BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031G15

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606507.1|  PREDICTED: uncharacterized protein LOC104100862    195   1e-88   Nicotiana tomentosiformis
ref|XP_006338702.1|  PREDICTED: probable transporter mch1-like          194   2e-88   Solanum tuberosum [potatoes]
ref|XP_009802951.1|  PREDICTED: uncharacterized protein LOC104248396    194   2e-88   Nicotiana sylvestris
ref|XP_008379106.1|  PREDICTED: uncharacterized protein LOC103442130    195   5e-88   
ref|XP_004231775.1|  PREDICTED: probable transporter mch1               192   2e-87   Solanum lycopersicum
ref|XP_009344920.1|  PREDICTED: probable transporter mch1               196   2e-87   Pyrus x bretschneideri [bai li]
ref|XP_008231105.1|  PREDICTED: probable transporter mch1               198   3e-87   Prunus mume [ume]
ref|XP_010926825.1|  PREDICTED: probable transporter mch1               192   3e-87   Elaeis guineensis
ref|XP_009601173.1|  PREDICTED: probable transporter mch1               189   3e-87   Nicotiana tomentosiformis
ref|XP_008339906.1|  PREDICTED: uncharacterized protein LOC103402901    194   4e-87   Malus domestica [apple tree]
ref|XP_007214954.1|  hypothetical protein PRUPE_ppa003193mg             196   7e-87   
gb|EPS64558.1|  hypothetical protein M569_10221                         183   3e-86   Genlisea aurea
ref|XP_004304525.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    187   9e-86   Fragaria vesca subsp. vesca
ref|XP_006357196.1|  PREDICTED: uncharacterized protein LOC102603984    187   1e-85   Solanum tuberosum [potatoes]
ref|XP_011098901.1|  PREDICTED: uncharacterized protein LOC105177434    188   2e-85   Sesamum indicum [beniseed]
ref|XP_010033424.1|  PREDICTED: uncharacterized protein LOC104422714    188   2e-85   Eucalyptus grandis [rose gum]
ref|XP_009404757.1|  PREDICTED: uncharacterized protein LOC103987995    187   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP16703.1|  unnamed protein product                                186   9e-85   Coffea canephora [robusta coffee]
ref|XP_010112377.1|  hypothetical protein L484_010782                   183   2e-84   Morus notabilis
ref|XP_004233292.1|  PREDICTED: probable transporter mch1               182   1e-83   Solanum lycopersicum
gb|EYU45415.1|  hypothetical protein MIMGU_mgv1a006811mg                187   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_002270737.1|  PREDICTED: uncharacterized protein LOC100244537    182   2e-83   Vitis vinifera
emb|CAN82292.1|  hypothetical protein VITISV_016786                     181   4e-83   Vitis vinifera
ref|XP_010249040.1|  PREDICTED: uncharacterized protein LOC104591744    186   9e-83   Nelumbo nucifera [Indian lotus]
ref|XP_009402249.1|  PREDICTED: uncharacterized protein LOC103986091    183   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403771.1|  PREDICTED: probable transporter mch1               182   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002270809.1|  PREDICTED: uncharacterized protein LOC100266857    179   2e-82   Vitis vinifera
ref|XP_010680020.1|  PREDICTED: probable transporter mch1               180   4e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006659624.1|  PREDICTED: uncharacterized protein LOC102701471    174   8e-82   Oryza brachyantha
ref|XP_009413001.1|  PREDICTED: probable transporter mch1               179   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511170.1|  conserved hypothetical protein                     184   1e-81   Ricinus communis
ref|NP_566157.1|  major facilitator protein                             196   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAC39501.1|  nodulin-like protein                                    195   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AAB07879.1|  similar to a E. coli hypothetical protein F402 en...    195   3e-81   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ07770.1|  hypothetical protein OsI_30023                          171   6e-81   Oryza sativa Indica Group [Indian rice]
ref|NP_001062339.1|  Os08g0532400                                       171   6e-81   
ref|XP_010250689.1|  PREDICTED: uncharacterized protein LOC104592...    185   7e-81   Nelumbo nucifera [Indian lotus]
emb|CDP15002.1|  unnamed protein product                                185   2e-80   Coffea canephora [robusta coffee]
ref|XP_007037994.1|  Major facilitator protein                          178   4e-80   
ref|XP_009623438.1|  PREDICTED: probable transporter mch1               179   5e-80   Nicotiana tomentosiformis
ref|XP_009783567.1|  PREDICTED: probable transporter mch1               180   5e-80   Nicotiana sylvestris
ref|XP_006351510.1|  PREDICTED: uncharacterized protein LOC102597647    178   7e-80   Solanum tuberosum [potatoes]
ref|XP_004975414.1|  PREDICTED: uncharacterized protein LOC101772491    178   9e-80   Setaria italica
ref|XP_010250690.1|  PREDICTED: uncharacterized protein LOC104592...    182   1e-79   
ref|XP_011044125.1|  PREDICTED: uncharacterized protein LOC105139411    179   1e-79   Populus euphratica
ref|XP_004234304.1|  PREDICTED: probable transporter mch1 isoform X1    178   1e-79   Solanum lycopersicum
gb|EAZ30529.1|  hypothetical protein OsJ_14578                          177   2e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002318735.1|  nodulin family protein                             179   2e-79   Populus trichocarpa [western balsam poplar]
ref|XP_006848262.1|  hypothetical protein AMTR_s00013p00058430          174   4e-79   Amborella trichopoda
gb|KDP22609.1|  hypothetical protein JCGZ_26440                         182   4e-79   Jatropha curcas
ref|XP_008441326.1|  PREDICTED: uncharacterized protein LOC103485...    174   1e-78   Cucumis melo [Oriental melon]
emb|CAH66429.1|  OSIGBa0096P03.3                                        176   1e-78   Oryza sativa [red rice]
ref|XP_007161720.1|  hypothetical protein PHAVU_001G092800g             173   3e-78   Phaseolus vulgaris [French bean]
emb|CBI15688.3|  unnamed protein product                                176   4e-78   Vitis vinifera
ref|XP_011009185.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    169   4e-78   Populus euphratica
ref|XP_002280267.3|  PREDICTED: uncharacterized protein LOC100247479    176   4e-78   Vitis vinifera
ref|XP_002446304.1|  hypothetical protein SORBIDRAFT_06g013900          175   5e-78   Sorghum bicolor [broomcorn]
gb|KGN63164.1|  hypothetical protein Csa_2G406130                       178   1e-77   Cucumis sativus [cucumbers]
gb|KDO47303.1|  hypothetical protein CISIN_1g007766mg                   181   1e-77   Citrus sinensis [apfelsine]
ref|XP_004138620.1|  PREDICTED: uncharacterized protein LOC101211655    178   1e-77   
ref|XP_010026435.1|  PREDICTED: uncharacterized protein LOC104416...    173   2e-77   
ref|XP_006436853.1|  hypothetical protein CICLE_v10031034mg             179   5e-77   Citrus clementina [clementine]
ref|XP_003579618.1|  PREDICTED: probable transporter mch1               171   6e-77   Brachypodium distachyon [annual false brome]
ref|XP_010026445.1|  PREDICTED: uncharacterized protein LOC104416...    172   1e-76   
ref|NP_001167921.1|  hypothetical protein                               173   2e-76   Zea mays [maize]
ref|XP_004513316.1|  PREDICTED: uncharacterized protein LOC101511301    159   4e-76   Cicer arietinum [garbanzo]
tpg|DAA38148.1|  TPA: hypothetical protein ZEAMMB73_491057              171   5e-76   
ref|XP_007210258.1|  hypothetical protein PRUPE_ppa003294mg             166   1e-75   Prunus persica
dbj|BAK01324.1|  predicted protein                                      166   2e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006848265.1|  hypothetical protein AMTR_s00013p00061220          164   5e-75   
ref|XP_008392789.1|  PREDICTED: probable transporter mch1               164   1e-74   
ref|XP_008239485.1|  PREDICTED: uncharacterized protein LOC103338077    162   1e-74   Prunus mume [ume]
ref|XP_008374232.1|  PREDICTED: uncharacterized protein LOC103437529    165   1e-74   
gb|EMT05600.1|  hypothetical protein F775_14441                         162   2e-74   
gb|KJB33994.1|  hypothetical protein B456_006G042500                    162   4e-74   Gossypium raimondii
ref|XP_009359425.1|  PREDICTED: probable transporter mch1               162   8e-74   Pyrus x bretschneideri [bai li]
ref|XP_009375205.1|  PREDICTED: probable transporter mch1               162   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_006373208.1|  hypothetical protein POPTR_0017s09660g             193   2e-70   
ref|XP_004297562.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...    150   3e-70   Fragaria vesca subsp. vesca
ref|XP_008668550.1|  PREDICTED: hypothetical protein isoform X2         150   2e-69   Zea mays [maize]
ref|XP_003602802.1|  Nodulin-like protein                               153   3e-65   Medicago truncatula
gb|KHN32545.1|  Putative transporter MCH1                               148   1e-64   Glycine soja [wild soybean]
ref|XP_003526953.1|  PREDICTED: uncharacterized protein LOC100817909    146   5e-64   Glycine max [soybeans]
ref|XP_002446303.1|  hypothetical protein SORBIDRAFT_06g013890          136   2e-63   Sorghum bicolor [broomcorn]
gb|KFK22925.1|  hypothetical protein AALP_AAs48765U000600               150   2e-63   Arabis alpina [alpine rockcress]
ref|XP_003523150.1|  PREDICTED: uncharacterized protein LOC100784744    144   2e-63   Glycine max [soybeans]
gb|KHN23980.1|  Putative transporter MCH1                               142   5e-63   Glycine soja [wild soybean]
ref|XP_004975411.1|  PREDICTED: uncharacterized protein LOC101770...    147   3e-62   Setaria italica
dbj|BAD95303.1|  nodulin-like protein                                   146   9e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568730.1|  major facilitator protein                             146   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279610.1|  hypothetical protein CARUB_v10026202mg             146   1e-61   Capsella rubella
ref|XP_010442204.1|  PREDICTED: probable transporter mch1               145   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010442541.1|  PREDICTED: probable transporter mch1               145   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010525333.1|  PREDICTED: uncharacterized protein LOC104803150    139   5e-60   Tarenaya hassleriana [spider flower]
emb|CDY16357.1|  BnaA02g11610D                                          151   4e-59   Brassica napus [oilseed rape]
emb|CDX91555.1|  BnaC02g16050D                                          150   6e-59   
ref|XP_009127350.1|  PREDICTED: uncharacterized protein LOC103852185    150   9e-59   Brassica rapa
tpg|DAA38152.1|  TPA: hypothetical protein ZEAMMB73_727902              144   3e-58   
ref|XP_002865816.1|  nodulin family protein                             147   1e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_001778186.1|  predicted protein                                  141   2e-57   
ref|XP_002964118.1|  hypothetical protein SELMODRAFT_166743             137   5e-57   Selaginella moellendorffii
ref|XP_002992049.1|  hypothetical protein SELMODRAFT_134679             137   9e-57   Selaginella moellendorffii
ref|XP_001780273.1|  predicted protein                                  138   1e-56   
ref|XP_001758608.1|  predicted protein                                  135   2e-56   
gb|KDO63910.1|  hypothetical protein CISIN_1g007654mg                   192   5e-56   Citrus sinensis [apfelsine]
ref|XP_006373207.1|  hypothetical protein POPTR_0017s09660g             187   1e-55   
ref|XP_007031903.1|  Major facilitator superfamily protein isoform 1    197   2e-55   
gb|KFK25643.1|  hypothetical protein AALP_AA8G141300                    197   2e-55   Arabis alpina [alpine rockcress]
gb|KJB11689.1|  hypothetical protein B456_001G272000                    193   3e-55   Gossypium raimondii
gb|KDO63909.1|  hypothetical protein CISIN_1g007654mg                   193   4e-55   Citrus sinensis [apfelsine]
ref|XP_006447046.1|  hypothetical protein CICLE_v10014684mg             193   4e-55   
gb|KJB11691.1|  hypothetical protein B456_001G272000                    193   5e-55   Gossypium raimondii
ref|XP_002882160.1|  nodulin family protein                             196   6e-55   Arabidopsis lyrata subsp. lyrata
gb|KJB76385.1|  hypothetical protein B456_012G086100                    192   9e-55   Gossypium raimondii
ref|NP_196916.1|  major facilitator protein                             194   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399921.1|  hypothetical protein EUTSA_v10013083mg             193   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_002300113.2|  hypothetical protein POPTR_0001s33670g             193   5e-54   Populus trichocarpa [western balsam poplar]
gb|KHG08620.1|  putative transporter MCH1                               193   5e-54   Gossypium arboreum [tree cotton]
ref|XP_006447047.1|  hypothetical protein CICLE_v10014684mg             193   7e-54   Citrus clementina [clementine]
gb|KDO63908.1|  hypothetical protein CISIN_1g007654mg                   192   7e-54   Citrus sinensis [apfelsine]
gb|KDO63907.1|  hypothetical protein CISIN_1g007654mg                   193   7e-54   Citrus sinensis [apfelsine]
gb|KJB76384.1|  hypothetical protein B456_012G086100                    192   7e-54   Gossypium raimondii
ref|XP_010489623.1|  PREDICTED: uncharacterized protein LOC104767274    186   8e-54   
gb|KJB11688.1|  hypothetical protein B456_001G272000                    193   8e-54   Gossypium raimondii
ref|XP_002509502.1|  conserved hypothetical protein                     192   8e-54   
ref|XP_010495184.1|  PREDICTED: uncharacterized protein LOC104772249    191   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010453528.1|  PREDICTED: uncharacterized protein LOC104735432    192   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010420035.1|  PREDICTED: uncharacterized protein LOC104705...    192   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009784305.1|  PREDICTED: probable transporter mch1               192   1e-53   Nicotiana sylvestris
ref|XP_006287365.1|  hypothetical protein CARUB_v10000565mg             192   2e-53   Capsella rubella
gb|KJB76382.1|  hypothetical protein B456_012G086100                    192   2e-53   Gossypium raimondii
ref|XP_010913012.1|  PREDICTED: uncharacterized protein LOC105038807    192   2e-53   
ref|XP_002871602.1|  nodulin family protein                             191   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_010927760.1|  PREDICTED: uncharacterized protein LOC105049721    191   3e-53   Elaeis guineensis
ref|XP_006404864.1|  hypothetical protein EUTSA_v10000696mg             191   4e-53   
ref|XP_008801667.1|  PREDICTED: uncharacterized protein LOC103715713    190   7e-53   Phoenix dactylifera
ref|XP_009597102.1|  PREDICTED: probable transporter mch1 isoform X1    190   1e-52   Nicotiana tomentosiformis
gb|KHG07666.1|  putative transporter MCH1                               189   1e-52   Gossypium arboreum [tree cotton]
gb|EYU34813.1|  hypothetical protein MIMGU_mgv1a003413mg                189   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_010524260.1|  PREDICTED: probable transporter mch1               189   2e-52   
ref|XP_010550224.1|  PREDICTED: probable transporter mch1 isoform X1    188   3e-52   Tarenaya hassleriana [spider flower]
emb|CDY58410.1|  BnaC09g54560D                                          188   4e-52   Brassica napus [oilseed rape]
ref|XP_009121693.1|  PREDICTED: uncharacterized protein LOC103846506    188   4e-52   Brassica rapa
ref|XP_010485347.1|  PREDICTED: uncharacterized protein LOC104763...    187   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010496426.1|  PREDICTED: uncharacterized protein LOC104773497    186   2e-51   Camelina sativa [gold-of-pleasure]
emb|CDX78561.1|  BnaA03g04730D                                          186   2e-51   
ref|XP_009131387.1|  PREDICTED: uncharacterized protein LOC103856061    186   2e-51   Brassica rapa
emb|CDX70543.1|  BnaC03g06270D                                          185   5e-51   
ref|XP_008790753.1|  PREDICTED: uncharacterized protein LOC103707...    184   1e-50   Phoenix dactylifera
ref|XP_008790755.1|  PREDICTED: uncharacterized protein LOC103707...    184   1e-50   
ref|XP_002964117.1|  hypothetical protein SELMODRAFT_62386              125   7e-50   
tpg|DAA48224.1|  TPA: hypothetical protein ZEAMMB73_995020              170   8e-50   
ref|NP_001152103.1|  nodulin-like protein                               181   2e-49   Zea mays [maize]
ref|XP_002992050.1|  hypothetical protein SELMODRAFT_42415              124   4e-49   
ref|XP_008664391.1|  PREDICTED: uncharacterized protein LOC103643013    179   6e-49   
ref|NP_001146179.1|  uncharacterized protein LOC100279749               179   6e-49   Zea mays [maize]
ref|XP_009385482.1|  PREDICTED: probable transporter mch1               179   6e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW61584.1|  nodulin-like protein                                    179   7e-49   
dbj|BAJ95281.1|  predicted protein                                      179   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004974007.1|  PREDICTED: uncharacterized protein LOC101764387    178   2e-48   Setaria italica
ref|XP_003553263.1|  PREDICTED: uncharacterized protein LOC100796...    178   2e-48   Glycine max [soybeans]
gb|KHN40970.1|  Putative transporter MCH1                               178   2e-48   Glycine soja [wild soybean]
ref|XP_003547642.1|  PREDICTED: uncharacterized protein LOC100818484    177   3e-48   Glycine max [soybeans]
gb|EMT08736.1|  hypothetical protein F775_20527                         177   3e-48   
gb|AFW58066.1|  hypothetical protein ZEAMMB73_861058                    165   6e-48   
ref|XP_002445809.1|  hypothetical protein SORBIDRAFT_07g026140          176   1e-47   Sorghum bicolor [broomcorn]
ref|XP_003574828.1|  PREDICTED: probable transporter mch1               176   1e-47   Brachypodium distachyon [annual false brome]
gb|KHG00245.1|  putative transporter MCH1                               169   4e-45   Gossypium arboreum [tree cotton]
gb|EMS47360.1|  hypothetical protein TRIUR3_13858                       157   9e-45   Triticum urartu
gb|KEH22006.1|  nodulin-like/MFS transporter                            166   4e-44   Medicago truncatula
ref|XP_009597103.1|  PREDICTED: probable transporter mch1 isoform X2    162   6e-43   
dbj|BAG89634.1|  unnamed protein product                                144   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb|KJB33996.1|  hypothetical protein B456_006G042600                    161   1e-42   Gossypium raimondii
ref|XP_009783274.1|  PREDICTED: uncharacterized protein LOC104231909    160   2e-42   Nicotiana sylvestris
ref|XP_008362108.1|  PREDICTED: LOW QUALITY PROTEIN: probable tra...    154   2e-42   
ref|XP_011007428.1|  PREDICTED: probable transporter mch1               158   1e-41   Populus euphratica
gb|KDO63913.1|  hypothetical protein CISIN_1g007654mg                   156   4e-41   Citrus sinensis [apfelsine]
gb|KDO63912.1|  hypothetical protein CISIN_1g007654mg                   157   4e-41   Citrus sinensis [apfelsine]
gb|KDP46269.1|  hypothetical protein JCGZ_10109                         157   8e-41   Jatropha curcas
ref|XP_002446302.1|  hypothetical protein SORBIDRAFT_06g013870          147   1e-40   
ref|XP_001757080.1|  predicted protein                                  113   1e-40   
ref|XP_006352868.1|  PREDICTED: uncharacterized protein LOC102601846    154   3e-40   Solanum tuberosum [potatoes]
gb|KJB76383.1|  hypothetical protein B456_012G086100                    154   3e-40   Gossypium raimondii
gb|EYU45416.1|  hypothetical protein MIMGU_mgv1a006811mg                151   4e-40   Erythranthe guttata [common monkey flower]
gb|KJB11690.1|  hypothetical protein B456_001G272000                    151   3e-39   Gossypium raimondii
gb|AFW60461.1|  nodulin-like protein, mRNA                              151   3e-39   
ref|XP_006846932.1|  hypothetical protein AMTR_s01570p00000230          146   7e-39   
gb|EAY83124.1|  hypothetical protein OsI_38340                          100   9e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001066777.2|  Os12g0484600                                       100   1e-38   
ref|XP_002967061.1|  hypothetical protein SELMODRAFT_87151              107   2e-38   
ref|XP_002960946.1|  hypothetical protein SELMODRAFT_266544             107   2e-38   
gb|EMT08425.1|  hypothetical protein F775_07944                         101   3e-38   
ref|XP_010317535.1|  PREDICTED: probable transporter mch1 isoform X2    149   3e-38   Solanum lycopersicum
ref|XP_010485349.1|  PREDICTED: uncharacterized protein LOC104763...    148   4e-38   
ref|XP_004150375.1|  PREDICTED: uncharacterized protein LOC101208506    103   6e-38   
ref|XP_006653332.1|  PREDICTED: uncharacterized protein LOC102716407    149   6e-38   
ref|XP_008798934.1|  PREDICTED: probable transporter mch1               148   6e-38   
ref|XP_008456537.1|  PREDICTED: uncharacterized protein LOC103496460    103   7e-38   Cucumis melo [Oriental melon]
ref|XP_009397027.1|  PREDICTED: uncharacterized protein LOC103981971    100   7e-38   
ref|XP_003576191.1|  PREDICTED: uncharacterized protein LOC100839547  99.4    1e-37   Brachypodium distachyon [annual false brome]
dbj|BAJ89452.1|  predicted protein                                    99.0    1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008441327.1|  PREDICTED: uncharacterized protein LOC103485...    147   1e-37   Cucumis melo [Oriental melon]
gb|KHN09928.1|  Putative transporter MCH1                               145   7e-37   Glycine soja [wild soybean]
ref|XP_010086962.1|  hypothetical protein L484_010108                   144   1e-36   Morus notabilis
ref|XP_004962674.1|  PREDICTED: uncharacterized protein LOC101763766    100   1e-36   Setaria italica
gb|KJB33995.1|  hypothetical protein B456_006G042500                    144   2e-36   Gossypium raimondii
ref|XP_006604148.1|  PREDICTED: uncharacterized protein LOC100796...    144   2e-36   Glycine max [soybeans]
gb|EMS47359.1|  hypothetical protein TRIUR3_13857                       144   2e-36   Triticum urartu
ref|XP_002442137.1|  hypothetical protein SORBIDRAFT_08g014860        99.8    2e-36   
gb|EPS63811.1|  hypothetical protein M569_10970                       95.1    3e-36   Genlisea aurea
dbj|BAC83908.1|  putative nodule-specific protein                     93.2    8e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003522712.1|  PREDICTED: uncharacterized protein LOC100813607  99.4    8e-36   Glycine max [soybeans]
gb|EAZ03041.1|  hypothetical protein OsI_25182                        93.2    8e-36   Oryza sativa Indica Group [Indian rice]
gb|ABR18255.1|  unknown                                                 101   1e-35   Picea sitchensis
ref|XP_003612193.1|  hypothetical protein MTR_5g022380                  100   1e-35   
ref|NP_001168963.1|  uncharacterized protein LOC100382788               141   1e-35   Zea mays [maize]
ref|XP_004249479.1|  PREDICTED: uncharacterized protein LOC101244433  91.3    1e-35   Solanum lycopersicum
ref|NP_001183397.1|  hypothetical protein                               140   2e-35   Zea mays [maize]
ref|XP_009606524.1|  PREDICTED: uncharacterized protein LOC104100872  91.7    3e-35   Nicotiana tomentosiformis
ref|XP_009783152.1|  PREDICTED: uncharacterized protein LOC104231797  91.3    3e-35   Nicotiana sylvestris
ref|XP_003557448.1|  PREDICTED: uncharacterized protein LOC100822987  90.1    3e-35   
ref|XP_008662107.1|  PREDICTED: hypothetical protein isoform X1         140   3e-35   Zea mays [maize]
ref|XP_008668551.1|  PREDICTED: hypothetical protein isoform X3         140   3e-35   Zea mays [maize]
ref|XP_006339087.1|  PREDICTED: uncharacterized protein LOC102587756  89.4    4e-35   Solanum tuberosum [potatoes]
gb|EPS72388.1|  hypothetical protein M569_02370                         102   5e-35   Genlisea aurea
ref|XP_010673913.1|  PREDICTED: uncharacterized protein LOC104890215    102   6e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006367793.1|  PREDICTED: uncharacterized protein LOC102602269    102   7e-35   Solanum tuberosum [potatoes]
ref|XP_007046677.1|  Major facilitator superfamily protein            92.8    8e-35   
emb|CDM84956.1|  unnamed protein product                              89.7    8e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004248658.1|  PREDICTED: probable transporter mch1               102   9e-35   Solanum lycopersicum
