575867.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
Length=459

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  219  ATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYAC  398
            ATE FP SVPPVLPPTRLP ++FPD VPLT+I++ SS   +G   EE+ RADAVVLTYAC
Sbjct  27   ATEPFPKSVPPVLPPTRLPHNLFPDSVPLTLIESPSSLAKQGARNEELKRADAVVLTYAC  86

Query  399  DKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIET  578
            D+P + +R+ TYWLPEL++LEVK PVIVVGC LD RD+ Q ++LE +   IM+ F E+ T
Sbjct  87   DEPVSFERVITYWLPELQKLEVKVPVIVVGCKLDLRDENQLVSLESLTTHIMKHFIEVVT  146

Query  579  CIECSA  596
            C+ECSA
Sbjct  147  CVECSA  152



>ref|XP_004290658.1| PREDICTED: mitochondrial Rho GTPase 2 [Fragaria vesca subsp. 
vesca]
Length=645

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI++ ATE+FP S+PPVLPPT LP D++PDRVP+TIIDTSSS ++     EE+ R
Sbjct  24   TGKSSLIVSLATETFPESLPPVLPPTTLPADLYPDRVPVTIIDTSSSLDSGVKRSEELKR  83

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            AD V+LTYACD+P TLDR+S YWLPELRRLEV  PVI+VGC +D RD+   I++EQ M P
Sbjct  84   ADVVMLTYACDQPITLDRISGYWLPELRRLEVNVPVILVGCKMDLRDEHDPISMEQAMTP  143

Query  549  IMQQFREIETCIECSA  596
            IMQ +R+IETCIECSA
Sbjct  144  IMQAYRQIETCIECSA  159



>ref|XP_001778992.1| predicted protein [Physcomitrella patens]
 gb|EDQ56138.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            + +G  S  +V+V GD  TGKS LI+A AT+SFP   PPVLPPT LP D +P RV LTI+
Sbjct  5    DGQGARSRCQVVVVGDHGTGKSGLIIALATDSFPDKPPPVLPPTCLPPDFYPSRVSLTIV  64

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSS  +++     E  +ADA+VLTY+ D P TLDRLSTYWLPELRRLE+K P++VVGC 
Sbjct  65   DTSSRQQDKIKTETECKKADAIVLTYSDDLPRTLDRLSTYWLPELRRLEIKVPIVVVGCK  124

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            LD  DD+Q+ ++EQ+M P+MQ++REIET IECSA
Sbjct  125  LDLHDDRQS-DIEQIMAPLMQEYREIETIIECSA  157



>ref|XP_003571671.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brachypodium distachyon]
Length=635

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            G+RV+V GDP TGKSSLI+A A   +P + P V+PPTRLP D+FP+R+P+T++DTSSS  
Sbjct  10   GLRVVVVGDPGTGKSSLIVALAANQYPVTPPRVVPPTRLPVDLFPERIPITVVDTSSSEG  69

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ  515
                L  E   ADAVVLTYACD P TLDRLS++WLP+LR  +VK PVIV GC LD +D+Q
Sbjct  70   RTAELITECQAADAVVLTYACDSPETLDRLSSFWLPKLRSCQVKVPVIVAGCKLDLKDEQ  129

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
            Q  +L Q + PIMQ F EIETCIECSA
Sbjct  130  QG-DLAQAVEPIMQSFGEIETCIECSA  155



>ref|XP_006651944.1| PREDICTED: mitochondrial Rho GTPase 1-like [Oryza brachyantha]
Length=123

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  156  GVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPE  335
            GVRV+V GDP TGKSSL+++ ATE+FP +VP V+PPTRLP D FPDRVP+TI+DTSSSPE
Sbjct  15   GVRVVVIGDPGTGKSSLVVSVATEAFPENVPRVMPPTRLPADYFPDRVPITIVDTSSSPE  74

Query  336  NRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
             R  L  E   ADAVVLTYACD+PATL+RLST+WLPELRRL+ +A
Sbjct  75   QRAKLIAECQAADAVVLTYACDRPATLERLSTFWLPELRRLQGRA  119



>ref|XP_003520566.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
Length=644

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +3

Query  123  GGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVP  302
               S++ G  SGVRV+VAGD  TGKSSLI A ATESF  +VPPVLPPT LP D++PD VP
Sbjct  2    ANHSSSFGGRSGVRVVVAGDRATGKSSLIAAIATESFAEAVPPVLPPTLLPPDLYPDAVP  61

Query  303  LTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIV  482
            LT++DT SS E +    EE+  AD VVLTYAC+  A+  RLS+YW PEL++LEVK PVIV
Sbjct  62   LTVVDTPSSLEKQRKRNEELKGADVVVLTYACNDTASFSRLSSYWFPELQKLEVKVPVIV  121

Query  483  VGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            VGC LD RD+ Q ++LE+VM  ++QQF+EI TCIECSA
Sbjct  122  VGCKLDLRDESQEVSLERVMTQLLQQFKEIVTCIECSA  159



>ref|NP_187182.1| MIRO-related GTP-ase 3 [Arabidopsis thaliana]
 sp|Q9MA88.1|MIRO3_ARATH RecName: Full=Mitochondrial Rho GTPase 3; Short=AtMIRO3; AltName: 
Full=Miro-related GTPase 3 [Arabidopsis thaliana]
 gb|AAF27037.1|AC009177_27 unknown protein [Arabidopsis thaliana]
 gb|AEE74218.1| MIRO-related GTP-ase 3 [Arabidopsis thaliana]
Length=648

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = +3

Query  126  GSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPL  305
            G  ++ G+   +R++V G+  +GKSSLI+AAA  +F  ++P +LP T LP + FPDR+P 
Sbjct  4    GVGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPA  63

Query  306  TIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVV  485
            T+IDTSS PE++G + +E+ +ADA+VLT+A D+P TLDRLS YWLP  R+LEV+ P+IV 
Sbjct  64   TVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVA  123

Query  486  GCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            G  +D ++     ++EQ+   +M+Q+RE+ET I+ SA
Sbjct  124  GYEVDNKEAYNHFSIEQITSALMKQYREVETSIQWSA  160



>ref|XP_002882407.1| hypothetical protein ARALYDRAFT_477819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58666.1| hypothetical protein ARALYDRAFT_477819 [Arabidopsis lyrata subsp. 
lyrata]
Length=647

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 114/157 (73%), Gaps = 0/157 (0%)
 Frame = +3

Query  126  GSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPL  305
            G  +  G+   +R++V G+  +GKSSLI+AAA  +F  ++P +LP T LP + FPDR+P 
Sbjct  4    GVGDYSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPA  63

Query  306  TIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVV  485
            T+IDTSS PE++G + +E+ +ADA+VLT+A D+P TLDRLS +WLP  R+LEV+ P+IV 
Sbjct  64   TVIDTSSRPEDKGKVLKEVKQADAIVLTFAFDRPETLDRLSKHWLPLFRQLEVRVPIIVA  123

Query  486  GCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            G  +D ++     ++EQ+  P+MQ++RE+ET I+ SA
Sbjct  124  GYEVDSKEAYNQTSIEQITSPMMQRYREVETSIQWSA  160



>ref|XP_010464053.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=650

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            +++G+   +R++V G+  TGKSSLI+AAA  +F  ++  +LP T LP + FPDR+P T+I
Sbjct  7    DSRGSPKPMRIVVVGEKGTGKSSLIMAAARNTFHPNIASLLPYTNLPSEFFPDRIPATVI  66

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSS  E++G + +E+ +ADA+VLT+A D+P TL+RLS +WLP  R+LEV+ P+IV G +
Sbjct  67   DTSSRLEDKGKVVKEVKQADAIVLTFAFDRPETLERLSDHWLPLFRQLEVRVPIIVAGYI  126

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +D   D   I++EQ+  P+MQQ+RE+ET I+ SA
Sbjct  127  VDSNGDCDQISIEQITSPMMQQYREVETSIQWSA  160



>gb|KEH23754.1| Rho GTPase [Medicago truncatula]
Length=467

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDT  320
            K + + VRV+VAGD  TGKSSLI A A+ESFP +V PVLPPT LP D FPD VP+T+IDT
Sbjct  3    KTDRNAVRVVVAGDRGTGKSSLIAAIASESFPDTVLPVLPPTLLPADYFPDHVPITVIDT  62

Query  321  SSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLD  500
            SSS E +    EE+  AD VVLTYAC+   +  RLS+YW  EL++LEV  P+IVVGC LD
Sbjct  63   SSSLEKQNKRNEELKGADVVVLTYACNDSQSFSRLSSYWFRELQKLEVTVPIIVVGCKLD  122

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             RD+ Q ++LE++M  ++Q+F+ + TCIECSA
Sbjct  123  LRDESQQVSLERLMAQLLQEFKNVATCIECSA  154



>ref|XP_003613772.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=682

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 2/163 (1%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            L A   S    G+ +GVR++VAG+  TGKS+LI AAA+  F  +V  +L P RLP     
Sbjct  2    LRASSKSVQPHGHHTGVRIVVAGEKCTGKSTLIRAAASNKFEKNVGRLLRPIRLPIHHCV  61

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+T++DT     +R  +F+E+ RAD VVLTYACD+P TL  L+ +WLP LR L+V+ 
Sbjct  62   DHLPITVVDTRIDGSDR--VFKELKRADIVVLTYACDRPYTLTSLTIFWLPLLRNLKVRV  119

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q  NLE  M  IM QF EIE   ECSAY
Sbjct  120  PVIVVGCKLDLRDENQQENLEHGMSQIMLQFHEIEAYFECSAY  162



>gb|AES96730.2| Rho GTPase-like protein [Medicago truncatula]
Length=656

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 2/163 (1%)
 Frame = +3

Query  111  LMAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFP  290
            L A   S    G+ +GVR++VAG+  TGKS+LI AAA+  F  +V  +L P RLP     
Sbjct  2    LRASSKSVQPHGHHTGVRIVVAGEKCTGKSTLIRAAASNKFEKNVGRLLRPIRLPIHHCV  61

Query  291  DRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKA  470
            D +P+T++DT     +R  +F+E+ RAD VVLTYACD+P TL  L+ +WLP LR L+V+ 
Sbjct  62   DHLPITVVDTRIDGSDR--VFKELKRADIVVLTYACDRPYTLTSLTIFWLPLLRNLKVRV  119

Query  471  PVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
            PVIVVGC LD RD+ Q  NLE  M  IM QF EIE   ECSAY
Sbjct  120  PVIVVGCKLDLRDENQQENLEHGMSQIMLQFHEIEAYFECSAY  162



>gb|KEH23751.1| Rho GTPase [Medicago truncatula]
Length=643

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDT  320
            K + + VRV+VAGD  TGKSSLI A A+ESFP +V PVLPPT LP D FPD VP+T+IDT
Sbjct  3    KTDRNAVRVVVAGDRGTGKSSLIAAIASESFPDTVLPVLPPTLLPADYFPDHVPITVIDT  62

Query  321  SSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLD  500
            SSS E +    EE+  AD VVLTYAC+   +  RLS+YW  EL++LEV  P+IVVGC LD
Sbjct  63   SSSLEKQNKRNEELKGADVVVLTYACNDSQSFSRLSSYWFRELQKLEVTVPIIVVGCKLD  122

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             RD+ Q ++LE++M  ++Q+F+ + TCIECSA
Sbjct  123  LRDESQQVSLERLMAQLLQEFKNVATCIECSA  154



>ref|XP_006408091.1| hypothetical protein EUTSA_v10020270mg [Eutrema salsugineum]
 gb|ESQ49544.1| hypothetical protein EUTSA_v10020270mg [Eutrema salsugineum]
Length=644

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +3

Query  126  GSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPL  305
            G    +G++  +R++V G+  TGKSSLI AAA   F + VPP+LP T LP ++  D +P 
Sbjct  4    GVGEPRGSLKPIRIVVVGEKGTGKSSLIKAAADGFFHSKVPPLLPHTNLPSELSSDPIPA  63

Query  306  TIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVV  485
            TI+DTSS P+++G + +E+  ADA+VLT+A D+  T+DRLS YWLP  R+LEV+ P+IV 
Sbjct  64   TIVDTSSRPKDKGKVIKEVKEADAIVLTFAFDRQETVDRLSEYWLPLFRQLEVRVPIIVA  123

Query  486  GCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            G  +D       I++EQ+  PIMQQ+REIET IE SA
Sbjct  124  GYKVDVNGVYNQISIEQITTPIMQQYREIETSIEWSA  160



>gb|KEH23750.1| Rho GTPase [Medicago truncatula]
Length=639

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDT  320
            K + + VRV+VAGD  TGKSSLI A A+ESFP +V PVLPPT LP D FPD VP+T+IDT
Sbjct  3    KTDRNAVRVVVAGDRGTGKSSLIAAIASESFPDTVLPVLPPTLLPADYFPDHVPITVIDT  62

Query  321  SSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLD  500
            SSS E +    EE+  AD VVLTYAC+   +  RLS+YW  EL++LEV  P+IVVGC LD
Sbjct  63   SSSLEKQNKRNEELKGADVVVLTYACNDSQSFSRLSSYWFRELQKLEVTVPIIVVGCKLD  122

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             RD+ Q ++LE++M  ++Q+F+ + TCIECSA
Sbjct  123  LRDESQQVSLERLMAQLLQEFKNVATCIECSA  154