ref|XP_010246855.1|  PREDICTED: probable transporter mch1             97.1    1e-34   Nelumbo nucifera [Indian lotus]
dbj|BAJ90449.1|  predicted protein                                    89.4    1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010266799.1|  PREDICTED: probable transporter mch1             97.4    2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010550225.1|  PREDICTED: uncharacterized protein LOC104821...    138   2e-34   
ref|XP_008680679.1|  PREDICTED: uncharacterized protein LOC103655757    138   2e-34   
ref|XP_006658348.1|  PREDICTED: uncharacterized protein LOC102709579  88.2    2e-34   
ref|XP_011092895.1|  PREDICTED: probable transporter mch1             99.0    4e-34   Sesamum indicum [beniseed]
ref|XP_010935083.1|  PREDICTED: probable transporter mch1             95.5    5e-34   Elaeis guineensis
gb|AFW81675.1|  putative xylose isomerase family protein                137   6e-34   
ref|XP_009379410.1|  PREDICTED: uncharacterized protein LOC103967826  95.9    1e-33   Pyrus x bretschneideri [bai li]
tpg|DAA42500.1|  TPA: nitrate and chloride transporter                89.4    1e-33   
ref|XP_002461592.1|  hypothetical protein SORBIDRAFT_02g005120        87.8    1e-33   Sorghum bicolor [broomcorn]
ref|NP_001152028.1|  nitrate and chloride transporter                 89.4    1e-33   
ref|XP_004230920.1|  PREDICTED: uncharacterized protein LOC101255930  88.6    2e-33   Solanum lycopersicum
emb|CAN82898.1|  hypothetical protein VITISV_026994                   86.3    2e-33   Vitis vinifera
ref|XP_004505781.1|  PREDICTED: uncharacterized membrane protein ...  97.8    2e-33   Cicer arietinum [garbanzo]
ref|XP_009622121.1|  PREDICTED: probable transporter mch1             98.2    3e-33   Nicotiana tomentosiformis
ref|XP_006664561.1|  PREDICTED: uncharacterized protein LOC102703921  87.4    3e-33   Oryza brachyantha
emb|CBI17146.3|  unnamed protein product                              85.5    3e-33   Vitis vinifera
ref|XP_002273103.2|  PREDICTED: uncharacterized protein LOC100249900  85.5    3e-33   Vitis vinifera
ref|XP_006359676.1|  PREDICTED: uncharacterized protein LOC102592169  95.1    4e-33   Solanum tuberosum [potatoes]
ref|NP_850497.1|  major facilitator protein                             134   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512144.1|  PREDICTED: probable transporter MCH1-like        95.5    4e-33   Cicer arietinum [garbanzo]
ref|XP_008808634.1|  PREDICTED: probable transporter mch1             96.3    4e-33   Phoenix dactylifera
ref|XP_007010014.1|  Major facilitator superfamily protein            88.6    5e-33   
ref|XP_004957481.1|  PREDICTED: uncharacterized protein LOC101778324  93.6    5e-33   Setaria italica
ref|XP_008446818.1|  PREDICTED: uncharacterized protein LOC103489434  88.6    5e-33   Cucumis melo [Oriental melon]
ref|XP_008464809.1|  PREDICTED: uncharacterized protein LOC103502605  86.7    6e-33   Cucumis melo [Oriental melon]
gb|EYU40425.1|  hypothetical protein MIMGU_mgv1a004038mg              96.7    6e-33   Erythranthe guttata [common monkey flower]
ref|XP_008394084.1|  PREDICTED: uncharacterized protein LOC103456200  95.9    6e-33   
gb|KDP30492.1|  hypothetical protein JCGZ_16171                       89.4    7e-33   Jatropha curcas
gb|KEH30507.1|  nodulin-like/MFS transporter                          97.8    7e-33   Medicago truncatula
tpg|DAA64363.1|  TPA: hypothetical protein ZEAMMB73_992659            93.6    8e-33   
ref|XP_004142503.1|  PREDICTED: uncharacterized protein LOC101205503  87.8    8e-33   Cucumis sativus [cucumbers]
ref|XP_010673912.1|  PREDICTED: uncharacterized protein LOC104890214    100   8e-33   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAO45884.1|  nitrate and chloride transporter                     91.7    1e-32   Acacia mangium
gb|KJB73494.1|  hypothetical protein B456_011G235000                  91.3    1e-32   Gossypium raimondii
ref|XP_008670908.1|  PREDICTED: uncharacterized protein LOC103648199  95.1    1e-32   Zea mays [maize]
gb|KEH30508.1|  nodulin-like/MFS transporter                          97.1    1e-32   Medicago truncatula
gb|ACJ85602.1|  unknown                                               97.1    1e-32   Medicago truncatula
ref|XP_004977870.1|  PREDICTED: uncharacterized protein LOC101756569  92.0    1e-32   Setaria italica
ref|XP_009766430.1|  PREDICTED: uncharacterized protein LOC104217799  96.3    1e-32   Nicotiana sylvestris
ref|XP_004231025.1|  PREDICTED: uncharacterized protein LOC101261467  94.0    2e-32   Solanum lycopersicum
ref|XP_008657543.1|  PREDICTED: uncharacterized protein LOC103637046  93.6    2e-32   Zea mays [maize]
ref|XP_009621414.1|  PREDICTED: uncharacterized protein LOC104113038  85.9    2e-32   Nicotiana tomentosiformis
ref|XP_008464784.1|  PREDICTED: uncharacterized protein LOC103502588  93.6    3e-32   Cucumis melo [Oriental melon]
ref|XP_010678619.1|  PREDICTED: uncharacterized protein LOC104894...  82.8    3e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009766499.1|  PREDICTED: uncharacterized protein LOC104217867  85.5    4e-32   Nicotiana sylvestris
emb|CDY17497.1|  BnaC03g65660D                                        89.0    4e-32   Brassica napus [oilseed rape]
ref|XP_010917688.1|  PREDICTED: uncharacterized membrane protein ...  84.0    5e-32   
ref|XP_006425443.1|  hypothetical protein CICLE_v10027345mg           91.7    5e-32   
ref|XP_007204209.1|  hypothetical protein PRUPE_ppa003398mg           92.0    6e-32   
ref|XP_002987402.1|  hypothetical protein SELMODRAFT_126136           82.8    6e-32   
ref|NP_001052632.2|  Os04g0388700                                       124   6e-32   
ref|XP_002979921.1|  hypothetical protein SELMODRAFT_111826           83.2    8e-32   
ref|XP_004147303.1|  PREDICTED: uncharacterized protein LOC101202941  85.1    8e-32   
ref|XP_004161323.1|  PREDICTED: uncharacterized protein LOC101224401  85.1    9e-32   
gb|EYU24441.1|  hypothetical protein MIMGU_mgv1a020189mg              91.3    1e-31   
ref|XP_010447017.1|  PREDICTED: probable transporter mch1             88.6    1e-31   
ref|XP_009108692.1|  PREDICTED: probable transporter mch1             89.4    1e-31   
gb|KFK30131.1|  hypothetical protein AALP_AA7G221100                  89.4    2e-31   
ref|XP_011043179.1|  PREDICTED: uncharacterized membrane protein ...  86.3    2e-31   
ref|XP_002530466.1|  conserved hypothetical protein                   94.4    2e-31   
gb|KHN21069.1|  hypothetical protein glysoja_006548                   89.4    2e-31   
ref|XP_007203698.1|  hypothetical protein PRUPE_ppa022013mg           89.4    3e-31   
ref|XP_009609132.1|  PREDICTED: uncharacterized protein LOC104102978  86.3    3e-31   
ref|XP_009798217.1|  PREDICTED: uncharacterized protein LOC104244484  90.9    4e-31   
ref|XP_004236183.1|  PREDICTED: uncharacterized protein LOC101243876  85.9    4e-31   
ref|XP_009783437.1|  PREDICTED: uncharacterized protein LOC104232044  85.5    5e-31   
ref|XP_008242919.1|  PREDICTED: uncharacterized protein LOC103341215  90.9    5e-31   
emb|CDX76306.1|  BnaA08g10940D                                        88.6    5e-31   
ref|XP_004303264.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4    88.2    6e-31   
ref|XP_002867099.1|  nodulin family protein                           87.8    8e-31   
ref|XP_011012237.1|  PREDICTED: uncharacterized protein LOC105116...  85.5    8e-31   
ref|XP_008464773.1|  PREDICTED: uncharacterized protein LOC103502580  90.9    8e-31   
ref|XP_009107674.1|  PREDICTED: probable transporter mch1             89.0    8e-31   
ref|XP_006367059.1|  PREDICTED: uncharacterized protein LOC102578204  85.9    1e-30   
ref|XP_010537919.1|  PREDICTED: uncharacterized protein LOC104812458  88.6    1e-30   
ref|XP_008808412.1|  PREDICTED: probable transporter mch1             85.5    1e-30   
ref|XP_004165074.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.9    1e-30   
ref|XP_004152187.1|  PREDICTED: uncharacterized protein LOC101211550  85.9    1e-30   
ref|XP_002987406.1|  hypothetical protein SELMODRAFT_235284           83.6    2e-30   
gb|AAT06468.1|  At4g34950                                             87.8    2e-30   
ref|XP_003590365.1|  Nodule-specific protein Nlj70                    89.0    2e-30   
ref|XP_011020248.1|  PREDICTED: uncharacterized protein LOC105122687  92.0    2e-30   
emb|CDX69099.1|  BnaC01g03540D                                        88.2    2e-30   
gb|AFW56485.1|  hypothetical protein ZEAMMB73_235935                  88.6    2e-30   
ref|XP_011087196.1|  PREDICTED: uncharacterized protein LOC105168751  86.3    2e-30   
dbj|BAJ93070.1|  predicted protein                                    95.5    2e-30   
ref|NP_195221.1|  major facilitator family protein                    87.0    2e-30   
ref|XP_002892879.1|  hypothetical protein ARALYDRAFT_312565           92.0    3e-30   
ref|XP_008241911.1|  PREDICTED: uncharacterized protein LOC103340299  85.9    4e-30   
ref|XP_010272188.1|  PREDICTED: uncharacterized protein LOC104608039  79.7    4e-30   
emb|CDP14418.1|  unnamed protein product                              88.6    4e-30   
dbj|BAG92908.1|  unnamed protein product                              92.0    4e-30   
ref|XP_011087194.1|  PREDICTED: uncharacterized protein LOC105168749  84.0    4e-30   
ref|XP_008454196.1|  PREDICTED: LOW QUALITY PROTEIN: probable tra...  85.1    5e-30   
ref|XP_011044882.1|  PREDICTED: probable transporter mch1             92.0    5e-30   
ref|XP_010097161.1|  hypothetical protein L484_025706                 97.4    5e-30   
ref|XP_006851905.1|  hypothetical protein AMTR_s00041p00157100        93.2    5e-30   
ref|XP_002979925.1|  hypothetical protein SELMODRAFT_178001           84.3    6e-30   
gb|KHN21070.1|  hypothetical protein glysoja_006549                   86.3    6e-30   
ref|XP_002963237.1|  hypothetical protein SELMODRAFT_79408            89.4    7e-30   
ref|XP_010933941.1|  PREDICTED: probable transporter mch1 isoform X1  85.9    7e-30   
ref|XP_002974541.1|  hypothetical protein SELMODRAFT_101779           89.4    8e-30   
gb|EAZ06229.1|  hypothetical protein OsI_28471                        99.0    8e-30   
ref|XP_002442621.1|  hypothetical protein SORBIDRAFT_08g023130        85.9    8e-30   
ref|XP_003540770.1|  PREDICTED: uncharacterized protein LOC100799928  85.9    9e-30   
ref|XP_010933956.1|  PREDICTED: probable transporter mch1 isoform X3  85.5    9e-30   
tpg|DAA51660.1|  TPA: putative xylose isomerase family protein          125   1e-29   
ref|XP_006341383.1|  PREDICTED: uncharacterized protein LOC102606368  88.6    1e-29   
ref|XP_006381072.1|  hypothetical protein POPTR_0006s05990g           89.7    1e-29   
ref|XP_010933948.1|  PREDICTED: probable transporter mch1 isoform X2  85.5    1e-29   
ref|XP_007023328.1|  Major facilitator superfamily protein            90.1    1e-29   
ref|XP_011084061.1|  PREDICTED: uncharacterized protein LOC105166417  84.7    1e-29   
ref|XP_010236602.1|  PREDICTED: uncharacterized protein LOC100836162  87.4    1e-29   
gb|EYU24433.1|  hypothetical protein MIMGU_mgv1a004516mg              79.7    2e-29   
gb|KCW55503.1|  hypothetical protein EUGRSUZ_I01397                   96.7    2e-29   
ref|XP_011087197.1|  PREDICTED: uncharacterized protein LOC105168753  79.0    2e-29   
ref|XP_006474315.1|  PREDICTED: uncharacterized membrane protein ...  83.2    2e-29   
ref|XP_009363916.1|  PREDICTED: uncharacterized protein LOC103953847  90.1    2e-29   
gb|KDO62002.1|  hypothetical protein CISIN_1g0082101mg                84.7    2e-29   
gb|AAN62343.1|AF506028_10  nodulin-like protein                       98.2    2e-29   
ref|XP_010526898.1|  PREDICTED: uncharacterized protein LOC104804333  90.9    2e-29   
ref|XP_006307140.1|  hypothetical protein CARUB_v10008730mg           85.9    2e-29   
ref|XP_010678618.1|  PREDICTED: uncharacterized protein LOC104894...  83.2    2e-29   
ref|XP_006302052.1|  hypothetical protein CARUB_v10020035mg           82.4    2e-29   
ref|XP_008384897.1|  PREDICTED: uncharacterized protein LOC103447477  90.5    2e-29   
gb|KDP46769.1|  hypothetical protein JCGZ_06557                       83.6    2e-29   
gb|KDO62001.1|  hypothetical protein CISIN_1g0082101mg                84.3    2e-29   
gb|KHN01935.1|  Putative transporter MCH1                             79.0    2e-29   
ref|XP_006385272.1|  nodulin family protein                           91.7    2e-29   
ref|XP_006383090.1|  hypothetical protein POPTR_0005s11450g           79.3    2e-29   
ref|XP_003522351.2|  PREDICTED: probable transporter mch1-like        79.0    3e-29   
ref|XP_003541492.1|  PREDICTED: uncharacterized membrane protein ...  82.0    3e-29   
ref|XP_010028707.1|  PREDICTED: uncharacterized protein LOC104418927  95.9    3e-29   
ref|XP_006427483.1|  hypothetical protein CICLE_v10025286mg           97.1    3e-29   
ref|XP_006660896.1|  PREDICTED: uncharacterized protein LOC102701295  91.7    3e-29   
ref|XP_010091040.1|  hypothetical protein L484_006404                 80.9    3e-29   
ref|XP_004488508.1|  PREDICTED: uncharacterized protein LOC101489674  79.3    4e-29   
ref|XP_006399922.1|  hypothetical protein EUTSA_v10013083mg             123   4e-29   
gb|KJB70654.1|  hypothetical protein B456_011G085700                  84.3    4e-29   
gb|AAC27411.1|  nodulin-like protein                                  82.0    4e-29   
ref|XP_006389807.1|  hypothetical protein EUTSA_v10018350mg           82.8    4e-29   
ref|XP_004235913.1|  PREDICTED: uncharacterized protein LOC101263299  87.0    4e-29   
ref|XP_006409413.1|  hypothetical protein EUTSA_v10022630mg           79.7    4e-29   
gb|EAZ42068.1|  hypothetical protein OsJ_26629                        96.3    4e-29   
ref|XP_004147308.1|  PREDICTED: uncharacterized protein LOC101204150  89.4    4e-29   
ref|XP_004171580.1|  PREDICTED: uncharacterized LOC101205122          91.3    5e-29   
ref|XP_004147312.1|  PREDICTED: uncharacterized protein LOC101205122  91.3    5e-29   
gb|KJB70655.1|  hypothetical protein B456_011G085700                  84.0    5e-29   
ref|XP_002887824.1|  hypothetical protein ARALYDRAFT_895939           82.8    5e-29   
ref|XP_006427482.1|  hypothetical protein CICLE_v10025286mg           96.7    6e-29   
gb|EMS49129.1|  hypothetical protein TRIUR3_19318                     92.4    6e-29   
dbj|BAC98515.1|  nodulin-like protein                                 96.3    7e-29   
ref|XP_006465227.1|  PREDICTED: uncharacterized membrane protein ...  97.1    7e-29   
ref|NP_178168.1|  Major facilitator superfamily protein               82.0    9e-29   
gb|KCW70766.1|  hypothetical protein EUGRSUZ_F03926                   90.5    1e-28   
ref|XP_008777475.1|  PREDICTED: probable transporter mch1             83.2    1e-28   
ref|XP_006600718.1|  PREDICTED: uncharacterized membrane protein ...  82.0    1e-28   
gb|KFK40073.1|  hypothetical protein AALP_AA3G326700                  78.6    1e-28   
ref|XP_009338491.1|  PREDICTED: uncharacterized protein LOC103930831  90.5    1e-28   
emb|CDY02250.1|  BnaA03g39170D                                        78.2    1e-28   
gb|KJB39868.1|  hypothetical protein B456_007G034700                  77.0    1e-28   
ref|XP_009136319.1|  PREDICTED: probable transporter mch1             78.2    1e-28   
gb|KHN05409.1|  Putative membrane protein YMR155W                     89.7    1e-28   
ref|XP_010063536.1|  PREDICTED: uncharacterized membrane protein ...  90.5    2e-28   
gb|KCW70764.1|  hypothetical protein EUGRSUZ_F03926                   90.1    2e-28   
ref|XP_009363919.1|  PREDICTED: uncharacterized protein LOC103953849  85.9    2e-28   
gb|KEH37893.1|  nodulin-like/MFS transporter                          77.8    2e-28   
emb|CDY26781.1|  BnaC09g09080D                                        77.0    3e-28   
emb|CDP14900.1|  unnamed protein product                              77.8    3e-28   
ref|XP_006402085.1|  hypothetical protein EUTSA_v10015411mg             119   3e-28   
ref|XP_009369377.1|  PREDICTED: uncharacterized protein LOC103958777  77.8    3e-28   
ref|XP_004236184.1|  PREDICTED: uncharacterized protein LOC101244171  86.3    3e-28   
ref|NP_179257.1|  Major facilitator superfamily protein               77.4    3e-28   
ref|XP_010678610.1|  PREDICTED: uncharacterized protein LOC104894132  87.0    3e-28   
emb|CDY47472.1|  BnaA09g08810D                                        77.0    3e-28   
ref|XP_006367060.1|  PREDICTED: uncharacterized protein LOC102578528  85.9    4e-28   
gb|KFK42463.1|  hypothetical protein AALP_AA2G260200                  83.2    4e-28   
ref|XP_002511500.1|  conserved hypothetical protein                   80.1    4e-28   
ref|XP_010255962.1|  PREDICTED: uncharacterized protein LOC104596480  79.3    4e-28   
ref|XP_006852818.1|  hypothetical protein AMTR_s00033p00175020        83.6    4e-28   
ref|XP_004975412.1|  PREDICTED: uncharacterized protein LOC101770...    120   4e-28   
ref|XP_004146405.1|  PREDICTED: uncharacterized protein LOC101220925  84.7    5e-28   
gb|EPS71124.1|  hypothetical protein M569_03631                       91.7    5e-28   
ref|XP_002886064.1|  nodulin family protein                           77.0    6e-28   
ref|XP_007013638.1|  Major facilitator superfamily protein isoform 1  82.8    9e-28   
gb|KGN54809.1|  hypothetical protein Csa_4G507390                     84.3    9e-28   
ref|XP_009112395.1|  PREDICTED: probable transporter mch1             77.0    9e-28   
emb|CDX89732.1|  BnaC03g46460D                                        78.2    9e-28   
gb|KDP31188.1|  hypothetical protein JCGZ_11564                       77.4    1e-27   
ref|XP_003597634.1|  Nodulin-like protein                             80.5    2e-27   
gb|KDP31187.1|  hypothetical protein JCGZ_11563                       83.2    2e-27   
gb|AES67885.2|  MFS transporter                                       80.5    2e-27   
ref|XP_004155069.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.2    2e-27   
ref|XP_002887558.1|  nodulin family protein                           78.2    2e-27   
gb|KGN63641.1|  hypothetical protein Csa_1G008470                     78.2    2e-27   
ref|XP_004138145.1|  PREDICTED: uncharacterized protein LOC101216789  78.2    3e-27   
gb|KDP30201.1|  hypothetical protein JCGZ_16983                       83.2    3e-27   
ref|XP_007037166.1|  Nodulin / Major Facilitator Superfamily protein  74.7    3e-27   
ref|XP_008453166.1|  PREDICTED: uncharacterized protein LOC103493962  78.6    3e-27   
ref|XP_010687781.1|  PREDICTED: uncharacterized protein LOC104901852  76.6    4e-27   
ref|XP_006302127.1|  hypothetical protein CARUB_v10020132mg           79.3    4e-27   
ref|XP_003528176.1|  PREDICTED: uncharacterized protein LOC100799596  82.4    4e-27   
ref|XP_009766329.1|  PREDICTED: uncharacterized protein LOC104217722  80.9    4e-27   
ref|XP_009622453.1|  PREDICTED: uncharacterized protein LOC104113849  80.5    5e-27   
ref|XP_006402082.1|  hypothetical protein EUTSA_v10014412mg             115   5e-27   
ref|XP_007208600.1|  hypothetical protein PRUPE_ppa022397mg           82.4    6e-27   
ref|XP_010539949.1|  PREDICTED: uncharacterized protein LOC104813863  75.1    6e-27   
ref|XP_010509768.1|  PREDICTED: uncharacterized protein LOC104786130  76.3    6e-27   
ref|NP_850228.1|  nodulin-like domain-containing protein              79.3    6e-27   
ref|XP_010677449.1|  PREDICTED: uncharacterized protein LOC104893078  83.6    7e-27   
ref|XP_009104470.1|  PREDICTED: uncharacterized protein LOC103830442  80.5    8e-27   
emb|CDX67953.1|  BnaA07g19930D                                        80.5    8e-27   
ref|XP_010049904.1|  PREDICTED: uncharacterized protein LOC104438451  84.3    8e-27   
emb|CDX87321.1|  BnaA07g35520D                                        79.7    8e-27   
ref|XP_009106737.1|  PREDICTED: uncharacterized protein LOC103832476  79.7    9e-27   
ref|XP_007037173.1|  Nodulin-like / Major Facilitator Superfamily...  74.3    9e-27   
ref|XP_011082070.1|  PREDICTED: uncharacterized protein LOC105164931  87.0    1e-26   
emb|CDY39967.1|  BnaC06g40450D                                        79.7    1e-26   
ref|XP_002879492.1|  hypothetical protein ARALYDRAFT_321151           78.6    1e-26   
ref|XP_010504887.1|  PREDICTED: uncharacterized protein LOC104781819  75.9    1e-26   
ref|XP_002270754.1|  PREDICTED: probable transporter mch1             91.7    1e-26   
emb|CDX79379.1|  BnaC06g19240D                                        80.5    1e-26   
ref|XP_002880951.1|  nodulin family protein                             117   1e-26   
emb|CBI15295.3|  unnamed protein product                              74.7    1e-26   
ref|XP_010691075.1|  PREDICTED: uncharacterized protein LOC104904508  80.9    1e-26   
ref|XP_009788802.1|  PREDICTED: uncharacterized protein LOC104236559  80.1    1e-26   
ref|NP_180379.1|  major facilitator protein                             117   1e-26   
ref|XP_003609485.1|  hypothetical protein MTR_4g116210                79.7    1e-26   
ref|XP_010663424.1|  PREDICTED: uncharacterized protein LOC100250053  74.3    2e-26   
ref|XP_010532110.1|  PREDICTED: uncharacterized protein LOC104808196  76.6    2e-26   
ref|XP_010516579.1|  PREDICTED: uncharacterized protein LOC104792187  75.1    2e-26   
ref|XP_009103645.1|  PREDICTED: uncharacterized membrane protein ...    116   2e-26   
emb|CDX71381.1|  BnaC04g16160D                                          116   2e-26   
gb|AAP04143.1|  unknown protein                                       78.2    2e-26   
emb|CDY04538.1|  BnaA07g13640D                                          116   2e-26   
ref|NP_177616.1|  nodulin-like and major facilitator domain-conta...  78.2    2e-26   
ref|XP_010557355.1|  PREDICTED: uncharacterized protein LOC104826384    116   2e-26   
ref|XP_004287243.1|  PREDICTED: protein NUCLEAR FUSION DEFECTIVE ...  81.6    2e-26   
ref|XP_010244877.1|  PREDICTED: uncharacterized protein LOC104588582  89.4    3e-26   
ref|XP_008239662.1|  PREDICTED: probable transporter MCH1             73.9    3e-26   
emb|CDX85856.1|  BnaC06g22780D                                        77.8    3e-26   
gb|KJB18828.1|  hypothetical protein B456_003G071000                  76.6    3e-26   
ref|XP_003546584.1|  PREDICTED: uncharacterized membrane protein ...  75.1    4e-26   
emb|CDX67954.1|  BnaA07g19940D                                        82.4    4e-26   
ref|XP_009104471.1|  PREDICTED: uncharacterized protein LOC103830443  82.4    4e-26   
ref|XP_003579078.1|  PREDICTED: uncharacterized protein LOC100846557  75.1    5e-26   
ref|XP_010470138.1|  PREDICTED: uncharacterized protein LOC104750092    115   5e-26   
ref|XP_006295612.1|  hypothetical protein CARUB_v10024725mg           73.6    5e-26   
ref|XP_009611327.1|  PREDICTED: uncharacterized membrane protein ...  74.7    6e-26   
ref|XP_006390390.1|  hypothetical protein EUTSA_v10018391mg           78.6    6e-26   
ref|XP_007209882.1|  hypothetical protein PRUPE_ppa003974mg           74.3    6e-26   
ref|XP_009419093.1|  PREDICTED: probable transporter mch1             83.2    7e-26   
ref|XP_003533860.1|  PREDICTED: uncharacterized membrane protein ...  76.3    7e-26   
ref|XP_009609133.1|  PREDICTED: uncharacterized protein LOC104102979  79.0    7e-26   
ref|XP_010414589.1|  PREDICTED: uncharacterized protein LOC104700...    115   7e-26   
emb|CAH10046.1|  Unknown similar to A.thaliana Hypothetical prote...  75.5    8e-26   
gb|EMT08792.1|  hypothetical protein F775_14992                       92.4    8e-26   
ref|XP_009401386.1|  PREDICTED: uncharacterized protein LOC103985421  76.3    9e-26   
emb|CAH10068.1|  Unknown similar to A.thaliana Hypothetical prote...  75.5    9e-26   
ref|XP_010510684.1|  PREDICTED: uncharacterized protein LOC104786...    114   9e-26   
dbj|BAK00120.1|  predicted protein                                    83.2    9e-26   
emb|CAA17760.1|  EF-1 alpha-like protein (fragment)                   86.3    1e-25   
ref|XP_007155098.1|  hypothetical protein PHAVU_003G173000g           77.0    1e-25   
emb|CDX77158.1|  BnaC04g39530D                                          114   1e-25   
ref|XP_006439672.1|  hypothetical protein CICLE_v10019511mg           73.9    1e-25   
emb|CDX79374.1|  BnaC06g19290D                                        83.2    1e-25   
emb|CDY30506.1|  BnaA04g16270D                                          114   1e-25   