>gb|KEH23752.1| Rho GTPase [Medicago truncatula]
Length=567

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDT  320
            K + + VRV+VAGD  TGKSSLI A A+ESFP +V PVLPPT LP D FPD VP+T+IDT
Sbjct  3    KTDRNAVRVVVAGDRGTGKSSLIAAIASESFPDTVLPVLPPTLLPADYFPDHVPITVIDT  62

Query  321  SSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLD  500
            SSS E +    EE+  AD VVLTYAC+   +  RLS+YW  EL++LEV  P+IVVGC LD
Sbjct  63   SSSLEKQNKRNEELKGADVVVLTYACNDSQSFSRLSSYWFRELQKLEVTVPIIVVGCKLD  122

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             RD+ Q ++LE++M  ++Q+F+ + TCIECSA
Sbjct  123  LRDESQQVSLERLMAQLLQEFKNVATCIECSA  154



>gb|KEH23753.1| Rho GTPase [Medicago truncatula]
Length=563

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +3

Query  141  KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDT  320
            K + + VRV+VAGD  TGKSSLI A A+ESFP +V PVLPPT LP D FPD VP+T+IDT
Sbjct  3    KTDRNAVRVVVAGDRGTGKSSLIAAIASESFPDTVLPVLPPTLLPADYFPDHVPITVIDT  62

Query  321  SSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLD  500
            SSS E +    EE+  AD VVLTYAC+   +  RLS+YW  EL++LEV  P+IVVGC LD
Sbjct  63   SSSLEKQNKRNEELKGADVVVLTYACNDSQSFSRLSSYWFRELQKLEVTVPIIVVGCKLD  122

Query  501  KRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             RD+ Q ++LE++M  ++Q+F+ + TCIECSA
Sbjct  123  LRDESQQVSLERLMAQLLQEFKNVATCIECSA  154



>ref|XP_010485971.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 112/154 (73%), Gaps = 0/154 (0%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            +++G+   +R++V G+  TGKSSLI+AAA  +F  ++  +LP T LP + FPDR+P T+I
Sbjct  7    DSRGSPKPMRIVVVGEKGTGKSSLIMAAARNTFNPNIAFLLPYTNLPSEFFPDRIPATVI  66

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSS  E++G + +E+ +ADA+VLT+A D+P TLDRLS +WLP  R+LEV+ P+IV G  
Sbjct  67   DTSSRLEDKGKVVKEVKQADAIVLTFAFDRPETLDRLSDHWLPLFRQLEVRVPIIVAGYT  126

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +D       I++EQ+  P+MQQ+RE+ET I+ SA
Sbjct  127  VDINGACDQISIEQITSPMMQQYREVETSIQWSA  160



>gb|KEH32598.1| Rho GTPase-like protein [Medicago truncatula]
Length=651

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 101/149 (68%), Gaps = 2/149 (1%)
 Frame = +3

Query  150  ISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSS  329
            ++G+R++VAGD  TGKSSLI   A  +    VPPVL PT LP  + PD VP TIIDTSS 
Sbjct  17   LTGIRIVVAGDDGTGKSSLIATFAAGNSVKDVPPVLTPTILPKSMSPDGVPFTIIDTSSR  76

Query  330  PENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD  509
            PE+   + EE++ AD ++LTYACD+ ATL+ L+ +WLP LR L VK PVIV  C L  + 
Sbjct  77   PEDSDKVDEELLAADVIILTYACDRQATLESLTAFWLPRLRDLGVKVPVIVAACKL--QH  134

Query  510  DQQAINLEQVMLPIMQQFREIETCIECSA  596
            + Q   +E+ M P+MQQF EIE  I CSA
Sbjct  135  ENQKAGIEEAMQPVMQQFPEIEISIGCSA  163



>ref|XP_010242349.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
Length=628

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 101/154 (66%), Gaps = 17/154 (11%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            N  GN   V+  +   P+     +I+      +                   DRVPLTII
Sbjct  7    NGNGNFQSVQAAINFVPEGNSQWIIIHVRKGEYSG-----------------DRVPLTII  49

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSS  ++R TL EE+  ADAVVLTYACD+P TLDRLST+WLPELRRLEVK PV+VVGC 
Sbjct  50   DTSSXFDSRNTLAEELKHADAVVLTYACDQPETLDRLSTFWLPELRRLEVKVPVVVVGCK  109

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            LD RDD Q ++LEQVM PIMQQFREIETCIECSA
Sbjct  110  LDLRDDNQQVSLEQVMSPIMQQFREIETCIECSA  143



>ref|XP_010425682.1| PREDICTED: mitochondrial Rho GTPase 1 [Camelina sativa]
Length=649

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = +3

Query  135  NAKGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTII  314
            +++G+   +R+ V G+  TGKSSLI+AAA  +F  ++  +LP T LP + FPDR+P T+I
Sbjct  7    DSRGSPKPMRIAVVGEKGTGKSSLIMAAARNTFHPNIASLLPYTNLPSEFFPDRMPATVI  66

Query  315  DTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
            DTSS   ++G + +E+ +ADA+VLT+A D+  TLDRLS +WLP  R+LEV+ P+IV G +
Sbjct  67   DTSSRLGDKGKVVKEVKQADAIVLTFAFDRLETLDRLSDHWLPLFRQLEVRVPIIVAGYI  126

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            +D  +    I++EQ+  P+MQQ+RE+ET I+ SA
Sbjct  127  VDSNEACDQISIEQITSPMMQQYREVETSIQWSA  160



>ref|XP_005702894.1| Miro (mitochondrial Rho) protein (GTPase/ calcium ion binding) 
[Galdieria sulphuraria]
 gb|EME26374.1| Miro (mitochondrial Rho) protein (GTPase/ calcium ion binding) 
[Galdieria sulphuraria]
Length=648

 Score =   154 bits (389),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR++V GDPK GKSSLI    +ESF   V PVLP   +P ++ P+RV ++I+DTSSSPE 
Sbjct  5    VRIVVVGDPKVGKSSLIKTLISESFEDEVQPVLPTVVIPPEVTPERVHVSIVDTSSSPEE  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L EE+ +AD +VL Y   K  TLDR S+YWLP LRRL V  PV++VG  +D R    
Sbjct  65   RHKLEEEIRKADVLVLVYDVSKRETLDRASSYWLPTLRRLGVTVPVVLVGNKIDVRGIGA  124

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
              +LE ++ PIM +FRE++ CIECSA
Sbjct  125  DHSLEHLIKPIMDEFREVDVCIECSA  150



>ref|XP_003613256.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES96214.1| Rho GTPase-like protein [Medicago truncatula]
Length=621

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 98/147 (67%), Gaps = 18/147 (12%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            V V+VAGD  TGK+SL+  A                  P  +  D VP+ IIDTSS  E+
Sbjct  11   VHVVVAGDSGTGKTSLVHGA------------------PRFLHCDGVPIKIIDTSSRTED  52

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
               + EE+ RAD+VVLTYACD+  TL+ L+T+WLP LR+LEVKAPVIV GC LD  D+ Q
Sbjct  53   TDKVAEELQRADSVVLTYACDRSETLENLTTFWLPRLRKLEVKAPVIVAGCKLDLLDENQ  112

Query  519  AINLEQVMLPIMQQFREIETCIECSAY  599
             ++LEQVM P+MQQF EI+ C+ECS+Y
Sbjct  113  QVSLEQVMSPLMQQFCEIQACVECSSY  139



>emb|CDY40707.1| BnaC03g34230D [Brassica napus]
Length=666

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 121/195 (62%), Gaps = 10/195 (5%)
 Frame = +3

Query  21   LHNYLSINIIYLFWY*GLGFTYKFIRSRGELMAGGGSSNAKGNISGVRVIVAGDPKTGKS  200
            + +Y+++N++Y   Y  +    + +R    ++  GGS + K     VR++V G+  TGK+
Sbjct  1    MSSYMTMNMLYSEKYFDICLQNQMMR----MLGLGGSGSPKP----VRIVVVGEKGTGKT  52

Query  201  SLILAAATESFPA--SVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMRAD  374
            SLI+AA  ES     ++PPVLP T  P + F D +P TIIDTSS PE+R  + +E+  AD
Sbjct  53   SLIIAALNESSQPQPNIPPVLPYTTFPSEWFRDPIPATIIDTSSKPEDREKVVKEVKEAD  112

Query  375  AVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLPIM  554
            A+VLT+  D P TLDRLS YWLP  R+LEV+ P+I+ GC +  R+      +E +   I 
Sbjct  113  AIVLTFVVDIPETLDRLSEYWLPLFRQLEVRVPIIIAGCSVTNREYHNQSGMEIITTSIR  172

Query  555  QQFREIETCIECSAY  599
            +Q+ EIETC + SA+
Sbjct  173  EQYLEIETCFDWSAH  187



>gb|AAT77912.1| hypothetical protein [Oryza sativa Japonica Group]
Length=269

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 102/165 (62%), Gaps = 14/165 (8%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPA---SVPPVLPPTRLPDDI  284
            M    SS A   +  VRV V GD  TGKSSL+   AT  FP     V  VLPP RLP D 
Sbjct  1    MGVAWSSRAAAKLD-VRVAVIGDHGTGKSSLVATIATGRFPDQDDGVARVLPPARLPVDY  59

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRR-LE  461
            FP RVP+TI+DTSS              ADAVVLTYACD+P TL+R++T+WLP++RR L+
Sbjct  60   FPARVPVTIVDTSS---------RYCQTADAVVLTYACDRPNTLERITTFWLPKIRRLLQ  110

Query  462  VKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             K PVI+ GC +D  D QQ   LE V+  IM  FRE+E  +ECSA
Sbjct  111  SKVPVILAGCKVDLSDKQQQAGLENVLDFIMCTFREVEIYLECSA  155



>ref|XP_009124073.1| PREDICTED: mitochondrial Rho GTPase 2-like [Brassica rapa]
Length=635

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = +3

Query  120  GGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESF--PASVPPVLPPTRLPDDIFPD  293
            G G  ++ G+   VR++V G+ +T K+SLI+AA T+ +    ++PP+LP T+LP +   +
Sbjct  6    GFGLGDSNGSKKPVRIVVVGETETRKTSLIMAAVTDHYYPEPNIPPMLPYTKLPSEYCSE  65

Query  294  RVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAP  473
             VP+T+IDTSS PE++  +  E+  ADA+VLT+A D+  TLDRLS YWLP  R+LEV+ P
Sbjct  66   DVPVTLIDTSSRPEDKRDVIREVKEADAIVLTFAIDRQETLDRLSEYWLPLFRQLEVRVP  125

Query  474  VIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             IVV C    +++   +N+E++ LPI QQ +EIE CIE SA
Sbjct  126  -IVVACYSVIKNEHNPVNIEEITLPIRQQCQEIEICIEWSA  165



>ref|XP_005642921.1| hypothetical protein COCSUDRAFT_38657 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18377.1| hypothetical protein COCSUDRAFT_38657 [Coccomyxa subellipsoidea 
C-169]
Length=550

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VRV V GD + GK+SLI AAATESFP + PP+LP TRL  D  P+ VPL I DTSS PE+
Sbjct  7    VRVCVIGDSQVGKTSLITAAATESFPDNPPPLLPATRLGADATPEGVPLIITDTSSRPED  66

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            +  L    + +D ++L Y    P TL+R++  W+PEL+RL VK P+++VGC  D R   Q
Sbjct  67   KPALELACLNSDVIILAYDTGNPRTLNRITEVWVPELQRLGVKVPLLLVGCKSDLRPQDQ  126

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
              N++QV++P++ + +EIE+C++CSA
Sbjct  127  --NMQQVVVPVLAKCKEIESCLDCSA  150



>ref|XP_010098381.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXB74905.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=358

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 106/159 (67%), Gaps = 2/159 (1%)
 Frame = +3

Query  114  MAGGGSSNA--KGNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIF  287
            M  GG+  A   G  + VR++VAGD  TG+SSLI  AA  +   +VPP+LPP  L  + F
Sbjct  1    MWRGGTGRAILAGGRTRVRIVVAGDCGTGRSSLIATAAAMNPNVNVPPLLPPMILLQESF  60

Query  288  PDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVK  467
              + PLT++DTSS   +   +  E+ +AD+VVLTYAC +P T DRLST+WLP+LR LEVK
Sbjct  61   QPKAPLTLVDTSSRTVDFCKVAAELKQADSVVLTYACYQPHTFDRLSTFWLPKLRLLEVK  120

Query  468  APVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCI  584
             PVIVVGC  D RD  Q  NLEQVM P+ QQF EIE  +
Sbjct  121  VPVIVVGCKQDLRDKNQQFNLEQVMSPLKQQFPEIENYM  159



>emb|CDY66986.1| BnaAnng23350D [Brassica napus]
Length=643

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 104/164 (63%), Gaps = 5/164 (3%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPA--SVPPVLPPTRLPDDIF  287
            M G G S   G+   VR++V G+  TGK+SLI+AA  ES     ++PPVLP T  P + F
Sbjct  4    MLGLGYS---GSPKPVRIVVVGEKGTGKTSLIIAALNESSQPQPNIPPVLPYTTFPSEWF  60

Query  288  PDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVK  467
             D +P TIIDTSS PE+R  + +E+  ADA+VLT+  D   TLDRLS YWLP  R+LEV+
Sbjct  61   RDPIPATIIDTSSKPEDREKVVKEVKEADAIVLTFVVDIAETLDRLSEYWLPLFRQLEVR  120