>ref|XP_009606507.1| PREDICTED: uncharacterized protein LOC104100862 [Nicotiana tomentosiformis]
Length=592

 Score =   195 bits (495),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RLKEK+  FF+NRWLVFVA+MW+Q+ AG+GYLFGSISPIIKS++ YNQ+QLS LGVAKDL
Sbjct  3    RLKEKLCLFFNNRWLVFVAAMWIQSFAGIGYLFGSISPIIKSSLNYNQRQLSRLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTLSEILPLWA LLVG  QNF+GYGWVWLI+TGR P LP+W MC
Sbjct  63   GDSVGFLAGTLSEILPLWATLLVGAIQNFIGYGWVWLIVTGRSPTLPLWVMC  114


 Score =   159 bits (401),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY LIHSPD
Sbjct  113  MCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAIMTQIYALIHSPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGPA+V+I+LMFLIRPVG
Sbjct  173  HASLIFMVAVGPAMVVIALMFLIRPVG  199



>ref|XP_006338702.1| PREDICTED: probable transporter mch1-like [Solanum tuberosum]
Length=590

 Score =   194 bits (492),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RLKE+ + FF+NRWLVFVA+MW+Q+ AG+GYLFGSISPIIKS++ YNQKQ++ LGVAKDL
Sbjct  3    RLKERFSLFFNNRWLVFVAAMWIQSFAGIGYLFGSISPIIKSSLNYNQKQIARLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTLSEILPLWA LLVG  QNF+GYGWVWLI+TGR P LP+W MC
Sbjct  63   GDSVGFLAGTLSEILPLWAALLVGAVQNFIGYGWVWLIVTGRSPTLPLWVMC  114


 Score =   159 bits (402),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+GTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGL GAI+TQIY LIHSPD
Sbjct  113  MCLLIFIGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAIMTQIYALIHSPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FMIAVGPA+V I+LMF+IRPVG
Sbjct  173  HASLIFMIAVGPAMVAIALMFIIRPVG  199



>ref|XP_009802951.1| PREDICTED: uncharacterized protein LOC104248396 [Nicotiana sylvestris]
Length=595

 Score =   194 bits (494),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RLKEK+  FF+NRWLVFVA+MW+Q+ AG+GYLFGSISPIIKS++ YNQ+QLS LGVAKDL
Sbjct  6    RLKEKLCLFFNNRWLVFVAAMWIQSFAGIGYLFGSISPIIKSSLNYNQRQLSRLGVAKDL  65

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTLSEILPLWA LLVG  QNF+GYGWVWLI+TGR P LP+W MC
Sbjct  66   GDSVGFLAGTLSEILPLWATLLVGAIQNFIGYGWVWLIVTGRSPILPLWVMC  117


 Score =   159 bits (401),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY LIHSPD
Sbjct  116  MCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAIMTQIYALIHSPD  175

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGPA+V+I+LMFLIRPVG
Sbjct  176  HASLIFMVAVGPAMVVIALMFLIRPVG  202



>ref|XP_008379106.1| PREDICTED: uncharacterized protein LOC103442130 [Malus domestica]
Length=595

 Score =   195 bits (495),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR++EK+ SFFSNRWLVFVA+MWVQ+CAG+GYLFGSISP+IKS+M YNQ++++ LGVAK
Sbjct  1    MGRVQEKLRSFFSNRWLVFVAAMWVQSCAGIGYLFGSISPVIKSSMDYNQREIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+L E+LPLWA LLVG   NFVGYGWVWL++TGR P+L +WAMC
Sbjct  61   DLGDSVGFLAGSLCEVLPLWAALLVGALMNFVGYGWVWLVVTGRAPSLNLWAMC  114


 Score =   157 bits (396),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IHS
Sbjct  111  WAMCILIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYVMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPAMVVIALMFIVRPVG  199



>ref|XP_004231775.1| PREDICTED: probable transporter mch1 [Solanum lycopersicum]
Length=590

 Score =   192 bits (487),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RLKE+ + FF+NRWLVFVA+MW+Q+ AG+GYLFGSISPIIKS++ YNQ+Q++ LGVAKDL
Sbjct  3    RLKERFSLFFNNRWLVFVAAMWIQSFAGIGYLFGSISPIIKSSLNYNQRQVARLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTLSEILPLWA LLVG  QNF+GYGWVWLI+TGR P LP+W MC
Sbjct  63   GDSVGFLAGTLSEILPLWAALLVGAVQNFIGYGWVWLIVTGRSPTLPLWLMC  114


 Score =   158 bits (400),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C LIF+GTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGL GAI+TQIY LIHSPD
Sbjct  113  MCFLIFIGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAIMTQIYALIHSPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FMIAVGPA+V I+LMF+IRPVG
Sbjct  173  HASLIFMIAVGPAMVAIALMFIIRPVG  199



>ref|XP_009344920.1| PREDICTED: probable transporter mch1 [Pyrus x bretschneideri]
Length=595

 Score =   196 bits (497),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR++EK+ SFFSNRWLVFVA+MWVQ+CAG+GYLFGSISP+IKS+M YNQ+Q++ LGVAK
Sbjct  1    MGRVQEKLRSFFSNRWLVFVAAMWVQSCAGIGYLFGSISPVIKSSMDYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+L E+LPLWA LLVG   NFVGYGWVWL++TGR P+L +WAMC
Sbjct  61   DLGDSVGFLAGSLCEVLPLWAALLVGALMNFVGYGWVWLVVTGRAPSLNLWAMC  114


 Score =   154 bits (390),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  111  WAMCILIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYVMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPAMVVIALMFIVRPVG  199



>ref|XP_008231105.1| PREDICTED: probable transporter mch1 [Prunus mume]
Length=595

 Score =   198 bits (504),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+GRL+EK  SFFSNRWLVFVA+MWVQ+CAG+GYLFGSISP+IKS+M YNQ+Q++ LGVA
Sbjct  1    MMGRLQEKFRSFFSNRWLVFVAAMWVQSCAGIGYLFGSISPVIKSSMDYNQRQIARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGFLAG+L E+LPLWA LL+G   NF+GYGWVWLI+TGR P L +WAMC
Sbjct  61   KDLGDSVGFLAGSLCEVLPLWAALLIGALMNFIGYGWVWLIVTGRAPTLSLWAMC  115


 Score =   151 bits (381),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY  IHS
Sbjct  112  WAMCILIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAIMTQIYVTIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGP +VI++LMF++RPVG
Sbjct  172  PDHASLIFMVAVGPTMVIVALMFIVRPVG  200



>ref|XP_010926825.1| PREDICTED: probable transporter mch1 [Elaeis guineensis]
Length=594

 Score =   192 bits (489),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+ K+ SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++GYNQ+QL+SLGVAK
Sbjct  1    MGALQVKLRSFLNNRWLVFVAAMWMQSCAGIGYLFGSISPVIKSSLGYNQRQLASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAGTL EILPLWA LL+G  QN +GYGWVWLI++GR+P LP+W MC
Sbjct  61   DLGDSVGFLAGTLCEILPLWAALLIGALQNLIGYGWVWLIVSGRVPVLPLWVMC  114


 Score =   157 bits (396),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+IH+PD
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMIHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP +V+I+LMF+IRPVG
Sbjct  173  HAALIFMVAVGPTMVVIALMFIIRPVG  199



>ref|XP_009601173.1| PREDICTED: probable transporter mch1 [Nicotiana tomentosiformis]
Length=594

 Score =   189 bits (481),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+  LKE+   FF+NRWLVFV +MW+QT AG+GYLFGSISPIIKS++ YNQKQ++ LGVA
Sbjct  1    MMAHLKERFGFFFNNRWLVFVVAMWIQTFAGIGYLFGSISPIIKSSLNYNQKQIARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGFLAGTL EILPLWA LLVG  QNF+GYGWVWLI+TGR   LP+WAMC
Sbjct  61   KDLGDSVGFLAGTLCEILPLWAALLVGAIQNFIGYGWVWLIVTGRTLPLPLWAMC  115


 Score =   159 bits (403),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  112  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FMIAVGPA+VII+LMF+IRPVG
Sbjct  172  PDHASLIFMIAVGPAMVIIALMFIIRPVG  200



>ref|XP_008339906.1| PREDICTED: uncharacterized protein LOC103402901 [Malus domestica]
Length=595

 Score =   194 bits (493),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR++EK+ SFF+NRWLVFVA+MWVQ+CAG+GYLFGSISP+IKS+M YNQ+Q++ LGVAK
Sbjct  1    MGRVQEKLRSFFNNRWLVFVAAMWVQSCAGIGYLFGSISPVIKSSMDYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+L E+LPLWA LLVG   NFVGYGWVWL++TGR P+L +WAMC
Sbjct  61   DLGDSVGFLAGSLCEVLPLWAALLVGALMNFVGYGWVWLVVTGRAPSLNLWAMC  114


 Score =   154 bits (390),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  111  WAMCILIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYVMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPAMVVIALMFIVRPVG  199



>ref|XP_007214954.1| hypothetical protein PRUPE_ppa003193mg [Prunus persica]
 gb|EMJ16153.1| hypothetical protein PRUPE_ppa003193mg [Prunus persica]
Length=594

 Score =   196 bits (498),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRL+EK  SFFSNRWLVFVA+MWVQ+CAG+GYLFGSISP+IKS+M YNQ+Q++ LGVAK
Sbjct  1    MGRLQEKFRSFFSNRWLVFVAAMWVQSCAGIGYLFGSISPVIKSSMDYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+L E+LPLWA LL+G   NF+GYGWVWLI+TGR P L +WAMC
Sbjct  61   DLGDSVGFLAGSLCEVLPLWAALLIGALMNFIGYGWVWLIVTGRAPTLSLWAMC  114


 Score =   152 bits (383),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY  IHS
Sbjct  111  WAMCVLIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAIMTQIYVTIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGP +VI++LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPTMVIVALMFIVRPVG  199



>gb|EPS64558.1| hypothetical protein M569_10221, partial [Genlisea aurea]
Length=574

 Score =   183 bits (465),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  102  EKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDS  281
            ++ +SF +NRWLVFVA+MW+Q+CAG+GY+FGSISP IKS++ YNQ+Q++ L VAKDLGDS
Sbjct  1    DRFSSFLNNRWLVFVAAMWIQSCAGIGYVFGSISPRIKSSLSYNQRQIAKLAVAKDLGDS  60

Query  282  VGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            VGFLAG+LSEILPLW VLLVG  QNFVGYGWVWL++T R PALP+WAMC
Sbjct  61   VGFLAGSLSEILPLWGVLLVGALQNFVGYGWVWLVVTKRAPALPLWAMC  109


 Score =   162 bits (411),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTA+LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS
Sbjct  106  WAMCILIFVGTNGETYFNTASLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  165

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+ISLMF IRPVG
Sbjct  166  PDHASLIFMVAVGPAMVVISLMFFIRPVG  194



>ref|XP_004304525.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=591

 Score =   187 bits (475),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  102  EKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDS  281
            EK+ SFFSNRWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++ YNQ+Q++ LGVAKDLGDS
Sbjct  2    EKLKSFFSNRWLVFVAAMWMQSWAGIGYLFGSISPVIKSSLNYNQRQIARLGVAKDLGDS  61

Query  282  VGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            VGFLAGTL E+LPLWA LL+G  +NFVGYGWVWLI+TGR P LP+WAMC
Sbjct  62   VGFLAGTLCEVLPLWAALLIGALKNFVGYGWVWLIVTGRAPPLPLWAMC  110


 Score =   157 bits (397),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY +IHS
Sbjct  107  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAIMTQIYAVIHS  166

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+VII+LMF++RPVG
Sbjct  167  PDHASLIFMVAVGPAMVIIALMFIVRPVG  195



>ref|XP_006357196.1| PREDICTED: uncharacterized protein LOC102603984 [Solanum tuberosum]
Length=594

 Score =   187 bits (474),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            LKE+   FF+NRWLVFVA+MW+QTCAG+GYLFGSISP+IK ++ YNQKQ++ LGVAKDLG
Sbjct  5    LKERFGYFFNNRWLVFVAAMWIQTCAGIGYLFGSISPVIKISLNYNQKQIARLGVAKDLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DSVGFLAGTL EILPLWA LLVG  QNF+GYGWVWLI+T R   LP+WAMC
Sbjct  65   DSVGFLAGTLCEILPLWAALLVGAIQNFLGYGWVWLIVTRRTAPLPLWAMC  115


 Score =   157 bits (397),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  112  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FMIAV PA+VII+LMF+IRPVG
Sbjct  172  PDHASLIFMIAVAPAMVIIALMFIIRPVG  200



>ref|XP_011098901.1| PREDICTED: uncharacterized protein LOC105177434 [Sesamum indicum]
Length=589

 Score =   188 bits (478),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L E+ +SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP IK+++ YNQ+Q++ LGVAK
Sbjct  1    MGCLSERFSSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPTIKTSLNYNQRQVARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLA +LSEILPLW  +LVG  QNFVGYGWVWL++TG++P LP+WAMC
Sbjct  61   DLGDSVGFLAASLSEILPLWGAVLVGAIQNFVGYGWVWLVVTGKVPVLPLWAMC  114


 Score =   155 bits (392),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY L+HS
Sbjct  111  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYALMHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGP +V I+LMF+IRPVG
Sbjct  171  PDHASLIFMVAVGPTMVAIALMFIIRPVG  199



>ref|XP_010033424.1| PREDICTED: uncharacterized protein LOC104422714 [Eucalyptus grandis]
 gb|KCW53059.1| hypothetical protein EUGRSUZ_J02353 [Eucalyptus grandis]
Length=593

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRL E+  +  +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQ+Q++ LGVAK
Sbjct  1    MGRLGERFGALVNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLSYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+L E+LP+W  LLVG  QNFVGYGWVWLI+TGR P LP+WAMC
Sbjct  61   DLGDSVGFLAGSLCEVLPMWGALLVGALQNFVGYGWVWLIVTGRAPVLPLWAMC  114


 Score =   155 bits (392),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+GTNGETYFNT ALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  111  WAMCLLIFIGTNGETYFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FMIAVGPA+VII+LMF++RPVG
Sbjct  171  PDHANLIFMIAVGPAMVIIALMFIVRPVG  199



>ref|XP_009404757.1| PREDICTED: uncharacterized protein LOC103987995 [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   187 bits (475),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+ ++ +   NRWLVFVA+MWVQ  AG+GYLFGS+SP+IKS++GYNQ+Q++ LGVAK
Sbjct  1    MGELRGRLGTLLHNRWLVFVAAMWVQAVAGIGYLFGSLSPVIKSSLGYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDS+GFLAG+L EILPLWA LL+GV QNFVGYGWVWLI+TGR P LP+WAMC
Sbjct  61   DLGDSIGFLAGSLCEILPLWAALLIGVLQNFVGYGWVWLIVTGRAPVLPLWAMC  114


 Score =   155 bits (393),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQI+ +IH+
Sbjct  111  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIFAMIHT  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGP++V+ISLMF++RPVG
Sbjct  171  PDHAALIFMVAVGPSMVVISLMFIVRPVG  199



>emb|CDP16703.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   186 bits (472),  Expect(2) = 9e-85, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            MV   KE++  F +NRWLVFVA+MW+Q+CAG+GYLFGSISP IK+++ YNQ+Q++ LGVA
Sbjct  1    MVVSFKERLGLFVNNRWLVFVAAMWIQSCAGIGYLFGSISPTIKTSLNYNQRQIARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGFLAG+L EILPLW  LLVG  QNFVGYGWVWLIIT R+P LP+WAMC
Sbjct  61   KDLGDSVGFLAGSLCEILPLWGALLVGAVQNFVGYGWVWLIITRRVPVLPLWAMC  115


 Score =   155 bits (391),  Expect(2) = 9e-85, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  112  WAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASLVFM+AVGPA+VI++ MF++RPVG
Sbjct  172  PDHASLVFMVAVGPAMVILAFMFIVRPVG  200



>ref|XP_010112377.1| hypothetical protein L484_010782 [Morus notabilis]
 gb|EXC33372.1| hypothetical protein L484_010782 [Morus notabilis]
Length=599

 Score =   183 bits (464),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+E+V    SNRWLVFVA+MW+Q+ AGVGYLFGSISP+IKS++ YNQ+Q+S LGVAK
Sbjct  1    MGGLRERVKGLVSNRWLVFVAAMWLQSVAGVGYLFGSISPVIKSSLNYNQRQVSRLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGF AG+L E LPLWA L VG  +NFVGYGWVWLI+TGR P LP+WAMC
Sbjct  61   DLGDSVGFFAGSLCEFLPLWAALFVGALKNFVGYGWVWLIVTGRAPVLPLWAMC  114


 Score =   157 bits (396),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIH 
Sbjct  111  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHQ  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPV  678
            PDHA+++FM+AVGPA+V I+LMFL+RPV
Sbjct  171  PDHANIIFMVAVGPAMVAIALMFLVRPV  198



>ref|XP_004233292.1| PREDICTED: probable transporter mch1 [Solanum lycopersicum]
Length=596

 Score =   182 bits (461),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            LK++   FF NRWLVFVA+MW+QTCAG+GYLFGSISP+IK ++ YNQKQ++ LGVAKDLG
Sbjct  5    LKQRFGYFFHNRWLVFVAAMWIQTCAGLGYLFGSISPVIKISLNYNQKQIARLGVAKDLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DSVGFLA TL EILPLWA LLVG  QNF+GYGW+WLI+T R   LP+WAMC
Sbjct  65   DSVGFLAATLCEILPLWAALLVGAIQNFIGYGWLWLIVTRRTEPLPLWAMC  115


 Score =   155 bits (393),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI+TQIY +IHS
Sbjct  112  WAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAIITQIYAVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+F+IAVGPA+VII+LMF+IRPVG
Sbjct  172  PDHASLIFVIAVGPAMVIIALMFIIRPVG  200



>gb|EYU45415.1| hypothetical protein MIMGU_mgv1a006811mg [Erythranthe guttata]
Length=430

 Score =   187 bits (475),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G   E ++SFF+NRWLVFVA+MWVQ+CAG+GYLFGSISP IK+++ YNQ+Q++ LGVAK
Sbjct  1    MGCFSESLSSFFNNRWLVFVAAMWVQSCAGIGYLFGSISPTIKTSLNYNQRQVARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG LSEILPLW VLL+G  QNFVGYGWVWL++TG  P LP+WAMC
Sbjct  61   DLGDSVGFLAGGLSEILPLWGVLLIGAVQNFVGYGWVWLVVTGIAPVLPLWAMC  114


 Score =   150 bits (378),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGL GAILTQ+Y +++S
Sbjct  111  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLGGAILTQMYAVMNS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGP +V I+LMF+IRPVG
Sbjct  171  PDHASLIFMVAVGPTMVAIALMFIIRPVG  199



>ref|XP_002270737.1| PREDICTED: uncharacterized protein LOC100244537 [Vitis vinifera]
 emb|CBI21339.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   182 bits (461),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E+  +F +NRWLVFVA+MW+Q+CAG+GYLFGS+SP++KS++ YNQ+Q++ LGVAKD+
Sbjct  3    RLPERFRAFLNNRWLVFVAAMWIQSCAGIGYLFGSLSPVMKSSLNYNQRQIAKLGVAKDI  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDS+GF  G+L EILPLWAVLLVG  QNF+GYGWVWLI+T R+P LP+WA+C
Sbjct  63   GDSIGFWIGSLCEILPLWAVLLVGALQNFIGYGWVWLIVTHRVPTLPLWAIC  114


 Score =   154 bits (390),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNT  LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+IHS
Sbjct  111  WAICILIFVGTNGETYFNTVDLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASLVFM+AVGP +V+ +LMF++RPVG
Sbjct  171  PDHASLVFMVAVGPIMVVFALMFIVRPVG  199



>emb|CAN82292.1| hypothetical protein VITISV_016786 [Vitis vinifera]
Length=591

 Score =   181 bits (459),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E+  +F +NRWLVFVA+MW+Q+CAG+GYLFGS+SP++KS++ YNQ+Q++ LGVAKD+
Sbjct  3    RLPERXRAFXNNRWLVFVAAMWIQSCAGIGYLFGSLSPVMKSSLNYNQRQIAKLGVAKDI  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDS+GF  G+L EILPLWAVLLVG  QNF+GYGWVWLI+T R+P LP+WA+C
Sbjct  63   GDSIGFWIGSLCEILPLWAVLLVGALQNFIGYGWVWLIVTHRVPTLPLWAIC  114


 Score =   154 bits (390),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNT  LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+IHS
Sbjct  111  WAICILIFVGTNGETYFNTVDLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASLVFM+AVGP +V+ +LMF++RPVG
Sbjct  171  PDHASLVFMVAVGPIMVVFALMFIVRPVG  199



>ref|XP_010249040.1| PREDICTED: uncharacterized protein LOC104591744 [Nelumbo nucifera]
Length=593

 Score =   186 bits (472),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +3

Query  84   MVGRL---KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSL  254
            M G++   KEK  +F +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQ+Q++ L
Sbjct  1    MFGKMLPFKEKFRAFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQRQIARL  60

Query  255  GVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GVAKDLGDSVGFLAG+L E LP+W  LLVG  QNF+GYGWVWLI+TGR+P LP+WAMC
Sbjct  61   GVAKDLGDSVGFLAGSLCESLPIWGALLVGALQNFIGYGWVWLIVTGRVPILPLWAMC  118


 Score =   148 bits (374),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY ++++
Sbjct  115  WAMCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAMVNA  174

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+++FM+AVGP++VII+LMF++RPVG
Sbjct  175  PDQATIIFMVAVGPSMVIIALMFIVRPVG  203



>ref|XP_009402249.1| PREDICTED: uncharacterized protein LOC103986091 [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   183 bits (465),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+ ++ +  +NRWLVFVA+MWVQ  AG GYLFGS+SP+IKS++GYNQ+Q++ LGVAKDLG
Sbjct  4    LRGRLRTLLNNRWLVFVAAMWVQAVAGTGYLFGSLSPVIKSSLGYNQRQIARLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DS+GFLAGTL EILPLWA LLVGV QNFVGYGWVWL++TGR P +P+WAMC
Sbjct  64   DSIGFLAGTLCEILPLWAALLVGVLQNFVGYGWVWLVVTGRTPRMPLWAMC  114


 Score =   150 bits (378),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFV TNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQI+ +IH+
Sbjct  111  WAMCVLIFVATNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIFAMIHT  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+F++AVGP++V+I+L+F++RPVG
Sbjct  171  PDHAALLFVVAVGPSMVVIALLFIVRPVG  199



>ref|XP_009403771.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
Length=593

 Score =   182 bits (463),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            ++ S  +NRWLVFVA MWVQ  AG+GYLFGS+SP+IKS++GYNQ+Q++SLGVAKDLGDS+
Sbjct  7    RLGSLLNNRWLVFVAGMWVQAVAGIGYLFGSLSPVIKSSLGYNQRQIASLGVAKDLGDSI  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GFLAGTL EILPLWA L +GV QNF GYGWVWLI+TGR P LP+WAMC
Sbjct  67   GFLAGTLCEILPLWAALFIGVLQNFFGYGWVWLIVTGRAPRLPLWAMC  114


 Score =   150 bits (380),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNTAALVS VQNFP+SRGP+VGILKGFAGLSGAILTQI+ ++H+
Sbjct  111  WAMCILIFVGTNGETYFNTAALVSCVQNFPRSRGPIVGILKGFAGLSGAILTQIFAMMHT  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGP++V+ISL F++RPVG
Sbjct  171  PDHAALIFMVAVGPSMVVISLAFIVRPVG  199



>ref|XP_002270809.1| PREDICTED: uncharacterized protein LOC100266857 [Vitis vinifera]
 emb|CBI21337.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   179 bits (455),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E+  +FF+NRWLVFVA+MW+Q+CAG+GYLFGS+SP+IKS++ YNQ+Q++ LGVAKD+
Sbjct  3    RLPERFRAFFNNRWLVFVAAMWIQSCAGIGYLFGSLSPVIKSSLNYNQRQIARLGVAKDI  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGF  G+L EILPLW  LL+G  QN +GYGWVWLIIT R+P LP+WA+C
Sbjct  63   GDSVGFWIGSLCEILPLWVALLIGALQNLIGYGWVWLIITHRVPTLPLWAIC  114


 Score =   154 bits (388),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNT  LVS VQNFPKSRGPVVGILKGF+GLSGAILTQIYT+IHS
Sbjct  111  WAICILIFVGTNGETYFNTVDLVSCVQNFPKSRGPVVGILKGFSGLSGAILTQIYTMIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASLVFM+AVGP +V+ +LMF++RPVG
Sbjct  171  PDHASLVFMVAVGPTMVVFALMFIVRPVG  199



>ref|XP_010680020.1| PREDICTED: probable transporter mch1 [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   180 bits (456),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L E++ +F SNRWLVFV +MW+Q CAG+GY+FGSISP+IKS + YNQ+Q++ LGVAK
Sbjct  1    MGDLNERLKAFISNRWLVFVVAMWIQACAGIGYMFGSISPVIKSNLNYNQRQVARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFL G + E+LPLWA LL+G  QN +GYGWVWLIITGR   LP+WAMC
Sbjct  61   DLGDSVGFLTGYICEVLPLWAALLIGALQNLIGYGWVWLIITGRATPLPLWAMC  114


 Score =   152 bits (385),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C LIF+GTNGETYFNTAALVS VQNFPK+RGP+VGILKGFAGLSGAILTQ+YTLI+S
Sbjct  111  WAMCFLIFIGTNGETYFNTAALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQVYTLIYS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPV  678
            PD ASLVFMIAVGP +V+ISLMF+IRPV
Sbjct  171  PDQASLVFMIAVGPTMVVISLMFIIRPV  198



>ref|XP_006659624.1| PREDICTED: uncharacterized protein LOC102701471 [Oryza brachyantha]
Length=595

 Score =   174 bits (442),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q  AGVGYLFGSISP+IKS++GYNQ+QL+SLGVAKDLGDSV
Sbjct  7    RVRGFLRNRWLVFVAAMWMQAFAGVGYLFGSISPVIKSSLGYNQRQLASLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GFLAGTL  +LPLWA +LVG AQN VGYGWVWL +  R P  P+WAMC
Sbjct  67   GFLAGTLCAVLPLWAAVLVGAAQNLVGYGWVWLAVAHRAPVPPLWAMC  114


 Score =   157 bits (396),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y 
Sbjct  107  VPPLWAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQMYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            +IHSPDHA+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  MIHSPDHAALIFMVAVGPTMVVIALMFIVRPVG  199



>ref|XP_009413001.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
Length=589

 Score =   179 bits (454),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            R + +++S  +NRWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQ+Q++ LGVAKDL
Sbjct  3    RFRGRLHSLLNNRWLVFVAAMWMQSWAGIGYLFGSISPVIKSSLGYNQRQIAGLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTL E+LPLWA LL+G  QN +GYG VWL++TGR+PALP+W MC
Sbjct  63   GDSVGFLAGTLCEVLPLWAALLIGALQNLIGYGLVWLVVTGRVPALPLWVMC  114


 Score =   152 bits (383),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETY+NTAALVS VQNFPK+RGPVVGILKGFAGLSGAI+TQIY ++H+PD
Sbjct  113  MCILIFVGNNGETYYNTAALVSCVQNFPKNRGPVVGILKGFAGLSGAIITQIYAIVHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGPA+V+I+LMF++RPVG
Sbjct  173  HAALIFMLAVGPAMVVIALMFIVRPVG  199



>ref|XP_002511170.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51772.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score =   184 bits (467),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E+  +FF+NRWLVFV +MWVQ+CAG+GYLFGSISP+IKS+MGYNQ++++ LGVAKDL
Sbjct  3    RLHERFKAFFNNRWLVFVCAMWVQSCAGIGYLFGSISPVIKSSMGYNQREVAMLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDS+GF+AG L E+LP+WA+LL+GV QNFVGYG +WLI+  +LPALP+W +C
Sbjct  63   GDSIGFVAGALCEVLPIWAILLIGVFQNFVGYGLLWLIVIQKLPALPLWVLC  114


 Score =   146 bits (369),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCV +FVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ P+
Sbjct  113  LCVAVFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINFPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A L+FM+AVGP++V+I+LMF+IRPVG
Sbjct  173  EAWLIFMVAVGPSMVVIALMFIIRPVG  199



>ref|NP_566157.1| major facilitator protein [Arabidopsis thaliana]
 gb|AAF03444.1|AC010797_20 unknown protein [Arabidopsis thaliana]
 gb|AAF14842.1|AC011664_24 unknown protein [Arabidopsis thaliana]
 gb|AAM91600.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15407.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73737.1| major facilitator protein [Arabidopsis thaliana]
Length=584

 Score =   196 bits (497),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E+V SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  66   SVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMC  115


 Score =   134 bits (338),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGL GAIL+Q+YT+IHS
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             D ASL+FM+AV P++V++ LMF IRPVG
Sbjct  172  SDRASLIFMVAVAPSVVVVPLMFFIRPVG  200



>gb|AAC39501.1| nodulin-like protein [Arabidopsis thaliana]
Length=559

 Score =   195 bits (496),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E+V SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  66   SVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMC  115


 Score =   134 bits (337),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGL GAIL+Q+YT+IHS
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             D ASL+FM+AV P++V++ LMF IRPVG
Sbjct  172  SDRASLIFMVAVAPSVVVVPLMFFIRPVG  200



>gb|AAB07879.1| similar to a E. coli hypothetical protein F402 encoded by GenBank 
Accession Number S47768 [Arabidopsis thaliana]
Length=481

 Score =   195 bits (495),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +E+V SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVA
Sbjct  1    MARTTRERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  61   KDLGDSVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMC  115


 Score =   134 bits (338),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGL GAIL+Q+YT+IHS
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             D ASL+FM+AV P++V++ LMF IRPVG
Sbjct  172  SDRASLIFMVAVAPSVVVVPLMFFIRPVG  200



>gb|EAZ07770.1| hypothetical protein OsI_30023 [Oryza sativa Indica Group]
Length=595

 Score =   171 bits (434),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q+ AGVGYLFGSISP+IK+++GYNQ++++ LGVAKDLGDSV
Sbjct  7    RVRGFVRNRWLVFVAAMWMQSFAGVGYLFGSISPVIKASLGYNQREVAGLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GFLAGTLS +LPLWA +LVG AQN  GYGWVWL +T R P  P+WAMC
Sbjct  67   GFLAGTLSAVLPLWAAVLVGAAQNLFGYGWVWLAVTHRAPVPPLWAMC  114


 Score =   157 bits (396),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y 
Sbjct  107  VPPLWAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQMYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            +IHSPDHA+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  MIHSPDHAALIFMVAVGPTMVVIALMFIVRPVG  199



>ref|NP_001062339.1| Os08g0532400 [Oryza sativa Japonica Group]
 dbj|BAD11650.1| nodulin-related protein-like [Oryza sativa Japonica Group]
 dbj|BAF24253.1| Os08g0532400 [Oryza sativa Japonica Group]
 gb|EAZ43456.1| hypothetical protein OsJ_28062 [Oryza sativa Japonica Group]
 dbj|BAG95149.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   171 bits (434),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q+ AGVGYLFGSISP+IK+++GYNQ++++ LGVAKDLGDSV
Sbjct  7    RVRGFVRNRWLVFVAAMWMQSFAGVGYLFGSISPVIKASLGYNQREVAGLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GFLAGTLS +LPLWA +LVG AQN  GYGWVWL +T R P  P+WAMC
Sbjct  67   GFLAGTLSAVLPLWAAVLVGAAQNLFGYGWVWLAVTHRAPVPPLWAMC  114


 Score =   157 bits (396),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y 
Sbjct  107  VPPLWAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQMYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            +IHSPDHA+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  MIHSPDHAALIFMVAVGPTMVVIALMFIVRPVG  199



>ref|XP_010250689.1| PREDICTED: uncharacterized protein LOC104592868 isoform X1 [Nelumbo 
nucifera]
Length=608

 Score =   185 bits (469),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL+ K+  F +NRWLVFVA+MW+Q+CAG+GYL+GSISP+IKS++ YNQ+Q++ LGVAKDL
Sbjct  7    RLQGKLRDFINNRWLVFVAAMWIQSCAGIGYLYGSISPVIKSSLNYNQRQIARLGVAKDL  66

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAG+L E+LP+W  LL+G  +NF+GYGWVWLI+TGR+P LP+WAMC
Sbjct  67   GDSVGFLAGSLCEVLPIWGALLIGALKNFIGYGWVWLIVTGRVPTLPLWAMC  118


 Score =   143 bits (360),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CV+IFVG NG TYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQ+Y +I++
Sbjct  115  WAMCVVIFVGANGGTYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQVYAMINA  174

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+++FM+AVGP++V+I+LMF++RPVG
Sbjct  175  PDQAAIIFMVAVGPSMVVIALMFIVRPVG  203



>emb|CDP15002.1| unnamed protein product [Coffea canephora]
Length=583

 Score =   185 bits (470),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            MV ++ EK+ SFF+N+W VFVASMWVQ+C+G+GYLFGSISP+IKSTMGYNQ+Q+S LGVA
Sbjct  1    MVIQIPEKLKSFFNNKWAVFVASMWVQSCSGIGYLFGSISPVIKSTMGYNQRQVSMLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGD++GF+AG+L EILP+W+VLL+GV QNF+GYG V LI+ G LPALP+W +C
Sbjct  61   KDLGDAIGFIAGSLCEILPIWSVLLIGVVQNFIGYGLVGLIVVGALPALPLWVLC  115


 Score =   141 bits (355),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+LIFVGTNGETYFNT ALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +++ P+
Sbjct  114  LCILIFVGTNGETYFNTGALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMMNFPN  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+AV P ++I +LMF++RPVG
Sbjct  174  QASLIFMVAVCPTVIISALMFIVRPVG  200



>ref|XP_007037994.1| Major facilitator protein [Theobroma cacao]
 gb|EOY22495.1| Major facilitator protein [Theobroma cacao]
Length=588

 Score =   178 bits (451),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +++EK+ +F +NRWLVFV +MWVQ+CAGVGYLFGSISP+IKS MGYNQ+Q++ LGVAKDL
Sbjct  3    QIREKLKAFVNNRWLVFVCAMWVQSCAGVGYLFGSISPVIKSAMGYNQRQIAILGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GDS+GF+AG+  EILP+W +LL+GV QNFVGYG VWL+I   LP LP+W +C  I
Sbjct  63   GDSIGFVAGSCCEILPMWVILLIGVVQNFVGYGLVWLVIANILPDLPLWVLCVAI  117


 Score =   147 bits (372),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCV IFVGTNGETY+NTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQ+YT+I+ P+
Sbjct  113  LCVAIFVGTNGETYYNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQVYTMINFPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+AVGP+IV+I+LMF++RPVG
Sbjct  173  EAALIFMVAVGPSIVVIALMFIVRPVG  199



>ref|XP_009623438.1| PREDICTED: probable transporter mch1 [Nicotiana tomentosiformis]
Length=584

 Score =   179 bits (455),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +  EK+ SF ++RWLVFVASMWV +C+G+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDL
Sbjct  3    QFSEKIKSFLNDRWLVFVASMWVMSCSGIGYLFGSISPVIKSGMGYNQRQIAMLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GD++GFLAG LSE+LP+WAVL +GV QNFVGYG VWLI+  +LP LP+W +C
Sbjct  63   GDAIGFLAGILSEVLPIWAVLFIGVIQNFVGYGLVWLIVAHKLPVLPLWVLC  114


 Score =   146 bits (368),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCVLIF+GTNGETYFNT ALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y + + PD
Sbjct  113  LCVLIFIGTNGETYFNTGALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQVYAMFNFPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASLVFM+AVGP+IVI ++MFL+RPVG
Sbjct  173  QASLVFMVAVGPSIVITAVMFLVRPVG  199



>ref|XP_009783567.1| PREDICTED: probable transporter mch1 [Nicotiana sylvestris]
Length=584

 Score =   180 bits (457),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +  EK  SF ++RWLVFVASMWV +C+G+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDL
Sbjct  3    QFSEKFKSFLNDRWLVFVASMWVMSCSGIGYLFGSISPVIKSGMGYNQRQIAMLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GD++GFLAG LSEILP+WAVL +GV QNFVGYG VWLI+  +LPALP+W +C
Sbjct  63   GDAIGFLAGILSEILPIWAVLFIGVIQNFVGYGLVWLIVAHKLPALPLWVLC  114


 Score =   145 bits (365),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCVLIF+GTNGETYFNT ALVS VQNFPK+RGP+VGILKGFAGLSGAILTQ+Y + + PD
Sbjct  113  LCVLIFIGTNGETYFNTGALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQVYAMFNFPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASLVFM+AVGP+IVI ++MFL+RPVG
Sbjct  173  QASLVFMVAVGPSIVITAVMFLVRPVG  199



>ref|XP_006351510.1| PREDICTED: uncharacterized protein LOC102597647 [Solanum tuberosum]
Length=587

 Score =   178 bits (452),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +  EK   F ++RWLVFVASMWVQ+C+G+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDL
Sbjct  3    QFSEKFRGFLNDRWLVFVASMWVQSCSGIGYLFGSISPVIKSGMGYNQRQIALLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GD++GFLAG L E+LP+WAVL +GV QNFVGYG VWLI+  +LPALP+W +C
Sbjct  63   GDAIGFLAGILCEVLPIWAVLFIGVVQNFVGYGVVWLIVAHKLPALPLWVLC  114


 Score =   146 bits (368),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCVLIF+GTNGETYFNT ALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y + + PD
Sbjct  113  LCVLIFIGTNGETYFNTGALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQVYAMFNFPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASLVFM+AVGP+IVI ++MFL+RPVG
Sbjct  173  QASLVFMVAVGPSIVITAVMFLVRPVG  199



>ref|XP_004975414.1| PREDICTED: uncharacterized protein LOC101772491 [Setaria italica]
Length=592

 Score =   178 bits (451),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRL ++V +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K  +GYNQ+QL++LGVAK
Sbjct  1    MGRLGDRVRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVVKEALGYNQRQLAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGF AG+LS ILP WA+LL+G AQNF+GYGW+WLI+T + PALP+W MC
Sbjct  61   DLGDCVGFFAGSLSAILPSWAMLLIGAAQNFLGYGWLWLIVTRQAPALPLWMMC  114


 Score =   146 bits (369),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVGTNGETYFNT ALV+ +QNFPKSRGP VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  113  MCVLIFVGTNGETYFNTTALVTCIQNFPKSRGPTVGIMKGFAGLSSAILTQLYAVMHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVAIGLMFIIRPVG  199



>ref|XP_010250690.1| PREDICTED: uncharacterized protein LOC104592868 isoform X2 [Nelumbo 
nucifera]
Length=515

 Score =   182 bits (461),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL+ K+  F +NRWLVFVA+MW+Q+CAG+GYL+GSISP+IKS++ YNQ+Q++ LGVAKDL
Sbjct  7    RLQGKLRDFINNRWLVFVAAMWIQSCAGIGYLYGSISPVIKSSLNYNQRQIARLGVAKDL  66

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAG+L E+LP+W  LL+G  +NF+GYGWVWLI+TGR+P LP+WAMC
Sbjct  67   GDSVGFLAGSLCEVLPIWGALLIGALKNFIGYGWVWLIVTGRVPTLPLWAMC  118


 Score =   142 bits (358),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CV+IFVG NG TYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQ+Y +I++
Sbjct  115  WAMCVVIFVGANGGTYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQVYAMINA  174

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+++FM+AVGP++V+I+LMF++RPVG
Sbjct  175  PDQAAIIFMVAVGPSMVVIALMFIVRPVG  203



>ref|XP_011044125.1| PREDICTED: uncharacterized protein LOC105139411 [Populus euphratica]
 ref|XP_011044126.1| PREDICTED: uncharacterized protein LOC105139411 [Populus euphratica]
 ref|XP_011044127.1| PREDICTED: uncharacterized protein LOC105139411 [Populus euphratica]
Length=591

 Score =   179 bits (455),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL ++  +FF++RWLVFV +MW+Q+CAG+GYLFGSISP+IKSTMGYNQ+Q++ LGVAKDL
Sbjct  5    RLHDRFKAFFNDRWLVFVCAMWIQSCAGIGYLFGSISPVIKSTMGYNQRQVAILGVAKDL  64