Query  468  APVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
             P+I+ GC +  R+      +E +   I +Q+ EIETC + SA+
Sbjct  121  VPIILAGCSVTNREYHNQSGMEIITTSIREQYLEIETCFDWSAH  164



>dbj|GAC93572.1| hypothetical protein PHSY_001137 [Pseudozyma hubeiensis SY62]
Length=752

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSSPE+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSPEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            RG L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RGNLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>ref|XP_011389032.1| hypothetical protein UMAG_02638 [Ustilago maydis 521]
 sp|Q4PB75.1|GEM1_USTMA RecName: Full=Mitochondrial Rho GTPase 1; AltName: Full=GTPase 
EF-hand protein of mitochondria 1 [Ustilago maydis 521]
 gb|KIS69295.1| hypothetical protein UMAG_02638 [Ustilago maydis 521]
Length=752

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSSPE+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSPEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L V  PVI+VG  +D R  D 
Sbjct  65   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGVNVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>ref|XP_009134822.1| PREDICTED: mitochondrial Rho GTPase 2 [Brassica rapa]
Length=647

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPA--SVPPVLPPTRLPDDIF  287
            M G G S   G+   VR++V G+  TGK+SLI+AA  ES     ++PPVLP T  P + F
Sbjct  8    MLGLGYS---GSPKPVRIVVVGEKGTGKTSLIIAALNESSQPQPNIPPVLPYTTFPSEWF  64

Query  288  PDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVK  467
             D +P TIIDTSS PE+R  + +E+  ADA+VLT+  D   +L RLS YWLP  R+LEV+
Sbjct  65   RDPIPATIIDTSSKPEDREKVVKEVKEADAIVLTFIVDIAESLYRLSEYWLPLFRQLEVR  124

Query  468  APVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSAY  599
             P+I+ GC +  R+      +E +   I +Q+ EIETC + SA+
Sbjct  125  VPIIMAGCSVTNREYHNQSGIEIITTSIREQYLEIETCFDWSAH  168



>gb|KFH68549.1| hypothetical protein MVEG_05362 [Mortierella verticillata NRRL 
6337]
Length=628

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+LI +   ESF A+V  V+P   +P ++ PD V   I+D+S+ PEN
Sbjct  5    VRILLLGDNGVGKSTLITSLIKESFVANVQHVIPEVTIPPEVTPDNVTTHIVDSSTRPEN  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKR-DDQ  515
            R TL  E+ +A  + + YA D+PAT +RL  +WLP +R L V  PV++VG  +D R DD 
Sbjct  65   RDTLESEIRKAHVICIVYAIDEPATFNRLGAHWLPYIRSLGVNVPVVLVGNKIDLRGDDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  SNKCLEDEVVPIMNEFKEVETCVECSA  151



>gb|EST05554.1| Small GTPase - RAS protein [Pseudozyma brasiliensis GHG001]
Length=756

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSSPE+
Sbjct  6    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSPEH  65

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L V  PVI+VG  +D R  D 
Sbjct  66   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGVNVPVILVGNKIDLRSGDV  125

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  126  TNAALEDELAPVMAEFKEVETCVECSA  152



>ref|NP_001044775.1| Os01g0843300 [Oryza sativa Japonica Group]
 dbj|BAF06689.1| Os01g0843300 [Oryza sativa Japonica Group]
Length=597

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV+V GDP TGKSSL+++AATE   A+ P   PP   P              ++  PE 
Sbjct  16   LRVVVIGDPGTGKSSLVVSAATE---ATSPAYCPPPASPSTT--SPTASPSPSSTPPPEQ  70

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E   AD VVLTYACD+PATL+RLS++W PELRRL+++APVIVVGC LD R ++Q
Sbjct  71   RSKLIAECQSADVVVLTYACDQPATLERLSSFWFPELRRLQLEAPVIVVGCKLDLRGEEQ  130

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
               L+ VM PIM  FREIETCIECSA
Sbjct  131  G-TLDAVMAPIMVAFREIETCIECSA  155



>emb|CBQ73019.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=752

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSSPE+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSPEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>dbj|BAD81741.1| putative mitochondrial Rho 1 [Oryza sativa Japonica Group]
Length=594

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            +RV+V GDP TGKSSL+++AATE   A+ P   PP   P              ++  PE 
Sbjct  16   LRVVVIGDPGTGKSSLVVSAATE---ATSPAYCPPPASPSTT--SPTASPSPSSTPPPEQ  70

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E   AD VVLTYACD+PATL+RLS++W PELRRL+++APVIVVGC LD R ++Q
Sbjct  71   RSKLIAECQSADVVVLTYACDQPATLERLSSFWFPELRRLQLEAPVIVVGCKLDLRGEEQ  130

Query  519  AINLEQVMLPIMQQFREIETCIECSA  596
               L+ VM PIM  FREIETCIECSA
Sbjct  131  G-TLDAVMAPIMVAFREIETCIECSA  155



>gb|EPS66187.1| hypothetical protein M569_08590, partial [Genlisea aurea]
Length=298

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = +3

Query  327  SPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKR  506
            S ENRG + EE+ RADAVVLTYACD+P+TL+RLS++WL ELRRLE+ APVIVVGC LD+R
Sbjct  1    SLENRGRVAEELKRADAVVLTYACDQPSTLNRLSSFWLYELRRLEISAPVIVVGCKLDRR  60

Query  507  DDQQAINLEQVMLPIMQQFREIETCIECSA  596
             ++ ++++E  M+P+MQQFREIETC+ECSA
Sbjct  61   TEEYSLSVE--MVPLMQQFREIETCVECSA  88



>gb|EEE55655.1| hypothetical protein OsJ_04046 [Oryza sativa Japonica Group]
Length=628

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 98/154 (64%), Gaps = 9/154 (6%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESF-PASVPPVLPPTRLPDDIFPDRVPLTIIDTSSS--  329
            +RV+V GDP TGKSSL+++AATE+  PA  PP   P+       P               
Sbjct  16   LRVVVIGDPGTGKSSLVVSAATEATSPAYCPPPASPSTTSPTASPSPSSTPPPGPPLPLT  75

Query  330  -----PENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCM  494
                 PE R  L  E   AD VVLTYACD+PATL+RLS++W PELRRL+++APVIVVGC 
Sbjct  76   LDLRVPEQRSKLIAECQSADVVVLTYACDQPATLERLSSFWFPELRRLQLEAPVIVVGCK  135

Query  495  LDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
            LD R ++Q   L+ VM PIM  FREIETCIECSA
Sbjct  136  LDLRGEEQG-TLDAVMAPIMVAFREIETCIECSA  168



>emb|CDI53495.1| conserved hypothetical protein [Melanopsichium pennsylvanicum 
4]
Length=756

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSS E+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKETYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSTEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+  +P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RANLEAELRRANVICIVYSISEPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>dbj|GAK64448.1| mitochondrial Rho 1 [Pseudozyma antarctica]
Length=752