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GDS+GF+ G+L EI P+WAV L+GV QNFVGYG VWLI+  ++PALP+W +C  I
Sbjct  65   GDSIGFVPGSLCEIFPIWAVSLIGVVQNFVGYGLVWLIVAQKVPALPLWVLCVAI  119


 Score =   144 bits (364),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCV IFVGTNGETYFNT ALVS VQNFPK+RGPVVGILKGFAGLSGAILTQIY +I+SP+
Sbjct  115  LCVAIFVGTNGETYFNTVALVSCVQNFPKNRGPVVGILKGFAGLSGAILTQIYAMINSPN  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+FMIAVGP++V+I++MF++RPV
Sbjct  175  EASLIFMIAVGPSMVVIAIMFVVRPV  200



>ref|XP_004234304.1| PREDICTED: probable transporter mch1 isoform X1 [Solanum lycopersicum]
Length=586

 Score =   178 bits (451),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +  EK   F ++RWLVFVASMWVQ+C+G+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDL
Sbjct  3    QFSEKFRGFMNDRWLVFVASMWVQSCSGIGYLFGSISPVIKSGMGYNQRQIALLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GD++GFLAG L E+LP+WAVL +GV QNFVGYG VWLI+  +LPALP+W +C
Sbjct  63   GDAIGFLAGILCEVLPIWAVLFIGVVQNFVGYGVVWLIVAHKLPALPLWVLC  114


 Score =   146 bits (368),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCVLIF+GTNGETYFNT ALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y + + PD
Sbjct  113  LCVLIFIGTNGETYFNTGALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQVYAMFNFPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASLVFM+AVGP+IVI ++MFL+RPVG
Sbjct  173  QASLVFMVAVGPSIVITAVMFLVRPVG  199



>gb|EAZ30529.1| hypothetical protein OsJ_14578 [Oryza sativa Japonica Group]
Length=1255

 Score =   177 bits (450),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G++ EKV +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+Q+++LGVAK
Sbjct  1    MGKVGEKVRAFATNRWLVFVAAMWLQSMAGIGYLFGAISPVVKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAGTLS  LP WA+LLVG AQNF+GYGW+WLI+T +LPALP+  MC
Sbjct  61   DLGDCVGFLAGTLSATLPAWAMLLVGAAQNFLGYGWLWLIVTRQLPALPLSMMC  114


 Score =   146 bits (368),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTA+LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+PD
Sbjct  113  MCLLIFVGTNGETYFNTASLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVLHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVAIGLMFVIRPVG  199



>ref|XP_002318735.1| nodulin family protein [Populus trichocarpa]
 gb|EEE96955.1| nodulin family protein [Populus trichocarpa]
Length=591

 Score =   179 bits (453),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL ++  +FF++RWLVFV +MW+Q+CAG+GYLFGSISP+IKSTMGYNQ+Q++ LGVAKDL
Sbjct  5    RLHDRFKAFFNDRWLVFVCAMWIQSCAGIGYLFGSISPVIKSTMGYNQRQVAILGVAKDL  64

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GDS+GF+ G+L EI P+WA+ L+GV QNFVGYG VWLI+  ++PALP+W +C  I
Sbjct  65   GDSIGFVPGSLCEIFPIWAISLIGVVQNFVGYGLVWLIVAQKVPALPLWVLCVAI  119


 Score =   144 bits (364),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LCV IFVGTNGETYFNT ALVS VQNFPK+RGPVVGILKGFAGLSGAILTQIY +I+SP+
Sbjct  115  LCVAIFVGTNGETYFNTVALVSCVQNFPKNRGPVVGILKGFAGLSGAILTQIYAMINSPN  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+FMIAVGP++V+I++MF++RPV
Sbjct  175  EASLIFMIAVGPSMVVIAIMFVVRPV  200



>ref|XP_006848262.1| hypothetical protein AMTR_s00013p00058430 [Amborella trichopoda]
 gb|ERN09843.1| hypothetical protein AMTR_s00013p00058430 [Amborella trichopoda]
Length=593

 Score =   174 bits (442),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            R + ++ +FFSNRWLVFVA+MWVQ+ AG+GYLFG ISP+IKS++ YNQ+QL+ L VAK+ 
Sbjct  3    RQQGRIKAFFSNRWLVFVAAMWVQSVAGIGYLFGGISPVIKSSLNYNQRQLAMLSVAKNF  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGF+ G+LS ILP W  LLVG  QNF+GYGWVWLI+TGRLP LP++AMC
Sbjct  63   GDSVGFVTGSLSAILPTWGALLVGAVQNFIGYGWVWLIVTGRLPHLPLFAMC  114


 Score =   147 bits (372),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIF+GTNGETY+NTA+LVS VQNFPK RGP+VGILKGFAGLSGAILTQIY +I+ 
Sbjct  111  FAMCVLIFIGTNGETYYNTASLVSCVQNFPKHRGPIVGILKGFAGLSGAILTQIYAMINI  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FMIAVGPA+V+I+LMF +RPVG
Sbjct  171  PDQAALIFMIAVGPAMVVIALMFFVRPVG  199



>gb|KDP22609.1| hypothetical protein JCGZ_26440 [Jatropha curcas]
Length=611

 Score =   182 bits (461),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +3

Query  21   LSTSQRKIKARKSTQDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSI  200
            + ++ RK K  ++   K    M+ RL E+  +F +NRWLVFV +MWVQ+CAG+GYLFGSI
Sbjct  1    MMSTLRKKKGTRACGVKEQRRMIQRLHEEFKAFVNNRWLVFVCAMWVQSCAGIGYLFGSI  60

Query  201  SPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVW  380
            SP+IKS MGYNQ+Q++ LGVAKDLGDS+G +AG L E+LP+WA+LL+G  QN VGYG VW
Sbjct  61   SPVIKSAMGYNQRQVAMLGVAKDLGDSIGLVAGALCEVLPIWAILLIGALQNVVGYGLVW  120

Query  381  LIITGRLPALPIWAMC  428
            LI+  +LPALP+W +C
Sbjct  121  LIVVQKLPALPLWVLC  136


 Score =   140 bits (353),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ +FVGTNGETYFNTA LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +I+ P 
Sbjct  135  LCIAVFVGTNGETYFNTAVLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYLMINFPT  194

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+FM+AVGP +V+I+LMF++RPV
Sbjct  195  EASLIFMVAVGPPMVVIALMFIVRPV  220



>ref|XP_008441326.1| PREDICTED: uncharacterized protein LOC103485475 isoform X1 [Cucumis 
melo]
Length=596

 Score =   174 bits (441),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR  +K+ +F +NRWLVFVA++W+Q+ AG+GYLFGSISP+IK+ + YNQ+Q+S LGVAK
Sbjct  1    MGRWNDKLVAFINNRWLVFVAAIWLQSWAGIGYLFGSISPVIKTNLSYNQRQVSRLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLA TL+EILP W  LLVG   N VGYGWVWLI+TGR P LP+WAMC
Sbjct  61   DLGDSVGFLAATLTEILPFWGSLLVGAIHNIVGYGWVWLIVTGRAPVLPLWAMC  114


 Score =   146 bits (369),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVL+FVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IHS
Sbjct  111  WAMCVLVFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAIIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FM+AVGPA+V I +MF IRPV 
Sbjct  171  PDSANLIFMVAVGPALVAIGVMFFIRPVA  199



>emb|CAH66429.1| OSIGBa0096P03.3 [Oryza sativa Indica Group]
 gb|EEC77175.1| hypothetical protein OsI_15661 [Oryza sativa Indica Group]
Length=586

 Score =   176 bits (446),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G++ EKV +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+Q+++LGVAK
Sbjct  1    MGKVGEKVRAFATNRWLVFVAAMWLQSMAGIGYLFGAISPVVKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAGTLS  LP WA+LLVG AQNF+GYGW+WLI+T +LPALP+  MC
Sbjct  61   DLGDCVGFLAGTLSATLPAWAMLLVGAAQNFLGYGWLWLIVTRQLPALPLSMMC  114


 Score =   144 bits (364),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTA+LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+PD
Sbjct  113  MCLLIFVGTNGETYFNTASLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVLHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVAIGLMFVIRPVG  199



>ref|XP_007161720.1| hypothetical protein PHAVU_001G092800g [Phaseolus vulgaris]
 gb|ESW33714.1| hypothetical protein PHAVU_001G092800g [Phaseolus vulgaris]
Length=590

 Score =   173 bits (438),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+EK++ F+ +RWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQKQL+ LGVAK
Sbjct  1    MGVLQEKLSLFYKSRWLVFVAAMWLQSWAGIGYLFGSISPVIKSSLGYNQKQLAMLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD+VGF+ G L E+LP+W  LLVG A N +GYGWVWL++T ++P LP+WAMC
Sbjct  61   DLGDAVGFMTGLLCELLPIWGALLVGAALNLIGYGWVWLVVTAQVPVLPLWAMC  114


 Score =   147 bits (370),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAIL+QIY L H+
Sbjct  111  WAMCVLIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILSQIYALFHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            P+ ASL+FM+AVGPA+V I LMFL+RPVG
Sbjct  171  PNQASLIFMVAVGPALVGIGLMFLVRPVG  199



>emb|CBI15688.3| unnamed protein product [Vitis vinifera]
Length=588

 Score =   176 bits (446),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+EKV +F +NRWLVFV +MWVQ+ AG+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDLG
Sbjct  4    LREKVRAFVNNRWLVFVCAMWVQSWAGIGYLFGSISPVIKSAMGYNQRQVAMLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DS+GF+AG+L E+LP+W ++L+GV QNFVGYG VWL++T +LP+LP+W +C
Sbjct  64   DSIGFVAGSLCEVLPIWGIMLIGVVQNFVGYGVVWLVVTQKLPSLPLWVLC  114


 Score =   143 bits (360),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGETYFNT ALVS VQNFPK+RGPVVGILKGFAGLSGAI+TQIYT+I++P+
Sbjct  113  LCLCIFVGTNGETYFNTGALVSCVQNFPKNRGPVVGILKGFAGLSGAIITQIYTMINAPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+A+GP++V+I+LMF++RPVG
Sbjct  173  AAALIFMVAIGPSMVVIALMFIVRPVG  199



>ref|XP_011009185.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105114363 
[Populus euphratica]
Length=592

 Score =   169 bits (428),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+ +L ++ + + +NRWLVF+A+M +Q+CAG+GYLF SISP+IKS++ YNQ+QL+SLGVA
Sbjct  1    MMEKLPDRFSRYINNRWLVFMAAMXIQSCAGIGYLFSSISPVIKSSLNYNQRQLASLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGF AG+LSEILPLW  LLVG   N V YGWVWL++ GR P L +WAMC
Sbjct  61   KDLGDSVGFFAGSLSEILPLWGALLVGALHNLVXYGWVWLVVIGRAPVLLLWAMC  115


 Score =   150 bits (378),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+G NG TY NTAALVS VQNFPKSRGPVVGI KGFAGLSGAILTQ+YT+IHS
Sbjct  112  WAMCILIFMGNNGXTYINTAALVSCVQNFPKSRGPVVGIQKGFAGLSGAILTQMYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  172  PDHASLIFMVAVGPAMVVIALMFIVRPVG  200



>ref|XP_002280267.3| PREDICTED: uncharacterized protein LOC100247479 [Vitis vinifera]
 emb|CAN73867.1| hypothetical protein VITISV_001273 [Vitis vinifera]
Length=590

 Score =   176 bits (446),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+EKV +F +NRWLVFV +MWVQ+ AG+GYLFGSISP+IKS MGYNQ+Q++ LGVAKDLG
Sbjct  6    LREKVRAFVNNRWLVFVCAMWVQSWAGIGYLFGSISPVIKSAMGYNQRQVAMLGVAKDLG  65

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DS+GF+AG+L E+LP+W ++L+GV QNFVGYG VWL++T +LP+LP+W +C
Sbjct  66   DSIGFVAGSLCEVLPIWGIMLIGVVQNFVGYGVVWLVVTQKLPSLPLWVLC  116


 Score =   143 bits (360),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGETYFNT ALVS VQNFPK+RGPVVGILKGFAGLSGAI+TQIYT+I++P+
Sbjct  115  LCLCIFVGTNGETYFNTGALVSCVQNFPKNRGPVVGILKGFAGLSGAIITQIYTMINAPN  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+A+GP++V+I+LMF++RPVG
Sbjct  175  AAALIFMVAIGPSMVVIALMFIVRPVG  201



>ref|XP_002446304.1| hypothetical protein SORBIDRAFT_06g013900 [Sorghum bicolor]
 gb|EES10632.1| hypothetical protein SORBIDRAFT_06g013900 [Sorghum bicolor]
Length=592

 Score =   175 bits (443),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFGSISP+IK+ +GYNQ+Q+++LGVAK
Sbjct  1    MGTLGDRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGSISPVIKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAG+LS +LP WA+LL+G AQNF+GYGW+WLIIT + PALP+W MC
Sbjct  61   DLGDCVGFLAGSLSAVLPSWAMLLIGSAQNFLGYGWLWLIITRQAPALPLWMMC  114


 Score =   143 bits (361),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI+VGTNGET+FNT ALV+ +QNFPKSRGP VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  113  MCVLIYVGTNGETFFNTTALVTCIQNFPKSRGPTVGIMKGFAGLSSAILTQLYAVMHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVAIGLMFIIRPVG  199



>gb|KGN63164.1| hypothetical protein Csa_2G406130 [Cucumis sativus]
Length=596

 Score =   178 bits (451),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR  +K+ +F +NRWLVFVA++W+Q+ AG+GYLFGSISPIIK+ + YNQ+Q+S LGVAK
Sbjct  1    MGRWNDKLVAFINNRWLVFVAAIWLQSWAGIGYLFGSISPIIKTNLSYNQRQISRLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCS  431
            DLGDSVGFLA TL+EILP W  LLVG   NFVGYGWVWLI+TGR P LP+WAMC+
Sbjct  61   DLGDSVGFLAATLTEILPFWGSLLVGAIHNFVGYGWVWLIVTGRAPVLPLWAMCA  115


 Score =   139 bits (350),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C L+F+GTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQ Y + HS
Sbjct  111  WAMCALVFIGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQTYAIFHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            P+ A+L+FM+AVGPA+V I +MF IRPV 
Sbjct  171  PESANLIFMVAVGPALVAIGVMFFIRPVA  199



>gb|KDO47303.1| hypothetical protein CISIN_1g007766mg [Citrus sinensis]
Length=590

 Score =   181 bits (460),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E++ SF +NRWLVFV SMW+Q+CAG+GYLFGSISP+IK+ MGYNQ+Q+S LGVAKDL
Sbjct  3    RLPERLKSFVNNRWLVFVCSMWIQSCAGIGYLFGSISPVIKAHMGYNQRQVSLLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GDS+GF+ GT  EILP+W++ L+GV QNFVGYG VWLI+T RLP+LP+W +C  I
Sbjct  63   GDSIGFVPGTFVEILPVWSINLIGVLQNFVGYGLVWLIVTNRLPSLPLWVLCIAI  117


 Score =   135 bits (341),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +I S +
Sbjct  113  LCIAIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYIMI-SAN  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
              SL+F++AVGP+IV+++ MF++RP+G
Sbjct  172  ETSLIFLVAVGPSIVVMAFMFIVRPIG  198



>ref|XP_004138620.1| PREDICTED: uncharacterized protein LOC101211655 [Cucumis sativus]
Length=576

 Score =   178 bits (451),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GR  +K+ +F +NRWLVFVA++W+Q+ AG+GYLFGSISPIIK+ + YNQ+Q+S LGVAK
Sbjct  1    MGRWNDKLVAFINNRWLVFVAAIWLQSWAGIGYLFGSISPIIKTNLSYNQRQISRLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCS  431
            DLGDSVGFLA TL+EILP W  LLVG   NFVGYGWVWLI+TGR P LP+WAMC+
Sbjct  61   DLGDSVGFLAATLTEILPFWGSLLVGAIHNFVGYGWVWLIVTGRAPVLPLWAMCA  115


 Score =   139 bits (349),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C L+F+GTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQ Y + HS
Sbjct  111  WAMCALVFIGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQTYAIFHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPV  678
            P+ A+L+FM+AVGPA+V I +MF IRPV
Sbjct  171  PESANLIFMVAVGPALVAIGVMFFIRPV  198



>ref|XP_010026435.1| PREDICTED: uncharacterized protein LOC104416784 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010026439.1| PREDICTED: uncharacterized protein LOC104416784 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83146.1| hypothetical protein EUGRSUZ_B00102 [Eucalyptus grandis]
Length=588

 Score =   173 bits (438),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            R+ EK++ F+ NRWLVFV +MW+Q+CAGVGYLFGSISP+IKS MGY Q++++ LGVAKDL
Sbjct  3    RVYEKLSEFYGNRWLVFVCAMWIQSCAGVGYLFGSISPVIKSAMGYTQREVAILGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GD++GF+AG L E+LP+W +L +GV QNFVGYG +WLI+ G LP+LP+W +C  IC
Sbjct  63   GDAIGFVAGGLCEVLPIWVILAIGVVQNFVGYGLLWLIVIGVLPSLPLWVLC--IC  116


 Score =   144 bits (362),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ +FVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAIL+QIY +I++  
Sbjct  113  LCICVFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILSQIYLMINASS  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+AVGP+IV+I+LMF++RPVG
Sbjct  173  EASLIFMVAVGPSIVVIALMFIVRPVG  199



>ref|XP_006436853.1| hypothetical protein CICLE_v10031034mg [Citrus clementina]
 ref|XP_006493210.1| PREDICTED: uncharacterized protein LOC102617653 [Citrus sinensis]
 gb|ESR50093.1| hypothetical protein CICLE_v10031034mg [Citrus clementina]
Length=590

 Score =   179 bits (455),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL E++ SF +NRWLVFV SMW+Q+CAG+GYLFGSISP+IK+ MGYNQ+Q+S LGVAKDL
Sbjct  3    RLPERLKSFVNNRWLVFVCSMWIQSCAGIGYLFGSISPVIKAHMGYNQRQVSLLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GDS GF+ GT  EILP+W++ L+GV QNFVGYG VWLI+T RLP+LP+W +C  I
Sbjct  63   GDSFGFVPGTFVEILPVWSINLIGVLQNFVGYGLVWLIVTNRLPSLPLWVLCIAI  117


 Score =   135 bits (341),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 1/87 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +I S +
Sbjct  113  LCIAIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYIMI-SAN  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
              SL+F++AVGP+IV+++ MF++RP+G
Sbjct  172  ETSLIFLVAVGPSIVVMAFMFIVRPIG  198



>ref|XP_003579618.1| PREDICTED: probable transporter mch1 [Brachypodium distachyon]
Length=594

 Score =   171 bits (432),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L E++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+Q+++LG+AK
Sbjct  1    MGNLAERLRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVVKAALGYNQRQVAALGIAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAGTLS +LP WA+LL+G  QNF+GYGW+WLI+T + PALP+  MC
Sbjct  61   DLGDCVGFLAGTLSAMLPAWAMLLIGAVQNFLGYGWLWLIVTKQAPALPLSMMC  114


 Score =   144 bits (364),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVGTNGETYFNT +LV+ +QNFPKSRGP VGILKGFAGLS AILTQ+Y ++H+PD
Sbjct  113  MCVLIFVGTNGETYFNTTSLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLYAVLHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V + LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVALGLMFVIRPVG  199



>ref|XP_010026445.1| PREDICTED: uncharacterized protein LOC104416784 isoform X2 [Eucalyptus 
grandis]
Length=451

 Score =   172 bits (435),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            R+ EK++ F+ NRWLVFV +MW+Q+CAGVGYLFGSISP+IKS MGY Q++++ LGVAKDL
Sbjct  3    RVYEKLSEFYGNRWLVFVCAMWIQSCAGVGYLFGSISPVIKSAMGYTQREVAILGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GD++GF+AG L E+LP+W +L +GV QNFVGYG +WLI+ G LP+LP+W +C  IC
Sbjct  63   GDAIGFVAGGLCEVLPIWVILAIGVVQNFVGYGLLWLIVIGVLPSLPLWVLC--IC  116


 Score =   142 bits (358),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ +FVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAIL+QIY +I++  
Sbjct  113  LCICVFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILSQIYLMINASS  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+AVGP+IV+I+LMF++RPVG
Sbjct  173  EASLIFMVAVGPSIVVIALMFIVRPVG  199



>ref|NP_001167921.1| hypothetical protein [Zea mays]
 gb|ACN26537.1| unknown [Zea mays]
 gb|AFW58067.1| hypothetical protein ZEAMMB73_861058 [Zea mays]
Length=592

 Score =   173 bits (439),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP+IK+ +GYNQ+Q+++LGVAK
Sbjct  1    MGALGDRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVIKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAG+LS +LP WA+LL+G AQNF+GYGW+WLI+T + PALP+W MC
Sbjct  61   DLGDCVGFLAGSLSAVLPSWAMLLIGSAQNFLGYGWLWLIVTRQAPALPLWMMC  114


 Score =   139 bits (351),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI+VGTNGET+FNT ALV+ +QNFPKSRG  VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  113  MCVLIYVGTNGETFFNTTALVTCIQNFPKSRGQTVGIMKGFAGLSSAILTQLYAVMHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V + LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVALGLMFIIRPVG  199



>ref|XP_004513316.1| PREDICTED: uncharacterized protein LOC101511301 [Cicer arietinum]
Length=589

 Score =   159 bits (401),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G  KEK+ S + +RW VFV +MW+Q+ AG+GYLFGSISP+IK ++ YNQKQ++ LGVAK
Sbjct  1    MGVFKEKLISLYKSRWFVFVGAMWLQSWAGIGYLFGSISPVIKKSLNYNQKQIAMLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGF+ G L E+LP+WA LLVG + N VGYG VWLI+T +LP LP+WA+C
Sbjct  61   DLGDCVGFVTGVLCEVLPIWAALLVGASLNLVGYGSVWLIVTRQLPTLPLWAIC  114


 Score =   153 bits (387),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY LIHS
Sbjct  111  WAICILIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYALIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGP++V I LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPSLVAIGLMFIVRPVG  199



>tpg|DAA38148.1| TPA: hypothetical protein ZEAMMB73_491057 [Zea mays]
Length=592

 Score =   171 bits (434),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP+IK+ +GYNQ+Q+++LGVAK
Sbjct  1    MGTLGDRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGTISPVIKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAG+LS +LP WA+LL+G  QNF+GYGW+WLI+T + PALP+W MC
Sbjct  61   DLGDCVGFLAGSLSAVLPSWAMLLIGSVQNFLGYGWLWLIVTRQAPALPLWMMC  114


 Score =   140 bits (354),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI+VGTNGET+FNT ALV+ +QNFPKSRG  VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  113  MCVLIYVGTNGETFFNTTALVTCIQNFPKSRGQTVGIMKGFAGLSSAILTQLYAVMHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLVFMVAVGPSLVAIGLMFIIRPVG  199



>ref|XP_007210258.1| hypothetical protein PRUPE_ppa003294mg [Prunus persica]
 gb|EMJ11457.1| hypothetical protein PRUPE_ppa003294mg [Prunus persica]
Length=587

 Score =   166 bits (420),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
                K+ SFF++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGYNQ+Q++ LGVAKD 
Sbjct  3    HFHGKLKSFFNSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYNQRQVAILGVAKDW  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GD+VGF+AG+LSE+LP W +L +G A NF+GYG++WLI++ RLPA P+W +C  IC
Sbjct  63   GDAVGFVAGSLSEVLPTWGLLSIGAALNFLGYGFLWLIVSQRLPAFPLWVLC--IC  116


 Score =   144 bits (364),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGET+FNTAAL+S VQNFPKSRGPVVGILKG+AGLSGAI+TQIY +I+SP+
Sbjct  113  LCICIFVGTNGETFFNTAALISCVQNFPKSRGPVVGILKGYAGLSGAIITQIYAMINSPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             +SL+FMIAVGP++V+I+LMF++RPVG
Sbjct  173  ESSLLFMIAVGPSMVVIALMFIVRPVG  199



>dbj|BAK01324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   166 bits (421),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L ++  +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+QL++LG+AK
Sbjct  1    MGMLADRFRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVLKAALGYNQRQLAALGIAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGD VGFLAGTLS +LP WA+LL+G  QNF+GYGW+WLI+T + P LP+  MC
Sbjct  61   DLGDCVGFLAGTLSAMLPAWAMLLIGALQNFLGYGWLWLIVTKQAPPLPLSMMC  114


 Score =   143 bits (361),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVGTNGETYFNT +LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+PD
Sbjct  113  MCVLIFVGTNGETYFNTTSLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVMHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  173  HATLIFMVAVGPSLVAIGLMFVIRPVG  199



>ref|XP_006848265.1| hypothetical protein AMTR_s00013p00061220 [Amborella trichopoda]
 gb|ERN09846.1| hypothetical protein AMTR_s00013p00061220 [Amborella trichopoda]
Length=391

 Score =   164 bits (414),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            ++ + F NRWLVFVA+MWVQ+ AGVGY+FGSISP+IKS++GYNQ+QL+ LGVAKDLG SV
Sbjct  7    RIKALFYNRWLVFVAAMWVQSVAGVGYIFGSISPVIKSSLGYNQRQLARLGVAKDLGGSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GF+ G+LS ILP W  LLVG   NFVGYGWVW I+T R+  LP+WAMC  I
Sbjct  67   GFVTGSLSAILPPWGALLVGAVLNFVGYGWVWRIVTKRVATLPLWAMCVLI  117


 Score =   145 bits (365),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIF+GTNGETY+NT ALVS VQNFP  RGP+VGILKGFAGLSGAILTQIY +I+S
Sbjct  111  WAMCVLIFIGTNGETYYNTVALVSCVQNFPTHRGPIVGILKGFAGLSGAILTQIYFVINS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FMIAVGPA+V+I+LMF +RPVG
Sbjct  171  PDEAALIFMIAVGPALVVIALMFFVRPVG  199



>ref|XP_008392789.1| PREDICTED: probable transporter mch1 [Malus domestica]
Length=591

 Score =   164 bits (414),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +L  K  +F ++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGY+Q++++ LGVAKD 
Sbjct  3    QLHGKFKAFVNSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYSQREVAILGVAKDW  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GD+VGF+AG+LSEILP W +L++G   NFVGYG +WLI++ RLPALP+WA+C  I
Sbjct  63   GDAVGFVAGSLSEILPTWGILVIGAVLNFVGYGMLWLIVSQRLPALPLWALCIFI  117


 Score =   144 bits (362),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + LC+ IFVGTNGET+FNTAAL+S VQNFPKSRGP+VGILKG+AGLSGAILTQIY +I+S
Sbjct  111  WALCIFIFVGTNGETFFNTAALISCVQNFPKSRGPIVGILKGYAGLSGAILTQIYAMINS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            P+ +S++FMIAVGP++V I+LMF++RPVG
Sbjct  171  PNESSMLFMIAVGPSMVAIALMFIVRPVG  199



>ref|XP_008239485.1| PREDICTED: uncharacterized protein LOC103338077 [Prunus mume]
Length=587

 Score =   162 bits (411),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +   K+ + F++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGYNQ+Q++ LGVAKD 
Sbjct  3    QFHGKLKALFNSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYNQRQVAILGVAKDW  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GD+VGF+AG+LSE+LP W +L +G A NF+GYG++WLI++ RLPA P+W +C  IC
Sbjct  63   GDAVGFVAGSLSEVLPTWGLLSIGAALNFLGYGFLWLIVSQRLPAFPLWVLC--IC  116


 Score =   144 bits (364),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGET+FNTAAL+S VQNFPKSRGPVVGILKG+AGLSGAI+TQIY +I+SP+
Sbjct  113  LCICIFVGTNGETFFNTAALISCVQNFPKSRGPVVGILKGYAGLSGAIITQIYAMINSPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             +SL+FMIAVGP++V+I+LMF++RPVG
Sbjct  173  ESSLLFMIAVGPSMVVIALMFIVRPVG  199



>ref|XP_008374232.1| PREDICTED: uncharacterized protein LOC103437529 [Malus domestica]
Length=591

 Score =   165 bits (417),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L  K  +F ++RWLVFV +MW+Q+ AGVGYLFGSISP+IKSTMGY+Q+QL+ LGVAKDLG
Sbjct  4    LHGKFKAFANSRWLVFVCAMWIQSFAGVGYLFGSISPVIKSTMGYSQRQLAILGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            DSVGF+AG+LSEILP W +L++G A NFVGYG +WLI++  LPA P+W +C  IC
Sbjct  64   DSVGFVAGSLSEILPTWGLLVIGAAFNFVGYGLLWLIVSQTLPAFPLWVLC--IC  116


 Score =   142 bits (358),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGET+FNTAAL+S VQNFPKSRGP+VGILKG+AGLSGAILTQIY +I++P+
Sbjct  113  LCICIFVGTNGETFFNTAALISCVQNFPKSRGPIVGILKGYAGLSGAILTQIYAMINAPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             +SL+FMIAVGP++V ++LMF++RPVG
Sbjct  173  ESSLIFMIAVGPSMVAVALMFIVRPVG  199



>gb|EMT05600.1| hypothetical protein F775_14441 [Aegilops tauschii]
Length=626

 Score =   162 bits (411),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISPI+K+ +GYNQ+ +++LG+AK
Sbjct  1    MGMLADRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPILKAALGYNQRHVAALGIAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCS  431
            DLGD VGFLAG+LS +LP WA+LL+G  QNF+GYGW+WLI+T + P LP+   CS
Sbjct  61   DLGDCVGFLAGSLSAMLPAWAMLLIGALQNFLGYGWLWLIVTKQAPPLPLSMSCS  115


 Score =   144 bits (363),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVGTNGETYFNT +LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+
Sbjct  144  HKMCVLIFVGTNGETYFNTTSLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVMHT  203

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  204  PDHATLIFMVAVGPSLVAIGLMFVIRPVG  232



>gb|KJB33994.1| hypothetical protein B456_006G042500 [Gossypium raimondii]
Length=576

 Score =   162 bits (411),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            LKE+  +F +NRWLVFVA+MW+Q+C G GY+FGSISP+IKS++ YNQ+QLS LGVAKDLG
Sbjct  4    LKERFQAFVNNRWLVFVAAMWMQSCTGPGYIFGSISPVIKSSLNYNQRQLSKLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCS  431
             SVGF+AG L EI P+W VLL+G  QN +GY  +WLI+TG++P  P+WA  S
Sbjct  64   GSVGFIAGGLCEIFPIWGVLLIGALQNLIGYSSLWLIVTGKVPVFPLWAQFS  115


 Score =   143 bits (360),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVG NGETYFNTAALVS V+NFPKSRGPVVGILKGFA LSGAILTQIYT+I+ PD
Sbjct  127  MCVLIFVGHNGETYFNTAALVSCVRNFPKSRGPVVGILKGFAALSGAILTQIYTMINFPD  186

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+A GP +V+ +LMF+IRPVG
Sbjct  187  QASLIFMVAFGPTMVVFALMFIIRPVG  213



>ref|XP_009359425.1| PREDICTED: probable transporter mch1 [Pyrus x bretschneideri]
Length=591

 Score =   162 bits (409),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +L  K  +F ++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGY+Q++++ LGVAKD 
Sbjct  3    QLHGKFKAFVNSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYSQREVAILGVAKDW  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GD+VGF+AG+LSEILP W +L++G   NFVGYG +WLI++ RLPALP+W +C  IC
Sbjct  63   GDAVGFVAGSLSEILPTWGILVIGAVLNFVGYGMLWLIVSQRLPALPLWVLC--IC  116


 Score =   142 bits (359),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ IFVGTNGET+FNTAAL+S VQNFPKSRGP+VGILKG+AGLSGAILTQIY +I+SP+
Sbjct  113  LCICIFVGTNGETFFNTAALISCVQNFPKSRGPIVGILKGYAGLSGAILTQIYAMINSPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             +S++FMIAVGP++V I+LMF++RPVG
Sbjct  173  ESSMLFMIAVGPSMVAIALMFIVRPVG  199



>ref|XP_009375205.1| PREDICTED: probable transporter mch1 [Pyrus x bretschneideri]
Length=591

 Score =   162 bits (410),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +L  K  +F ++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGY+Q+QL+ LGVAKDL
Sbjct  3    QLHGKFKAFANSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYSQRQLAILGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            GDSVGF+AG+LSEILP W +L++G A N VGYG +WLI++  LPA P+W +C  IC
Sbjct  63   GDSVGFVAGSLSEILPTWGLLVIGAAFNLVGYGLLWLIVSQTLPAFPLWVLC--IC  116


 Score =   141 bits (356),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ I+VGTNGET+FNTAAL+S VQNFPKSRGP+VGILKG+AGLSGAILTQIY +I++P+
Sbjct  113  LCICIYVGTNGETFFNTAALISCVQNFPKSRGPIVGILKGYAGLSGAILTQIYAMINAPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             +SL+FMIAVGP++V ++LMF++RPVG
Sbjct  173  ESSLIFMIAVGPSMVAVALMFIVRPVG  199



>ref|XP_006373208.1| hypothetical protein POPTR_0017s09660g [Populus trichocarpa]
 gb|ERP51005.1| hypothetical protein POPTR_0017s09660g [Populus trichocarpa]
Length=249

 Score =   193 bits (491),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = +3

Query  3    PYRNTPLSTSQRKIKARKSTQDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVG  182
            PY +  L    R  K  K T   V  +M+G+L ++ + F +NRWLVFVA+MW+Q+CAG+G
Sbjct  41   PYWDI-LRCRARNHKIEKQTFVVVVLVMIGKLADRFSGFINNRWLVFVAAMWIQSCAGIG  99

Query  183  YLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFV  362
            YLFGSISP+IKS + YNQ+QL+SLGVAKDLG SVGFLAG+LSEILPLW  LLVG  QN V
Sbjct  100  YLFGSISPVIKSPLNYNQRQLASLGVAKDLGGSVGFLAGSLSEILPLWGALLVGALQNLV  159

Query  363  GYGWVWLIITGRLPALPIWAMC  428
            GYGWVWL++TGR P LP+WAMC
Sbjct  160  GYGWVWLVVTGRAPVLPLWAMC  181


 Score =   100 bits (248),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLI  588
            + +C+LIF+G NGETY NTAALVS VQNFPKSRGPVVGILKGFAGL+GAILTQIYT++
Sbjct  178  WAMCILIFIGNNGETYINTAALVSCVQNFPKSRGPVVGILKGFAGLNGAILTQIYTMM  235



>ref|XP_004297562.1| PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Fragaria 
vesca subsp. vesca]
Length=585

 Score =   150 bits (379),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            K  +F ++RWLVFV +MW+Q+ AG+GYLFGSISP+IKSTMGY Q++L+ LGVAKD GD++
Sbjct  7    KFKAFKNSRWLVFVCAMWIQSFAGIGYLFGSISPVIKSTMGYTQRELAILGVAKDWGDAI  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            GF+AG LSEILP W +L++G   NF+GYG +WLI++ ++ ALP+W +C  I
Sbjct  67   GFVAGYLSEILPSWGLLVIGAVLNFLGYGLLWLIVSQKIAALPLWVLCIAI  117


 Score =   142 bits (359),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ I+VGTNGET+FNTAAL+S VQNFPKSRGPVVGILKG+AGLSGAI+TQIY + +SP+
Sbjct  113  LCIAIYVGTNGETFFNTAALISCVQNFPKSRGPVVGILKGYAGLSGAIITQIYAMFNSPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FMIAVGP++V+I+LMF++RPVG
Sbjct  173  EASLLFMIAVGPSMVVIALMFIVRPVG  199



>ref|XP_008668550.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 tpg|DAA38150.1| TPA: hypothetical protein ZEAMMB73_173755 [Zea mays]
Length=595

 Score =   150 bits (380),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+L+E+  +F++NRWLVFV +MW+Q+ AG  Y+FG+ISP++K+ +GY+Q Q+++LGVAK
Sbjct  3    MGKLEERTRAFWTNRWLVFVGAMWMQSMAGTTYIFGAISPVVKARLGYDQPQVAALGVAK  62

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            ++G  +G LAG LS   P WA+L +G AQNF+GYGW+WL+++G  PALP+W MC
Sbjct  63   NVGGCLGLLAGALSATWPPWALLAIGAAQNFLGYGWLWLVVSGNAPALPLWLMC  116


 Score =   139 bits (351),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV+IF+GTNG+TYF TA+LV+ +QNFPKSRGP VGILKGF GL+ AILTQ+YT++H+PD
Sbjct  115  MCVVIFIGTNGQTYFITASLVTSIQNFPKSRGPTVGILKGFMGLTSAILTQVYTVMHTPD  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  175  HAALIFMVAVGPSLVAIGLMFVIRPVG  201



>ref|XP_003602802.1| Nodulin-like protein [Medicago truncatula]
 gb|AES73053.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=564

 Score =   153 bits (387),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+EK+  F  +RW+VFV +MW  + AG  Y+FGSISP+IKS+MGYNQKQ++ L VAKDLG
Sbjct  4    LQEKLKKFVGHRWVVFVCAMWDMSFAGTAYMFGSISPVIKSSMGYNQKQVAFLSVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            D+VG LAG +S+  P+WAV+LVGV QN VGYG VWL++T RLP+LP+W +C  I
Sbjct  64   DNVGLLAGFISKAWPVWAVILVGVLQNVVGYGLVWLVVTHRLPSLPLWTLCFFI  117


 Score =   122 bits (306),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC  I VG NG TY+NTAALVS VQ+FP++RGPVVGILKGF GLSGAI TQI  +I+ PD
Sbjct  113  LCFFILVGQNGSTYYNTAALVSCVQSFPENRGPVVGILKGFVGLSGAIWTQIIAMINLPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+F+IAVGPA+V ++ MF+IRPV
Sbjct  173  QASLIFIIAVGPAMVSLTFMFIIRPV  198



>gb|KHN32545.1| Putative transporter MCH1 [Glycine soja]
Length=589

 Score =   148 bits (374),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + EK+  F  +RW+VFV +MW  + AG  Y+FGSISP+IKS+MG+NQKQ++ L VAKDLG
Sbjct  4    VNEKLKGFVGHRWVVFVCAMWDMSFAGTSYMFGSISPVIKSSMGFNQKQVAFLSVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            D+VG LAG +S+  P+WA++LVGV QN VGYG VWLI+T + PALP+W +C
Sbjct  64   DNVGLLAGKISQSSPIWALILVGVVQNVVGYGLVWLIVTHQFPALPLWLLC  114


 Score =   125 bits (315),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+LIFVG NG TY+NTAALVS VQ+FP+SRGPVVGILKGF GLSGAI TQ+  +   PD
Sbjct  113  LCILIFVGQNGSTYYNTAALVSCVQSFPESRGPVVGILKGFVGLSGAIWTQLIAMAQLPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+F+IAVGPA+V ++ MF+IRPV
Sbjct  173  QASLIFIIAVGPAMVSLAFMFIIRPV  198



>ref|XP_003526953.1| PREDICTED: uncharacterized protein LOC100817909 [Glycine max]
Length=589

 Score =   146 bits (369),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + EK+  F  +RW+VFV +MW  + AG  Y+FGSISP+IKS+MG+NQKQ++ L VAKDLG
Sbjct  4    VNEKLKGFVGHRWVVFVCAMWDMSFAGTSYMFGSISPVIKSSMGFNQKQVAFLSVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            D+VG LAG + +  P+WA++LVGV QN VGYG VWLI+T + PALP+W +C
Sbjct  64   DNVGLLAGKICQSSPIWALILVGVVQNVVGYGLVWLIVTHQFPALPLWLLC  114


 Score =   125 bits (314),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+LIFVG NG TY+NTAALVS VQ+FP+SRGPVVGILKGF GLSGAI TQ+  +   PD
Sbjct  113  LCILIFVGQNGSTYYNTAALVSCVQSFPESRGPVVGILKGFVGLSGAIWTQLIAMAQLPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+F+IAVGPA+V ++ MF+IRPV
Sbjct  173  QASLIFIIAVGPAMVSLAFMFIIRPV  198



>ref|XP_002446303.1| hypothetical protein SORBIDRAFT_06g013890 [Sorghum bicolor]
 gb|EES10631.1| hypothetical protein SORBIDRAFT_06g013890 [Sorghum bicolor]
Length=595

 Score =   136 bits (342),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+L EKV +F+ NRWLVFV +MW+Q+ AG  Y+FG+ISP++K+ +GY+Q+Q+++LGVAK
Sbjct  3    MGKLGEKVRAFWRNRWLVFVGAMWMQSMAGTTYIFGAISPVVKARLGYDQRQVAALGVAK  62

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            +LG  +G LAGTLS   P WA+L +G AQNF GYGW+WL++ G+ PALP+W MC
Sbjct  63   NLGGCLGLLAGTLSATWPPWALLAIGAAQNFAGYGWLWLVVDGKAPALPLWLMC  116


 Score =   134 bits (337),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV+IF+GTNG+TY  TA+LV+ +QNFPKSRGP VGILKGF GL+ AILTQ+YT++++PD
Sbjct  115  MCVVIFIGTNGQTYMITASLVTSIQNFPKSRGPTVGILKGFMGLTSAILTQVYTVLNTPD  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V + LMF+IRPVG
Sbjct  175  HAALIFMVAVGPSLVAVGLMFVIRPVG  201



>gb|KFK22925.1| hypothetical protein AALP_AAs48765U000600 [Arabis alpina]
Length=532

 Score =   150 bits (378),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDL  272
            +  K+ + F++ WLVFV +MW+Q+ AGVGYLFG S+SP+IK+++GYNQKQ++ LGVAK+L
Sbjct  1    MTHKLKALFNDPWLVFVCAMWIQSVAGVGYLFGGSMSPVIKTSLGYNQKQIALLGVAKNL  60

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            GD++GF++G LSE+ P W VLLVG AQN VGYG VWL++TG LP LP+W +
Sbjct  61   GDAIGFVSGALSEVSPSWMVLLVGAAQNLVGYGAVWLVVTGLLPNLPLWML  111


 Score =   120 bits (300),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y +++   
Sbjct  111  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMLNPSH  170

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+AVGP +V+++L+F++RPV
Sbjct  171  DSSVILMVAVGPPVVVLALLFIVRPV  196



>ref|XP_003523150.1| PREDICTED: uncharacterized protein LOC100784744 [Glycine max]
Length=582

 Score =   144 bits (362),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  108  VNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVG  287
            V  F  +RW+VFV +MW  + AG  Y+FGSISP+IKS+MG+NQKQ++ L VAKDLGD+VG
Sbjct  4    VKGFVGHRWVVFVCAMWDMSFAGTSYMFGSISPVIKSSMGFNQKQVAFLSVAKDLGDNVG  63

Query  288  FLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
             LAG +S+  P+W ++LVGV QN VGYG VWL++T +LPALP+W +C
Sbjct  64   LLAGKISQASPVWGLILVGVVQNVVGYGLVWLVVTHQLPALPLWLLC  110


 Score =   126 bits (316),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC++IFVG NG TY+NTAALVS VQ+FP+SRGPVVGILKGF GLSGAI TQ+  +I  PD
Sbjct  109  LCIVIFVGQNGSTYYNTAALVSCVQSFPESRGPVVGILKGFVGLSGAIWTQLIAMIQLPD  168

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+F+IAVGPA+V ++ MF+IRPV
Sbjct  169  QASLIFIIAVGPAMVSLTFMFIIRPV  194



>gb|KHN23980.1| Putative transporter MCH1 [Glycine soja]
Length=582

 Score =   142 bits (359),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  108  VNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVG  287
            V  F  +RW+VFV +MW  + AG  Y+FGSISP+IKS+MG+NQKQ++ L VAKDLGD+VG
Sbjct  4    VKGFVGHRWVVFVCAMWDMSFAGTSYMFGSISPVIKSSMGFNQKQVAFLSVAKDLGDNVG  63

Query  288  FLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
             LAG +S+  P+W ++LVGV QN VGYG VWL++T + PALP+W +C
Sbjct  64   LLAGKISQASPVWGLILVGVVQNVVGYGLVWLVVTHQFPALPLWLLC  110


 Score =   126 bits (316),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC++IFVG NG TY+NTAALVS VQ+FP+SRGPVVGILKGF GLSGAI TQ+  +I  PD
Sbjct  109  LCIVIFVGQNGSTYYNTAALVSCVQSFPESRGPVVGILKGFVGLSGAIWTQLIAMIQLPD  168

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ASL+F+IAVGPA+V ++ MF+IRPV
Sbjct  169  QASLIFIIAVGPAMVSLTFMFIIRPV  194



>ref|XP_004975411.1| PREDICTED: uncharacterized protein LOC101770891 isoform X1 [Setaria 
italica]
Length=550

 Score =   147 bits (370),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G++ E++ +F  NRWLV VASMWVQ+ +GVGYLFG+ISP++KST+GYNQ+Q+++L VAK
Sbjct  1    MGKVAERLRAFSRNRWLVLVASMWVQSVSGVGYLFGAISPVLKSTLGYNQRQVAALAVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            +LG  VG +AGTL   +P W +LL+G A N +GYGW+WLI+ G  P LP+  MC
Sbjct  61   NLGGYVGVVAGTLPANMPPWLMLLMGAAHNLLGYGWLWLIVAGIAPPLPLSMMC  114


 Score =   119 bits (299),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVG N  TYFNT +LV+ + NFP SRGP+VGILKGF GL+ AILTQIY ++H+ D
Sbjct  113  MCVLIFVGNNSATYFNTHSLVTCILNFPTSRGPMVGILKGFLGLTSAILTQIYAVMHTTD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
               LV  +AVGPA+V I++MF+IRPVG
Sbjct  173  QTKLVLTVAVGPALVAIAMMFVIRPVG  199



>dbj|BAD95303.1| nodulin-like protein [Arabidopsis thaliana]
Length=540

 Score =   146 bits (369),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+    ++RWLVFV +MWVQ+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  6    RHKLELLVNDRWLVFVCAMWVQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  65