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSS E+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSQEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RANLESELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>emb|CCF52858.1| uncharacterized protein UHOR_04215 [Ustilago hordei]
Length=750

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSSPE+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKETYVAIVQKVVPPITLPPEVAPEAVVTKIVDTSSSPEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ-  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R    
Sbjct  65   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGNV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>gb|ETS64793.1| hypothetical protein PaG_00757 [Pseudozyma aphidis DSM 70725]
Length=752

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSS E+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSQEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>dbj|GAC71821.1| predicted Ras related Rac-GTP binding protein [Pseudozyma antarctica 
T-34]
Length=752

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGDP  GKS+LI +   E++ A V  V+PP  LP ++ P+ V   I+DTSSS E+
Sbjct  5    VRIVLAGDPDVGKSTLITSLVKEAYVAKVQKVVPPITLPPEVAPEAVVTKIVDTSSSQEH  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  L  E+ RA+ + + Y+   P++ DR+ TYWLP +R L +  PVI+VG  +D R  D 
Sbjct  65   RANLEAELRRANVICIVYSISAPSSFDRIPTYWLPYIRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE  + P+M +F+E+ETC+ECSA
Sbjct  125  TNAALEDELAPVMAEFKEVETCVECSA  151



>gb|KDN47152.1| mitochondrial Rho GTPase 1 [Tilletiaria anomala UBC 951]
Length=810

 Score =   134 bits (337),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 66/147 (45%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++AGD   GKS+LI +   E + A V  VLP   LP ++ P+ V   I DTSSSPE 
Sbjct  5    VRIVLAGDANVGKSTLITSLIKEQYVARVQKVLPEITLPVEVAPEGVVTKISDTSSSPEK  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRD-DQ  515
            R  +  E+ RA+ + + Y+ + PA+ DR+  YWLP LR L +  PVI+VG  +D R  D 
Sbjct  65   RSHMESELRRANVICIVYSIEAPASFDRIPNYWLPYLRSLGINVPVILVGNKIDLRSGDV  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
                LE+ + PIM +F+E+ETC+ECSA
Sbjct  125  TNKALEEELAPIMTEFKEVETCVECSA  151



>ref|XP_005847786.1| hypothetical protein CHLNCDRAFT_133936 [Chlorella variabilis]
 gb|EFN55684.1| hypothetical protein CHLNCDRAFT_133936 [Chlorella variabilis]
Length=586

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +3

Query  144  GNISGVRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTS  323
            G  + V + V GD   GK+SLI AAATE+FP   PPVLPP RLP D  P+ VP+ I DTS
Sbjct  5    GGPNTVHICVVGDEGVGKTSLITAAATETFPDHPPPVLPPARLPADTTPEGVPVVITDTS  64

Query  324  SSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDK  503
            S PE++ +L      A  +VL ++ D+P TL R+S+YW+PELRRL V  PV++VGC  D 
Sbjct  65   SRPEDKQSLELSCQEASVIVLCFSADRPGTLRRISSYWMPELRRLGVHVPVMLVGCKSDV  124

Query  504  RDDQQAIN--LEQVMLPIMQQFREIETCIECSA  596
            R      +  L++ +LPI++ + +IETC+ECSA
Sbjct  125  RTPNPVADRGLQEAVLPIVKAYPQIETCMECSA  157



>dbj|BAJ94408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  333  ENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDD  512
            E +  L  E   ADAVVLTYACD+ +TLDRLS+YWLPELRR+++KAPVIVVGC LD RDD
Sbjct  155  EQKPKLIAECQAADAVVLTYACDRLSTLDRLSSYWLPELRRIQLKAPVIVVGCKLDLRDD  214

Query  513  QQAINLEQVMLPIMQQFREIETCIECSA  596
            QQ  +LEQ M PIMQ FREIETCIECSA
Sbjct  215  QQN-SLEQTMAPIMQSFREIETCIECSA  241



>gb|KDQ20950.1| hypothetical protein BOTBODRAFT_124842 [Botryobasidium botryosum 
FD-172 SS1]
Length=660

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF   V  ++P   +P ++ P+ V   I+D+S+ P++
Sbjct  5    VRILLVGDEGVGKSTIITSLIKESFVPHVQHIVPEVTIPPEVTPENVTTYIVDSSAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            RG L  E+ +A  + + YA D P + DRL TYWLP  R + V  PVI+VG  +D R  + 
Sbjct  65   RGHLDSELRKAHVICVVYAIDNPTSFDRLPTYWLPYFRSVGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM++F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMEEFKEVETCVECSA  151



>gb|KIJ54421.1| hypothetical protein M422DRAFT_58414 [Sphaerobolus stellatus 
SS14]
Length=643

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ES+ A V  ++P   +P ++ P+ V   I+DT + P++
Sbjct  5    VRIVLVGDTGVGKSTIITSLIKESYVAQVQHIVPEVTIPPEVTPENVTTYIVDTGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ-  515
            R  L  E+ +A  + + YA D P + DRL TYWLP  R L V  PVI+VG  +D R    
Sbjct  65   RPHLEAEIRKAHVICVVYAIDNPNSFDRLPTYWLPYFRSLGVNVPVILVGNKIDLRGGHV  124

Query  516  --QAINLEQVMLPIMQQFREIETCIECSA  596
              QA  LE+ +LPIM +F+E+ETC+ECSA
Sbjct  125  TNQA--LEEDILPIMNEFKEVETCVECSA  151



>gb|KIK06177.1| hypothetical protein K443DRAFT_286142 [Laccaria amethystina LaAM-08-1]
Length=645

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  ++P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHIVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RTHLESEIRKAHVICVVYSIDNPGSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIIPIMNEFKEVETCVECSA  151



>ref|XP_001876187.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR13689.1| predicted protein [Laccaria bicolor S238N-H82]
Length=645

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  ++P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHIVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RTHLESEIRKAHVICVVYSIDNPGSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIIPIMNEFKEVETCVECSA  151



>ref|XP_007380209.1| mitochondrial Rho GTPase [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN12642.1| mitochondrial Rho GTPase [Punctularia strigosozonata HHB-11173 
SS5]
Length=646

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF   V  V+P   +P ++ P+ V   I+D+ S+PE+
Sbjct  5    VRILLVGDDGVGKSTIVTSLIKESFIPHVQHVVPEVTIPPEVTPENVTTYIVDSGSAPED  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RTHLETEIRKAHVICVVYSIDNPHSFDRIPTYWLPYFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ +LPIM +F+E+ETCIECSA
Sbjct  125  TNEALEEEILPIMNEFKEVETCIECSA  151



>ref|XP_007329726.1| hypothetical protein AGABI1DRAFT_59100 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM79460.1| hypothetical protein AGABI1DRAFT_59100 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=645

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF A V  V+P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIITSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RAHLESEIRKAHVICVVYSIDNPNSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>gb|KII90979.1| hypothetical protein PLICRDRAFT_158439 [Plicaturopsis crispa 
FD-325 SS-3]
Length=645

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  V+P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RAHLESEIRKAHVICVVYSIDNPNSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>ref|XP_006462756.1| hypothetical protein AGABI2DRAFT_224362 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45936.1| hypothetical protein AGABI2DRAFT_224362 [Agaricus bisporus var. 
bisporus H97]
Length=645

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF A V  V+P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIITSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI++G  +D R  + 
Sbjct  65   RAHLESEIRKAHVICVVYSIDNPNSFDRIPTYWLPHFRQLGVNVPVILIGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>gb|KDR82801.1| hypothetical protein GALMADRAFT_88479 [Galerina marginata CBS 
339.88]
Length=645

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  ++P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHIVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RTHLESEIRKAHVICVVYSIDNPGSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>emb|CEJ03380.1| Putative Mitochondrial Rho GTPase 1 [Rhizopus microsporus]
Length=291

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+LI +   E+F  +V  ++P   +P ++ P+ V + I+D+S+ PE+
Sbjct  5    VRILLVGDEGVGKSTLIASLIKETFIPNVQHLIPEVTIPPEVTPENVTMHIMDSSARPED  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R     E+ +A  + + YA D P T +RLS YWLP +R L V  P ++VG  +D R +  
Sbjct  65   REQTEAEIRKAHVICIVYAIDDPNTFNRLSLYWLPYIRSLGVNVPAVLVGNKIDLRGNDV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
            A   LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  ANQALEDEVIPIMNEFKEVETCVECSA  151



>gb|EPT05115.1| hypothetical protein FOMPIDRAFT_1027338 [Fomitopsis pinicola 
FP-58527 SS1]
Length=648

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  ++P   +P ++ P+ V   I+D+ S P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHIVPEVTIPPEVTPENVTTYIVDSGSGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RPHLESEIRKAHVICVVYSIDNPNSFDRIPTYWLPYFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIIPIMNEFKEVETCVECSA  151



>gb|ESA16053.1| hypothetical protein GLOINDRAFT_160597 [Rhizophagus irregularis 
DAOM 181602]
Length=634

 Score =   125 bits (315),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 58/147 (39%), Positives = 95/147 (65%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+LI +   E+F + +  V+P   +P ++ P+ V   I+D+S+  +N
Sbjct  5    VRILLVGDDGVGKSTLITSLIRETFVSELQHVVPEVTIPPEVTPENVTTHIVDSSARSDN  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQ-  515
            R  L  E+ +A+ + + YA D P T +RL+++WLP +R L V  P+++VG  +D R DQ 
Sbjct  65   REQLKTEIKKANVICIVYAIDNPHTFNRLASFWLPFIRSLGVNVPIVLVGNKIDLRGDQI  124

Query  516  QAINLEQVMLPIMQQFREIETCIECSA  596
               +LE  ++PIM  F+E+ETC+ECSA
Sbjct  125  TNQSLEDEIIPIMNDFKEVETCVECSA  151



>gb|KJA23989.1| hypothetical protein HYPSUDRAFT_162448 [Hypholoma sublateritium 
FD-334 SS-4]
Length=645

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  ++P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHIVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RTHLESEIRKAHVICVVYSIDNPGSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>emb|CCL99263.1| predicted protein [Fibroporia radiculosa]
Length=587

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 94/147 (64%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ES+ A V  V+P   +P ++ P+ V   I+D+ S P++
Sbjct  15   VRILLVGDDGVGKSTIVTSLIKESYVAHVQHVVPEVTIPPEVTPENVTTYIVDSGSGPQD  74

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  75   RPHLESEIRKAHVICVVYSIDNPNSFDRIPTYWLPYFRQLGVNVPVILVGNKIDLRGGEV  134

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
              + LE+ ++PIM +F+E+ETC+ECSA
Sbjct  135  TNDALEEEIIPIMNEFKEVETCVECSA  161



>gb|KIJ17754.1| hypothetical protein PAXINDRAFT_130103 [Paxillus involutus ATCC 
200175]
Length=645

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF A V  V+P   +P ++ P+ V   I+D+ +SP++
Sbjct  5    VRILLVGDEGVGKSTIITSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGASPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ T+WLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RQHLESEIRKAHVICVVYSIDNPGSFDRIPTFWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +++E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEYKEVETCVECSA  151



>ref|XP_007319634.1| hypothetical protein SERLADRAFT_470296 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN98305.1| hypothetical protein SERLA73DRAFT_183242 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO23872.1| hypothetical protein SERLADRAFT_470296 [Serpula lacrymans var. 
lacrymans S7.9]
Length=645

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  V+P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ T+WLP  R+L V  PVI+VG  +D R  Q 
Sbjct  65   RQHLESEIRKAHVICVVYSIDNPNSFDRIPTFWLPHFRQLGVNVPVILVGNKIDLRGGQV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIIPIMNEFKEVETCVECSA  151



>gb|AES92418.2| Rho GTPase [Medicago truncatula]
Length=613

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 11/137 (8%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI   AT +    VPPVL  TRLP  + PD V +TIIDTSS PE+   + E++ R
Sbjct  31   TGKSSLITTFATGNPVKDVPPVLLSTRLPKHLSPDGVRITIIDTSSRPEDCFKVGEQLRR  90

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADA+VLTY CD+  TL+RLS++WLP LR L V  PVIV  C LD + D Q  +LE     
Sbjct  91   ADAIVLTYTCDRQETLERLSSFWLPRLRDLGVNVPVIVAACKLDLQHDNQEESLE-----  145

Query  549  IMQQFREIETCIECSAY  599
                  ++E  I CSAY
Sbjct  146  ------DVEITIRCSAY  156



>gb|KIJ64547.1| hypothetical protein HYDPIDRAFT_111893 [Hydnomerulius pinastri 
MD-312]
Length=646

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 94/147 (64%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF A V  V+P   +P ++ P+ V   I+D+ + P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVAHVQHVVPEVTIPPEVTPENVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ T+WLP+ R+L V  PVI+VG  +D R  + 
Sbjct  65   RQHLESEIRKAHVICVVYSIDNPNSFDRIPTFWLPQFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIIPIMNEFKEVETCVECSA  151



>ref|XP_003034526.1| hypothetical protein SCHCODRAFT_52884 [Schizophyllum commune 
H4-8]
 gb|EFI99623.1| hypothetical protein SCHCODRAFT_52884 [Schizophyllum commune 
H4-8]
Length=652

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 91/147 (62%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   E+F A V  V+P   +P ++ P+ V   I+DT + P +
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKEAFVAHVQHVVPEVTIPPEVTPENVTTYIVDTGAGPAD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + YA D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RAHLESEVRKAHVICVVYAIDNPLSFDRIPTYWLPYFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEDEIVPIMNEFKEVETCVECSA  151