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D+VGF++G LSE+ P W VLLVG  QN  GYG VWL++TG+LP LP+W +
Sbjct  66   DAVGFVSGALSEVSPSWVVLLVGATQNLFGYGVVWLVVTGQLPNLPLWML  115


 Score =   118 bits (295),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  115  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  175  DSSVILMVALGPPVVVLALLFIVRPV  200



>ref|NP_568730.1| major facilitator protein [Arabidopsis thaliana]
 ref|NP_568735.1| major facilitator protein [Arabidopsis thaliana]
 dbj|BAA96976.1| nodulin-like protein [Arabidopsis thaliana]
 dbj|BAB09137.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AAK64028.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AAN12888.1| putative nodulin protein [Arabidopsis thaliana]
 gb|AED95954.1| major facilitator protein [Arabidopsis thaliana]
 gb|AED95970.1| major facilitator protein [Arabidopsis thaliana]
Length=540

 Score =   146 bits (368),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+    ++RWLVFV +MWVQ+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  6    RHKLELLVNDRWLVFVCAMWVQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  65

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LSE+ P W VLLVG  QN  GYG VWL++TG+LP LP+W +
Sbjct  66   DAIGFVSGALSEVSPSWVVLLVGATQNLFGYGVVWLVVTGQLPNLPLWML  115


 Score =   118 bits (295),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  115  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  174

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  175  DSSVILMVALGPPVVVLALLFIVRPV  200



>ref|XP_006279610.1| hypothetical protein CARUB_v10026202mg [Capsella rubella]
 gb|EOA12508.1| hypothetical protein CARUB_v10026202mg [Capsella rubella]
Length=539

 Score =   146 bits (368),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+    ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  5    RHKLEHLANDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LSE+ P W VL+VG  QN +GYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSEVSPTWVVLIVGATQNLLGYGVVWLVVTGQLPNLPLWML  114


 Score =   117 bits (294),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPVVVLALLFIVRPV  199



>ref|XP_010442204.1| PREDICTED: probable transporter mch1 [Camelina sativa]
Length=539

 Score =   145 bits (367),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+    ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  5    RHKLELLANDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LSE+ P W VL+VG  QN +GYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSEVSPSWVVLIVGATQNLIGYGVVWLVVTGQLPNLPLWML  114


 Score =   118 bits (295),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPVVVLALLFIVRPV  199



>ref|XP_010442541.1| PREDICTED: probable transporter mch1 [Camelina sativa]
Length=539

 Score =   145 bits (367),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+    ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  5    RHKLELLANDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LSE+ P W VL+VG  QN VGYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSEVSPSWVVLIVGATQNLVGYGVVWLVVTGQLPNLPLWML  114


 Score =   118 bits (295),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPVVVLALLFIVRPV  199



>ref|XP_010525333.1| PREDICTED: uncharacterized protein LOC104803150 [Tarenaya hassleriana]
Length=542

 Score =   139 bits (349),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = +3

Query  81   IMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLG  257
            +++ + + +  +  ++RWLVFV +MWVQ+ AGVGY+FG S+SP IK+ +GY+Q+Q+S LG
Sbjct  1    MLISQWRHRFEALVNDRWLVFVCAMWVQSVAGVGYIFGGSMSPAIKTALGYDQRQISVLG  60

Query  258  VAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            VAK+LGD++GF++G LSE  P W VLLVG A N VGYG VWL+++G  P LP+W +
Sbjct  61   VAKNLGDAIGFVSGALSEAFPPWVVLLVGAAHNLVGYGVVWLVVSGLWPRLPLWML  116


 Score =   120 bits (300),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L + IF+GTNGETY+NTA+LVS +QNFP SRGPVVGILKGF+GLSGAILTQ+Y++ +  +
Sbjct  116  LFIAIFLGTNGETYYNTASLVSCIQNFPDSRGPVVGILKGFSGLSGAILTQVYSMFNPRN  175

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP IV+++L+F++RPV
Sbjct  176  DSSVILMVAIGPPIVVLALLFIVRPV  201



>emb|CDY16357.1| BnaA02g11610D [Brassica napus]
Length=532

 Score =   151 bits (381),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+ +  ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ+  LGVAK+LG
Sbjct  5    RHKLETLTNDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIGLLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LS++ P W VLLVG AQNFVGYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSDVSPSWTVLLVGAAQNFVGYGVVWLVVTGQLPNLPLWIL  114


 Score =   104 bits (259),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPLVVLALLFVVRPV  199



>emb|CDX91555.1| BnaC02g16050D [Brassica napus]
Length=539

 Score =   150 bits (380),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            ++K+ +  ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ+  LGVAK+LG
Sbjct  5    RQKLETLTNDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIGLLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LS++ P W VLLVG AQNFVGYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSDVSPSWTVLLVGAAQNFVGYGVVWLVVTGQLPNLPLWIL  114


 Score =   104 bits (259),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPLVVLALLFVVRPV  199



>ref|XP_009127350.1| PREDICTED: uncharacterized protein LOC103852185 [Brassica rapa]
Length=539

 Score =   150 bits (379),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            + K+ +  ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ+  LGVAK+LG
Sbjct  5    RHKLETLTNDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIGLLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LS++ P W VLLVG AQNFVGYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSDVSPSWTVLLVGAAQNFVGYGVVWLVVTGQLPNLPLWIL  114


 Score =   103 bits (258),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSH  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPLVVLALLFVVRPV  199



>tpg|DAA38152.1| TPA: hypothetical protein ZEAMMB73_727902 [Zea mays]
Length=476

 Score =   144 bits (363),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+L  ++ +F  NRWLV VA+MWVQ+ AG+GYLFG+ISP++K+ +GYNQ+QL++L VAK
Sbjct  1    MGKLAARLRAFSRNRWLVLVAAMWVQSMAGIGYLFGAISPVLKARLGYNQRQLAALAVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            ++G  VG +AGTLS  LP WA+LL+G AQN +GYGW+WLI+TG+ P LP+W MC
Sbjct  61   NVGGYVGVVAGTLSAALPAWAMLLMGAAQNLLGYGWLWLIVTGQAPPLPLWMMC  114


 Score =   108 bits (270),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVG N  TYFNTA+LV+ VQNFP SRGP+VGILKGF GL+ AILTQ+Y +  + D
Sbjct  113  MCVLIFVGNNSATYFNTASLVTCVQNFPASRGPMVGILKGFLGLTSAILTQVYAVTRATD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+ +IAVGP++V +++M ++RPVG
Sbjct  173  QASLILIIAVGPSLVAVAVMLVVRPVG  199



>ref|XP_002865816.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42075.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   147 bits (370),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFG-SISPIIKSTMGYNQKQLSSLGVAKDLG  275
            ++K+    ++RWLVFV +MW+Q+ AGVGYLFG S+SP IK+++GYNQKQ++ LGVAK+LG
Sbjct  5    RQKLELLVNDRWLVFVCAMWIQSVAGVGYLFGGSMSPAIKTSLGYNQKQIALLGVAKNLG  64

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            D++GF++G LSE+ P W VL+VG  QN VGYG VWL++TG+LP LP+W +
Sbjct  65   DAIGFVSGALSEVSPTWVVLIVGATQNLVGYGVVWLVVTGQLPNLPLWML  114


 Score =   103 bits (257),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            L V IFVGTNGETY+NTA+LVS + NFP+SRGPVVGILKGF+GLSGAILTQ+Y + +   
Sbjct  114  LFVAIFVGTNGETYYNTASLVSCIHNFPESRGPVVGILKGFSGLSGAILTQVYLMFNPSR  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S++ M+A+GP +V+++L+F++RPV
Sbjct  174  DSSVILMVALGPPVVVLALLFVVRPV  199



>ref|XP_001778186.1| predicted protein [Physcomitrella patens]
 gb|EDQ56968.1| predicted protein [Physcomitrella patens]
Length=588

 Score =   141 bits (356),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            ++ WLV VAS+W+Q C+G GYLFGSISP+IK+T+ +NQKQL+ LGVAKD+GDS G LAG 
Sbjct  4    TSHWLVLVASIWLQACSGTGYLFGSISPVIKTTLDFNQKQLNRLGVAKDIGDSGGLLAGF  63

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            L + LP W ++LVG  QN +GYGW+WLI+ GR+P  P   +C  IC
Sbjct  64   LCDWLPPWGLILVGTLQNLIGYGWLWLIVIGRVPQPPFIVVCLLIC  109


 Score =   108 bits (271),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LI VGTNGET+FNTAALVS V+ F   RGPVVGILKGFAGL GAI T +YT +++PD
Sbjct  104  VCLLICVGTNGETFFNTAALVSSVRTFSTYRGPVVGILKGFAGLGGAIFTCVYTALYAPD  163

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             AS + ++ +GP +V I  M +IRP+
Sbjct  164  QASFILLLVIGPTLVAILSMLVIRPI  189



>ref|XP_002964118.1| hypothetical protein SELMODRAFT_166743 [Selaginella moellendorffii]
 gb|EFJ34451.1| hypothetical protein SELMODRAFT_166743 [Selaginella moellendorffii]
Length=608

 Score =   137 bits (346),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +L  +  S +++RWLV VAS+W+Q CAGVGY++GS SP+IKS + +NQKQ++ LGVAKD+
Sbjct  2    KLSRQHRSVWNSRWLVLVASIWIQACAGVGYVYGSYSPLIKSRLHFNQKQMNILGVAKDM  61

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALP--IWAMC  428
            GDSVG  AG+LS+++P W ++ +G  QNFVGYG +WLI+T   PALP   W MC
Sbjct  62   GDSVGIFAGSLSDVIPPWGLVFLGSLQNFVGYGGIWLIVTN--PALPSFFWLMC  113


 Score =   111 bits (277),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVL+FVGTNGETYFNT ALVS V+NFP++RGPVVGILKGF GL GAI T +Y  I SP+
Sbjct  112  MCVLMFVGTNGETYFNTVALVSSVRNFPRNRGPVVGILKGFTGLCGAIFTLVYGAILSPN  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             A+ + ++AV P  V + +M +IRP+
Sbjct  172  QAAFILLVAVAPVFVGLLVMPIIRPI  197



>ref|XP_002992049.1| hypothetical protein SELMODRAFT_134679 [Selaginella moellendorffii]
 gb|EFJ06898.1| hypothetical protein SELMODRAFT_134679 [Selaginella moellendorffii]
Length=608

 Score =   137 bits (346),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 4/114 (4%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            +L  +  S +++RWLV VAS+W+Q CAGVGY++GS SP+IKS + +NQKQ++ LGVAKD+
Sbjct  2    KLSRQHRSVWNSRWLVLVASIWIQACAGVGYVYGSYSPLIKSRLHFNQKQMNILGVAKDM  61

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALP--IWAMC  428
            GDSVG  AG+LS+++P W ++ +G  QNFVGYG +WLI+T   PALP   W MC
Sbjct  62   GDSVGIFAGSLSDVIPPWGLVFLGSLQNFVGYGGIWLIVTN--PALPSFFWLMC  113


 Score =   110 bits (274),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVL+FVGTNGETYFNT ALVS V+NFP++RGPVVGILKGF GL GAI T +Y  + SP+
Sbjct  112  MCVLMFVGTNGETYFNTVALVSSVRNFPRNRGPVVGILKGFTGLCGAIFTLVYGALLSPN  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             A+ + ++AV P  V + +M +IRP+
Sbjct  172  QAAFILLVAVAPVFVGLLVMPIIRPI  197



>ref|XP_001780273.1| predicted protein [Physcomitrella patens]
 gb|EDQ54937.1| predicted protein [Physcomitrella patens]
Length=595

 Score =   138 bits (347),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            +NRWLV VAS+W+Q CAG+GY+FGSISP+IK+ +  NQ+QL+ LGVAKDLGDSVG LAG 
Sbjct  4    TNRWLVLVASIWLQACAGIGYIFGSISPVIKTNLNLNQRQLNRLGVAKDLGDSVGLLAGF  63

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            LS+ LP W ++LVG+  N +GYGWVWLI+  R+   P   +C
Sbjct  64   LSDWLPSWGLILVGLLHNCIGYGWVWLIVIRRVATPPFAVVC  105


 Score =   109 bits (272),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LI +GTNGETYFNTAALVS V+ F   RGPVVGILKGFAGL GAI T +YT   +PD
Sbjct  104  VCLLIALGTNGETYFNTAALVSSVRTFSHYRGPVVGILKGFAGLGGAIFTCVYTAFFAPD  163

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             AS + +IAVGP +V    +F+IRP+
Sbjct  164  QASFILIIAVGPTLVAFLALFVIRPL  189



>ref|XP_001758608.1| predicted protein [Physcomitrella patens]
 gb|EDQ76586.1| predicted protein, partial [Physcomitrella patens]
Length=558

 Score =   135 bits (341),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            NRWLV V S+W+Q+CAG+GY+FGS+SP+IK ++ YNQKQ++ LGVAKD+GDSVG LAG +
Sbjct  1    NRWLVLVVSIWLQSCAGIGYVFGSLSPVIKVSLDYNQKQINRLGVAKDIGDSVGLLAGFM  60

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPAL  410
             + LP W ++ VG  QNF+GYGW+WL++  R+P L
Sbjct  61   CDWLPTWGLIFVGALQNFLGYGWLWLMVVKRVPQL  95


 Score =   110 bits (276),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LI VGTNGE+YFNTAALV+ V+NF   RGP+VGILKGF GL GAI T IYT +++PD
Sbjct  98   VCLLIGVGTNGESYFNTAALVTSVRNFSHYRGPIVGILKGFGGLGGAIFTCIYTALYAPD  157

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             AS +FM+AV P +V +  MF+I+P+
Sbjct  158  QASFIFMVAVLPTLVALLSMFVIQPL  183



>gb|KDO63910.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
 gb|KDO63911.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=309

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            N     F      SC++   FP+      G  +GF
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  153


 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>ref|XP_006373207.1| hypothetical protein POPTR_0017s09660g [Populus trichocarpa]
 gb|ERP51004.1| hypothetical protein POPTR_0017s09660g [Populus trichocarpa]
Length=191

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 1/140 (1%)
 Frame = +3

Query  3    PYRNTPLSTSQRKIKARKSTQDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVG  182
            PY +  L    R  K  K T   V  +M+G+L ++ + F +NRWLVFVA+MW+Q+CAG+G
Sbjct  41   PYWDI-LRCRARNHKIEKQTFVVVVLVMIGKLADRFSGFINNRWLVFVAAMWIQSCAGIG  99

Query  183  YLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFV  362
            YLFGSISP+IKS + YNQ+QL+SLGVAKDLG SVGFLAG+LSEILPLW  LLVG  QN V
Sbjct  100  YLFGSISPVIKSPLNYNQRQLASLGVAKDLGGSVGFLAGSLSEILPLWGALLVGALQNLV  159

Query  363  GYGWVWLIITGRLPALPIWA  422
            GYGWVWL++TGR P LP+WA
Sbjct  160  GYGWVWLVVTGRAPVLPLWA  179



>ref|XP_007031903.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007031904.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY02829.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY02830.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRLKE+  +F +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQ+QL+ LGVAK
Sbjct  1    MGRLKERFQAFVNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQRQLAKLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LSEILPLW  LLVG  QN VGYGWVWLI+TGR+P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSEILPLWGALLVGAVQNLVGYGWVWLIVTGRVPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHASLIFMVAVGPAMVVIALMFIIRPVG  199



>gb|KFK25643.1| hypothetical protein AALP_AA8G141300 [Arabis alpina]
Length=579

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    KEK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+LS LGVA
Sbjct  1    MASTTKEKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGTLSEILPLWAALLVGAIQNLVGYGWVWLIVTGRAPILPLWAMCVLIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   GS + G   FP+      G  +GF 
Sbjct  121  GNNGETYFNTGSLVSGVHNFPKSRGPVVGILKGFA  155


 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 90/111 (81%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +CVLIFVG NGETYFNT +LVSGV NFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTGRAPILPL-WAMCVLIFVGNNGETYFNTGSLVSGVHNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+QIYT+I+SPD ASL+FM+AV P +VI+SLMFLIRPVG
Sbjct  150  ILKGFAGLGGAILSQIYTMINSPDPASLIFMVAVAPFVVIVSLMFLIRPVG  200



>gb|KJB11689.1| hypothetical protein B456_001G272000 [Gossypium raimondii]
Length=430

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+G+LKE++ +F +NRWLVFVA++W+Q+CAG+GY+FGS+SP+IK ++ YNQ+QLS LGVA
Sbjct  1    MMGKLKERIQAFVNNRWLVFVAAIWIQSCAGIGYVFGSLSPVIKRSLNYNQRQLSKLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAG+LSEILPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGSLSEILPLWGALLVGALQNLIGYGWVWLIVTGRAPVLPLWAMCILIFV  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            GN     F      SC++   FP+      G  +GF 
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  155


 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FM+AVGPA+V+++LMF+IRPVG
Sbjct  172  PDQAALIFMVAVGPAMVVVALMFIIRPVG  200



>gb|KDO63909.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=423

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>ref|XP_006447046.1| hypothetical protein CICLE_v10014684mg [Citrus clementina]
 gb|ESR60286.1| hypothetical protein CICLE_v10014684mg [Citrus clementina]
Length=423

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>gb|KJB11691.1| hypothetical protein B456_001G272000 [Gossypium raimondii]
Length=432

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 118/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+G+LKE++ +F +NRWLVFVA++W+Q+CAG+GY+FGS+SP+IK ++ YNQ+QLS LGVA
Sbjct  1    MMGKLKERIQAFVNNRWLVFVAAIWIQSCAGIGYVFGSLSPVIKRSLNYNQRQLSKLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAG+LSEILPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGSLSEILPLWGALLVGALQNLIGYGWVWLIVTGRAPVLPLWAMCILIFV  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            GN     F      SC++   FP+      G  +GF
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  154


 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FM+AVGPA+V+++LMF+IRPVG
Sbjct  172  PDQAALIFMVAVGPAMVVVALMFIIRPVG  200



>ref|XP_002882160.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58419.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=583

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E+V SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  66   SVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMC  115


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +C+LIFVG NGETYFNTA LVSGVQNFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTGRAPILPL-WAMCILIFVGNNGETYFNTATLVSGVQNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+Q+YT+IHS D ASL+FM+AV P++V++ LMF IRPVG
Sbjct  150  ILKGFAGLGGAILSQVYTMIHSSDRASLIFMVAVAPSVVVVPLMFFIRPVG  200



>gb|KJB76385.1| hypothetical protein B456_012G086100 [Gossypium raimondii]
Length=426

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRLKE+  +F +NRWLVFVA+MW+Q+CAGVGY+FGSISP+IKS++ YNQ+QLS LGVAK
Sbjct  1    MGRLKERFQAFVNNRWLVFVAAMWIQSCAGVGYIFGSISPVIKSSLNYNQRQLSKLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LS+ LPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSDRLPLWGALLVGAFQNLIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FMIAVGPA+V+I+LMF+IRPVG
Sbjct  171  PDQASLIFMIAVGPAMVVIALMFIIRPVG  199



>ref|NP_196916.1| major facilitator protein [Arabidopsis thaliana]
 dbj|BAB08291.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AED91990.1| major facilitator protein [Arabidopsis thaliana]
Length=579

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+LS LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLIGYGWVWLIVTGRAPILPLWAMCVLIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFA  155


 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVG NGETYFNT ALVSGVQNFPKSRGPVVGILKGFAGL GAI++QIYT+IHS
Sbjct  112  WAMCVLIFVGNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFAGLGGAIISQIYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             + ASL+ M+AV PA+V++ LMF IRPVG
Sbjct  172  SNPASLILMVAVTPAVVVVCLMFFIRPVG  200



>ref|XP_006399921.1| hypothetical protein EUTSA_v10013083mg [Eutrema salsugineum]
 dbj|BAJ34083.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41374.1| hypothetical protein EUTSA_v10013083mg [Eutrema salsugineum]
Length=579

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGFLAG+LSEILPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGSLSEILPLWAALLVGAVQNLVGYGWVWLIVTGRAPILPLWAMCILIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   GS + G   FP+      G  +GF 
Sbjct  121  GNNGETYFNTGSLVSGVHNFPKSRGPVVGILKGFA  155


 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 87/111 (78%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +C+LIFVG NGETYFNT +LVSGV NFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTGRAPILPL-WAMCILIFVGNNGETYFNTGSLVSGVHNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+QIYT +HSPD ASL+ M+AVGPA+V+  LMF IRPVG
Sbjct  150  ILKGFAGLGGAILSQIYTTMHSPDPASLIVMVAVGPAVVVAFLMFFIRPVG  200



>ref|XP_002300113.2| hypothetical protein POPTR_0001s33670g [Populus trichocarpa]
 gb|EEE84918.2| hypothetical protein POPTR_0001s33670g [Populus trichocarpa]
Length=591

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 124/181 (69%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+L E+   F +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQ+QL+SLGVAK
Sbjct  1    MGKLHERFAGFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQRQLASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LSEILPLW  LLVG  QN VGYGWVWL++TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSEILPLWGALLVGAVQNLVGYGWVWLVVTGRAPVLPLWAMCILIFIG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACI  617
            N     F      SC++   FP+      G  +GF         T IYA   S    + I
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFAGLSGAIL-TQIYATIHSPDHASLI  177

Query  618  Y  620
            +
Sbjct  178  F  178


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+G NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY  IHS
Sbjct  111  WAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYATIHS  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  171  PDHASLIFMVAVGPAMVVIALMFIVRPVG  199



>gb|KHG08620.1| putative transporter MCH1 [Gossypium arboreum]
Length=591

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+G+LKE+V +F +NRWLVFVA++W+Q+CAG+GY+FGS+SP+IK ++ YNQ+QLS LGVA
Sbjct  1    MMGKLKERVQAFVNNRWLVFVAAIWIQSCAGIGYVFGSLSPVIKRSLNYNQRQLSKLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAG+LSEILPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGSLSEILPLWGALLVGALQNLIGYGWVWLIVTGRAPVLPLWAMCILIFV  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            GN     F      SC++   FP+      G  +GF 
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  155


 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FM+AVGPA+V+++LMF+IRPVG
Sbjct  172  PDQAALIFMVAVGPAMVVVALMFIIRPVG  200



>ref|XP_006447047.1| hypothetical protein CICLE_v10014684mg [Citrus clementina]
 ref|XP_006470080.1| PREDICTED: uncharacterized protein LOC102613132 [Citrus sinensis]
 gb|ESR60287.1| hypothetical protein CICLE_v10014684mg [Citrus clementina]
Length=594

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>gb|KDO63908.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=563

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            N     F      SC++   FP+      G  +GF
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  153


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>gb|KDO63907.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=594

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+ +E+  SFF+NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQ++ LGVAK
Sbjct  1    MGKFQERFVSFFNNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L E+LP+W  LLVG  QNF+GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEVLPIWGALLVGALQNFIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHA  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  171  PDHANLIFMVAVGPAMVVIALMFIIRPVG  199



>gb|KJB76384.1| hypothetical protein B456_012G086100 [Gossypium raimondii]
Length=529