>gb|KIP10221.1| hypothetical protein PHLGIDRAFT_85427 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=649

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+L+ +   ESF   V  V+P   +P ++ P+ V   I+DT S+P++
Sbjct  5    VRILLVGDEGVGKSTLVTSLIKESFVPHVQHVVPEVTIPPEVTPENVTTYIVDTGSTPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A A+ + YA D P + DR+ T+WLP  R L V  PVI+VG  +D R  + 
Sbjct  65   RLHLESEIRKAHAICVVYAIDNPNSFDRIPTWWLPLFRSLGVNVPVILVGNKMDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  +LPIM +F+E++TC+ECSA
Sbjct  125  TNEALEHEVLPIMTEFKEVDTCVECSA  151



>ref|XP_003610221.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=635

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 11/137 (8%)
 Frame = +3

Query  189  TGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPENRGTLFEEMMR  368
            TGKSSLI   AT +    VPPVL  TRLP  + PD V +TIIDTSS PE+   + E++ R
Sbjct  31   TGKSSLITTFATGNPVKDVPPVLLSTRLPKHLSPDGVRITIIDTSSRPEDCFKVGEQLRR  90

Query  369  ADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQAINLEQVMLP  548
            ADA+VLTY CD+  TL+RLS++WLP LR L V  PVIV  C LD + D Q  +LE     
Sbjct  91   ADAIVLTYTCDRQETLERLSSFWLPRLRDLGVNVPVIVAACKLDLQHDNQEESLE-----  145

Query  549  IMQQFREIETCIECSAY  599
                  ++E  I CSAY
Sbjct  146  ------DVEITIRCSAY  156



>ref|XP_007399690.1| hypothetical protein PHACADRAFT_177305 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM51897.1| hypothetical protein PHACADRAFT_177305 [Phanerochaete carnosa 
HHB-10118-sp]
Length=649

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 91/147 (62%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS+++ +   ESF   V  V+P   +P ++ P+ V   I+DT S+P++
Sbjct  5    VRILLVGDEGVGKSTIVTSLIKESFVPHVQHVVPEVTIPPEVTPENVTTYIVDTGSTPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + YA D P + DR+ TYWLP  R L V  PVI+VG  +D R  + 
Sbjct  65   RQHLESEIRKAHVICVVYAIDNPNSFDRIPTYWLPCFRALGVNVPVILVGNKMDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE  +LPIM +F+E++TC+ECSA
Sbjct  125  TNEALEHEVLPIMNEFKEVDTCVECSA  151



>ref|XP_001835979.2| mitochondrial Rho 1 [Coprinopsis cinerea okayama7#130]
 gb|EAU85755.2| mitochondrial Rho 1 [Coprinopsis cinerea okayama7#130]
Length=647

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF + V  ++P   +P ++ P+ +   I+D+ + P +
Sbjct  5    VRILLVGDEGVGKSTIITSLIKESFVSHVQHIVPEVTIPPEVTPENITTYIVDSGAGPND  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + YA D P + DR+ TYWLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RVHLESEIRKAHVICVVYAIDNPNSFDRIPTYWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIIPIMTEFKEVETCVECSA  151



>gb|AAP73841.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99486.1| EF hand family protein, expressed [Oryza sativa Japonica Group]
 gb|EAZ29015.1| hypothetical protein OsJ_13063 [Oryza sativa Japonica Group]
Length=253

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 91/165 (55%), Gaps = 30/165 (18%)
 Frame = +3

Query  114  MAGGGSSNAKGNISGVRVIVAGDPKTGKSSLILAAATESFPA---SVPPVLPPTRLPDDI  284
            M    SS A   +  VRV V GD  TGKSSL+   AT  FP     V  VLPP RLP D 
Sbjct  1    MGVAWSSRAAAKLD-VRVAVIGDHGTGKSSLVATIATGRFPDQDDGVARVLPPARLPVDY  59

Query  285  FPDRVPLTIIDTSSSPENRGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRL-E  461
            FP RVP+TI+DTSS                         +P TL+R++T+WLP++RRL +
Sbjct  60   FPARVPVTIVDTSS-------------------------RPNTLERITTFWLPKIRRLLQ  94

Query  462  VKAPVIVVGCMLDKRDDQQAINLEQVMLPIMQQFREIETCIECSA  596
             K PVI+ GC +D  D QQ   LE V+  IM  FRE+E  +ECSA
Sbjct  95   SKVPVILAGCKVDLSDKQQQAGLENVLDFIMCTFREVEIYLECSA  139



>gb|KIM66859.1| hypothetical protein SCLCIDRAFT_257565 [Scleroderma citrinum 
Foug A]
Length=646

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GD   GKS++I +   ESF A V  V+P   +P ++ P  V   I+D+ + P++
Sbjct  5    VRILLVGDDGVGKSTIITSLIKESFVAHVQHVVPEVTIPPEVTPQNVTTYIVDSGAGPQD  64

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRLEVKAPVIVVGCMLDKRDDQQ  518
            R  L  E+ +A  + + Y+ D P + DR+ T+WLP  R+L V  PVI+VG  +D R  + 
Sbjct  65   RQHLETEIRKAHVICVVYSIDNPNSFDRIPTFWLPHFRQLGVNVPVILVGNKIDLRGGEV  124

Query  519  AIN-LEQVMLPIMQQFREIETCIECSA  596
                LE+ ++PIM +F+E+ETC+ECSA
Sbjct  125  TNEALEEEIVPIMNEFKEVETCVECSA  151



>ref|XP_011423546.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Crassostrea 
gigas]
Length=648

 Score =   124 bits (311),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/149 (40%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +3

Query  159  VRVIVAGDPKTGKSSLILAAATESFPASVPPVLPPTRLPDDIFPDRVPLTIIDTSSSPEN  338
            VR+++ GDP  GK+SLIL+  +E FP  VP       +P D+ P+RVP  I+D SS  ++
Sbjct  7    VRILLVGDPGVGKTSLILSLVSEEFPDEVPAKAEEITIPADVTPERVPTHIVDYSSQEQD  66

Query  339  RGTLFEEMMRADAVVLTYACDKPATLDRLSTYWLPELRRL---EVKAPVIVVGCMLDKRD  509
               L EEM +++ + + Y+ D   +++R++++WLP +R     E K PVI+VG   D  D
Sbjct  67   EDILQEEMAKSNVICIIYSVDDEDSIERITSFWLPYIRTHLGEEHKVPVILVGNKCDLMD  126

Query  510  DQQAINLEQVMLPIMQQFREIETCIECSA  596
                 + E++M PIM  F E+ETC+ECSA
Sbjct  127  ----FSTEEIMRPIMNDFAEVETCVECSA  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940