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRLKE+  +F +NRWLVFVA+MW+Q+CAGVGY+FGSISP+IKS++ YNQ+QLS LGVAK
Sbjct  1    MGRLKERFQAFVNNRWLVFVAAMWIQSCAGVGYIFGSISPVIKSSLNYNQRQLSKLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LS+ LPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSDRLPLWGALLVGAFQNLIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FMIAVGPA+V+I+LMF+IRPVG
Sbjct  171  PDQASLIFMIAVGPAMVVIALMFIIRPVG  199



>ref|XP_010489623.1| PREDICTED: uncharacterized protein LOC104767274 [Camelina sativa]
Length=311

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +E+V SF +NRWLVFV +MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVA
Sbjct  1    MARTTRERVISFINNRWLVFVVAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            KDLGDSVGFLA +LSE LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  61   KDLGDSVGFLAASLSEFLPLWAALLVGSLQNLVGYGWVWLIVTGRAPLLPLWAMC  115


 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = +1

Query  394  ADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQ  573
            A  LP  + +C+LIFVG NGETYFNTA LVSGVQNFPKSRGPVVGILKGFAGL GAIL+Q
Sbjct  106  APLLPL-WAMCILIFVGNNGETYFNTATLVSGVQNFPKSRGPVVGILKGFAGLGGAILSQ  164

Query  574  IYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            +YT+IHS D ASL+FM+AV P++V+I LMF IRPVG
Sbjct  165  VYTMIHSSDRASLIFMVAVAPSVVVIPLMFFIRPVG  200



>gb|KJB11688.1| hypothetical protein B456_001G272000 [Gossypium raimondii]
Length=591

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M+G+LKE++ +F +NRWLVFVA++W+Q+CAG+GY+FGS+SP+IK ++ YNQ+QLS LGVA
Sbjct  1    MMGKLKERIQAFVNNRWLVFVAAIWIQSCAGIGYVFGSLSPVIKRSLNYNQRQLSKLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAG+LSEILPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGSLSEILPLWGALLVGALQNLIGYGWVWLIVTGRAPVLPLWAMCILIFV  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            GN     F      SC++   FP+      G  +GF 
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  155


 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  112  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD A+L+FM+AVGPA+V+++LMF+IRPVG
Sbjct  172  PDQAALIFMVAVGPAMVVVALMFIIRPVG  200



>ref|XP_002509502.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50889.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 118/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRL+E++ +F +NRWLVFVA+MW+Q+CAGVGYLFGSISP+IKS++ YNQ+QL+SLGVAK
Sbjct  1    MGRLQERLYAFINNRWLVFVAAMWIQSCAGVGYLFGSISPVIKSSLNYNQRQLASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LSEILPLW  LLVG  QN VGYGWVWL++TG+ P LP+W MC  I  G
Sbjct  61   DLGDSVGFLAGSLSEILPLWGALLVGALQNLVGYGWVWLVVTGKAPVLPLWVMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+IHSP+
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMIHSPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGPA+V+++LMF+IRPVG
Sbjct  173  HASLIFMVAVGPAMVVVTLMFIIRPVG  199



>ref|XP_010495184.1| PREDICTED: uncharacterized protein LOC104772249 [Camelina sativa]
Length=522

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+LS LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGMGYLFGSISPVIKSSLNYNQKELSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN  GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLFGYGWVWLIVTGRAPVLPLWAMCLLIFI  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+G NGETYFNT  LVSGVQNFPKSRGPVVGILKGFAGL GAI++QI+T+++S
Sbjct  112  WAMCLLIFIGNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFAGLGGAIMSQIFTMLNS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             + ASL+ M+AV PA+V +SLMFLIRPVG
Sbjct  172  SNPASLILMVAVTPAVVGVSLMFLIRPVG  200



>ref|XP_010453528.1| PREDICTED: uncharacterized protein LOC104735432 [Camelina sativa]
Length=579

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+LS LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGMGYLFGSISPVIKSSLNYNQKELSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN  GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLFGYGWVWLIVTGRAPVLPLWAMCILIFI  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+G NGETYFNT  LVSGVQNFPKSRGPVVGILKGFAGL GAI++QIYT+IHS
Sbjct  112  WAMCILIFIGNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFAGLGGAIMSQIYTVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             + A+L+ M+AV PA+V +SLMFLIRPVG
Sbjct  172  SNPANLILMVAVTPAVVGVSLMFLIRPVG  200



>ref|XP_010420035.1| PREDICTED: uncharacterized protein LOC104705682 isoform X1 [Camelina 
sativa]
 ref|XP_010420036.1| PREDICTED: uncharacterized protein LOC104705682 isoform X2 [Camelina 
sativa]
Length=579

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+LS LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGMGYLFGSISPVIKSSLNYNQKELSRLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN  GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLFGYGWVWLIVTGRAPVLPLWAMCILIFI  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIF+G NGETYFNT  LVSGVQNFPKSRGPVVGILKGFAGL GAI++QIYT+IHS
Sbjct  112  WAMCILIFIGNNGETYFNTGTLVSGVQNFPKSRGPVVGILKGFAGLGGAIMSQIYTVIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             + A+L+ M+AV PA+V +SLMFLIRPVG
Sbjct  172  SNPANLILMVAVTPAVVGVSLMFLIRPVG  200



>ref|XP_009784305.1| PREDICTED: probable transporter mch1 [Nicotiana sylvestris]
Length=592

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
             LKE V  FF+NRWLVFVA+MW+QTCAG+GYLFGSISP IK ++ YNQ+Q++ LGVAKDL
Sbjct  3    HLKESVGFFFNNRWLVFVAAMWIQTCAGIGYLFGSISPTIKKSLNYNQRQIARLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTL EILPLWA LLVG  QNFVGYGWVWLI+T R P+LP+WAMC
Sbjct  63   GDSVGFLAGTLCEILPLWAALLVGAIQNFVGYGWVWLIVTSRAPSLPLWAMC  114


 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S A  LP  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI
Sbjct  102  TSRAPSLPL-WAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAI  160

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY +IHSP+HASL+FMIAVGPA+VII+LMF+IRPVG
Sbjct  161  LTQIYAVIHSPNHASLIFMIAVGPAMVIIALMFIIRPVG  199



>ref|XP_006287365.1| hypothetical protein CARUB_v10000565mg [Capsella rubella]
 gb|EOA20263.1| hypothetical protein CARUB_v10000565mg [Capsella rubella]
Length=579

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQL+ LGVA
Sbjct  1    MASTTREKFKSFINNRWLVFVAAMWIQSCAGMGYLFGSISPVIKSSLNYNQKQLARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN  GYGWVWL++TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLFGYGWVWLVVTGRAPILPLWAMCVLIFI  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFA  155


 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIF+G NGETYFNT ALVSGVQNFPKSRGPVVGILKGFAGL GAI++QIYT+  S
Sbjct  112  WAMCVLIFIGNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFAGLGGAIISQIYTMFQS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             + ASL+ M+AV PA+V +  MFLIRPVG
Sbjct  172  SNPASLILMVAVTPAVVAVCFMFLIRPVG  200



>gb|KJB76382.1| hypothetical protein B456_012G086100 [Gossypium raimondii]
Length=593

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRLKE+  +F +NRWLVFVA+MW+Q+CAGVGY+FGSISP+IKS++ YNQ+QLS LGVAK
Sbjct  1    MGRLKERFQAFVNNRWLVFVAAMWIQSCAGVGYIFGSISPVIKSSLNYNQRQLSKLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LS+ LPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSDRLPLWGALLVGAFQNLIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FMIAVGPA+V+I+LMF+IRPVG
Sbjct  171  PDQASLIFMIAVGPAMVVIALMFIIRPVG  199



>ref|XP_010913012.1| PREDICTED: uncharacterized protein LOC105038807 [Elaeis guineensis]
Length=594

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 5/155 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRL+ +  SF +NRWLVFVA+MWVQ+ AG+GYLFGS+SP+IKS++GYNQ+Q++SLGVAK
Sbjct  1    MGRLQGRFGSFLNNRWLVFVAAMWVQSVAGIGYLFGSLSPVIKSSLGYNQRQIASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+L EILPLWA LL+G  QN +GYGWVWLI+TGR PALP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLCEILPLWAALLIGALQNLIGYGWVWLIVTGRAPALPLWAMCVLIFLG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            N     F      SC++   FP+      G  +GF
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPIVGILKGF  153


 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQI+ +IH+
Sbjct  111  WAMCVLIFLGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIFAMIHT  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             DHA+L+FM+AVGP++V+I+LMF++RPVG
Sbjct  171  SDHAALIFMVAVGPSLVVIALMFIVRPVG  199



>ref|XP_002871602.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47861.1| nodulin family protein [Arabidopsis lyrata subsp. lyrata]
Length=579

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AGTLSEILPLWA LLVG  QN +GYGWVWLI TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLIGYGWVWLITTGRAPILPLWAMCVLIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   G+ + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFA  155


 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             ++G+G     ++  A  LP  + +CVLIFVG NGETYFNT ALVSGVQNFPKSRGPVVG
Sbjct  91   NLIGYGWVWLITTGRAPILPL-WAMCVLIFVGNNGETYFNTGALVSGVQNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAI++QIYT+IHS + ASL+ M+AV PA+V++ LMF IRPVG
Sbjct  150  ILKGFAGLGGAIISQIYTMIHSSNPASLILMVAVTPAVVVVCLMFFIRPVG  200



>ref|XP_010927760.1| PREDICTED: uncharacterized protein LOC105049721 [Elaeis guineensis]
Length=594

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+ K+ SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++GYNQ+QL+SLGVAK
Sbjct  1    MGTLQGKLRSFLNNRWLVFVAAMWMQSCAGIGYLFGSISPVIKSSLGYNQRQLASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAGTL E+LPLWA LL+G  QN +GYGWVWL++ GR+P LP+W MC  I  G
Sbjct  61   DLGDSVGFLAGTLCEVLPLWAALLIGALQNLIGYGWVWLVVVGRVPVLPLWVMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACI  617
            N     F      SC++   FP+      G  +GF         T IYA   +    A I
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFAGLSGAIL-TQIYAMIHTPDHAALI  177

Query  618  Y  620
            +
Sbjct  178  F  178


 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IH+PD
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMIHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V+I+LMF+IRPVG
Sbjct  173  HAALIFMVAVGPSMVVIALMFIIRPVG  199



>ref|XP_006404864.1| hypothetical protein EUTSA_v10000696mg [Eutrema salsugineum]
 gb|ESQ46317.1| hypothetical protein EUTSA_v10000696mg [Eutrema salsugineum]
Length=562

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E++ SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERLVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGFLAGTLSEILPLWA LLVG  QN VGYGWVWLI+T R P LP+WAMC
Sbjct  66   SVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTRRAPILPLWAMC  115


 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +C+LIFVG NGETYFNTAALVSGV NFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTRRAPILPL-WAMCILIFVGNNGETYFNTAALVSGVHNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+QIYT+IHS D ASL+FM+AV PA+V++ LMF IRPVG
Sbjct  150  ILKGFAGLGGAILSQIYTMIHSSDRASLIFMVAVAPAVVVVPLMFFIRPVG  200



>ref|XP_008801667.1| PREDICTED: uncharacterized protein LOC103715713 [Phoenix dactylifera]
Length=594

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 120/166 (72%), Gaps = 6/166 (4%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+ K+ SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++GYNQ+QL+SLGVAKDLG
Sbjct  4    LQGKLRSFLNNRWLVFVAAMWMQSCAGIGYLFGSISPVIKSSLGYNQRQLASLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW  452
            DS+GFLAGTL EILPLWA LL+G  QN +GYGWVWLI+TGR+P LP+W MC  I  GN  
Sbjct  64   DSLGFLAGTLCEILPLWAALLIGALQNLIGYGWVWLIVTGRVPVLPLWVMCILIFVGNNG  123

Query  453  *DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYA  584
               F      SC++   FP+      G  +GF         T IYA
Sbjct  124  ETYFNTAALVSCVQ--NFPKSRGPVVGILKGFAGLSGAIL-TQIYA  166


 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IH PD
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMIHKPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP +V+I+LMF+IRPVG
Sbjct  173  HAALIFMVAVGPTMVVIALMFIIRPVG  199



>ref|XP_009597102.1| PREDICTED: probable transporter mch1 isoform X1 [Nicotiana tomentosiformis]
Length=592

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
             LKE V   F+NRWLVFVA+MW+QTCAG+GYLFGSISP IK ++ YNQ+Q++ LGVAKDL
Sbjct  3    HLKESVGFLFNNRWLVFVAAMWIQTCAGIGYLFGSISPTIKKSLNYNQRQIARLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            GDSVGFLAGTL EILPLWA LLVG  QNF+GYGWVWLI+T R P+LP+WAMC
Sbjct  63   GDSVGFLAGTLCEILPLWAALLVGAIQNFIGYGWVWLIVTSRAPSLPLWAMC  114


 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S A  LP  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI
Sbjct  102  TSRAPSLPL-WAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAI  160

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY +IHSPDHASL+FMIAVGPA+VII+LMF+IRPVG
Sbjct  161  LTQIYAVIHSPDHASLIFMIAVGPAMVIIALMFIIRPVG  199



>gb|KHG07666.1| putative transporter MCH1 [Gossypium arboreum]
Length=593

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +GRLKE+  +F +NRWLVFVA+MW+Q+CAGVGY+FGSISP+IK ++ YNQ+QLS LGVAK
Sbjct  1    MGRLKERFQAFVNNRWLVFVAAMWIQSCAGVGYIFGSISPVIKISLNYNQRQLSKLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAG+LS+ LPLW  LLVG  QN +GYGWVWLI+TGR P LP+WAMC  I  G
Sbjct  61   DLGDSVGFLAGSLSDRLPLWGALLVGAFQNLIGYGWVWLIVTGRAPVLPLWAMCILIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFC  545
            N     F      SC++   FP+      G  +GF 
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGFA  154


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ 
Sbjct  111  WAMCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FMIAVGPA+V+I+LMF+IRPVG
Sbjct  171  PDQASLIFMIAVGPAMVVIALMFIIRPVG  199



>gb|EYU34813.1| hypothetical protein MIMGU_mgv1a003413mg [Erythranthe guttata]
Length=586

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L ++++SF +NRWLVFVA+MW+Q+CAG+GYLFGSISPIIK+++ YNQ+Q++ LGVAK
Sbjct  1    MGGLGDRLSSFLNNRWLVFVAAMWIQSCAGIGYLFGSISPIIKTSLNYNQRQIARLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            DLGDSVGFLAG+LSEILPLWA LL+G  QNFVGYGWVWL++T R P LP+WAMC
Sbjct  61   DLGDSVGFLAGSLSEILPLWAALLIGAIQNFVGYGWVWLVVTSRAPVLPLWAMC  114


 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S A  LP  + +C+LIF+GTNGETYFNTA+LVS VQNFPKSRGPVVGILKGFAGL GAI
Sbjct  102  TSRAPVLPL-WAMCILIFIGTNGETYFNTASLVSCVQNFPKSRGPVVGILKGFAGLGGAI  160

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY +++SPDHASL+FM+AVGP +V+I+LMF++RPVG
Sbjct  161  LTQIYAVMYSPDHASLIFMVAVGPTMVVIALMFIVRPVG  199



>ref|XP_010524260.1| PREDICTED: probable transporter mch1 [Tarenaya hassleriana]
Length=583

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    ++ + SF +NRWLVFVA+MW+Q+CAGVGYLFGSISP+IKS++ YNQ++L+ LGVA
Sbjct  1    MAASARQTLLSFINNRWLVFVAAMWIQSCAGVGYLFGSISPVIKSSLHYNQRELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAGTLSE+LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGTLSELLPLWAALLVGAFQNLVGYGWVWLIVTGRAPVLPLWAMCVLIFV  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            GN     F      SC++   FP+      G  +GF
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  154


 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAIL+QIYT+I+S
Sbjct  112  WAMCVLIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMINS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF IRPVG
Sbjct  172  PDHASLIFMVAVGPAVVVIALMFFIRPVG  200



>ref|XP_010550224.1| PREDICTED: probable transporter mch1 isoform X1 [Tarenaya hassleriana]
Length=589

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    ++K+ SF +NRWLVF+A+MW+Q+CAG+GYLFGSISP+IKS++ YNQ++L+ LGVA
Sbjct  1    MTATARDKLVSFINNRWLVFIAAMWIQSCAGIGYLFGSISPVIKSSLNYNQRELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-C  440
            KDLGDSVGFLAGTLSE+LPLWA LLVG  QN  GYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFLAGTLSEVLPLWAALLVGAFQNLFGYGWVWLIVTGRAPVLPLWAMCVLIFI  120

Query  441  GNKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
            GN     F      SC++   FP+      G  +GF
Sbjct  121  GNNGETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  154


 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIF+G NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAIL+QIYT+IHS
Sbjct  112  WAMCVLIFIGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+++LMF IRPVG
Sbjct  172  PDHASLIFMVAVGPAVVVVALMFFIRPVG  200



>emb|CDY58410.1| BnaC09g54560D [Brassica napus]
Length=580

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AG LSE+LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGYLSEMLPLWAALLVGAVQNLVGYGWVWLIVTGRAPILPLWAMCILIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +    S + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTASLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTA+LVSGVQNFPKSRGPVVGILKGFAGL GA+L+QIYT+I+S
Sbjct  112  WAMCILIFVGNNGETYFNTASLVSGVQNFPKSRGPVVGILKGFAGLGGAMLSQIYTVINS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FM+AV PA+V+I+LMF IRPVG
Sbjct  172  PDPASLIFMVAVAPAVVVITLMFFIRPVG  200



>ref|XP_009121693.1| PREDICTED: uncharacterized protein LOC103846506 [Brassica rapa]
 emb|CDX69602.1| BnaA10g19510D [Brassica napus]
Length=580

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG+GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AG LSE+LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGYLSEMLPLWAALLVGAVQNLVGYGWVWLIVTGRAPILPLWAMCILIFV  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +    S + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTASLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVG NGETYFNTA+LVSGVQNFPKSRGPVVGILKGFAGL GA+L+QIYT+I+S
Sbjct  112  WAMCILIFVGNNGETYFNTASLVSGVQNFPKSRGPVVGILKGFAGLGGAMLSQIYTVINS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FM+AV PA+V+I LMF IRPVG
Sbjct  172  PDPASLIFMVAVAPAVVVIPLMFFIRPVG  200



>ref|XP_010485347.1| PREDICTED: uncharacterized protein LOC104763702 isoform X1 [Camelina 
sativa]
Length=581

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E+V SF +NRWLVFV +MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERVISFINNRWLVFVVAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGFLA +LSE LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  66   SVGFLAASLSEFLPLWAALLVGSLQNLVGYGWVWLIVTGRAPLLPLWAMC  115


 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +C+LIFVG NGETYFNTA LVSGVQNFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTGRAPLLPL-WAMCILIFVGNNGETYFNTATLVSGVQNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+Q+YT+IHS D ASL+FM+AV P++V+I LMF IRPVG
Sbjct  150  ILKGFAGLGGAILSQVYTMIHSSDRASLIFMVAVAPSVVVIPLMFFIRPVG  200



>ref|XP_010496426.1| PREDICTED: uncharacterized protein LOC104773497 [Camelina sativa]
 ref|XP_010496427.1| PREDICTED: uncharacterized protein LOC104773497 [Camelina sativa]
Length=584

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  99   KEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGD  278
            +E+V SF +NRWLVFV +MW+Q+CAG+GYLFGSISP+IKS++ YNQKQLS LGVAKDLGD
Sbjct  6    RERVISFINNRWLVFVVAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVAKDLGD  65

Query  279  SVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            SVGF+A +LSE LPLWA LLVG  QN VGYGWVWLI+TGR P LP+WAMC
Sbjct  66   SVGFIAASLSEFLPLWAALLVGSLQNLVGYGWVWLIVTGRAPLLPLWAMC  115


 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +  A  LP  + +C+LIFVG NGETYFNTA LVSGVQNFPKSRGPVVG
Sbjct  91   NLVGYGWVWLIVTGRAPLLPL-WAMCILIFVGNNGETYFNTATLVSGVQNFPKSRGPVVG  149

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGL GAIL+Q+YT+IHS D ASL+FM+AV P++V+I LMF IRPVG
Sbjct  150  ILKGFAGLGGAILSQVYTMIHSSDRASLIFMVAVAPSVVVIPLMFFIRPVG  200



>emb|CDX78561.1| BnaA03g04730D [Brassica napus]
Length=581

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFASFINNRWLVFVAAMWIQSCAGNGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AG+LSE  PLW  LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGSLSENFPLWVALLVGAVQNLVGYGWVWLIVTGRAPVLPLWAMCFLIFA  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   GS + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C LIF G NGETYFNT +LVSGVQNFPKSRGPVVGILKGFAGL GAIL+QIYT+IHS
Sbjct  112  WAMCFLIFAGNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             D AS++ M+AV PA+V +SLMF IRPVG
Sbjct  172  SDPASIILMVAVAPAVVAVSLMFFIRPVG  200



>ref|XP_009131387.1| PREDICTED: uncharacterized protein LOC103856061 [Brassica rapa]
Length=580

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFASFINNRWLVFVAAMWIQSCAGNGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AG+LSE  PLW  LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGSLSENFPLWVALLVGAVQNLVGYGWVWLIVTGRAPVLPLWAMCFLIFA  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   GS + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C LIF G NGETYFNT +LVSGVQNFPKSRGPVVGILKGFAGL GAIL+QIYT+IHS
Sbjct  112  WAMCFLIFAGNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD AS++ M+AV PA+V +SLMF IRPVG
Sbjct  172  PDPASIILMVAVAPAVVAVSLMFFIRPVG  200



>emb|CDX70543.1| BnaC03g06270D [Brassica napus]
Length=580

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = +3

Query  84   MVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVA  263
            M    +EK  SF +NRWLVFVA+MW+Q+CAG GYLFGSISP+IKS++ YNQK+L+ LGVA
Sbjct  1    MASTTREKFLSFINNRWLVFVAAMWIQSCAGNGYLFGSISPVIKSSLNYNQKELARLGVA  60

Query  264  KDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHICG  443
            KDLGDSVGF+AG+LSE  PLW  LLVG  QN VGYGWVWLI+TGR P LP+WAMC  I  
Sbjct  61   KDLGDSVGFIAGSLSENFPLWVALLVGAVQNLVGYGWVWLIVTGRAPVLPLWAMCFLIFA  120

Query  444  NKW*DLF*YCGSCLRGAK-FPQKPWSCGGNTQGFC  545
                + +   GS + G + FP+      G  +GF 
Sbjct  121  GNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFA  155


 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C LIF G NGETYFNT +LVSGVQNFPKSRGPVVGILKGFAGL GAIL+QIYT+IHS
Sbjct  112  WAMCFLIFAGNNGETYFNTGSLVSGVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMIHS  171

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD AS++ M+AV PA+V +SLMF IRPVG
Sbjct  172  PDPASIILMVAVAPAVVAVSLMFFIRPVG  200



>ref|XP_008790753.1| PREDICTED: uncharacterized protein LOC103707850 isoform X1 [Phoenix 
dactylifera]
Length=594

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 122/178 (69%), Gaps = 6/178 (3%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+ K+ SF +NRWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQ+QL+SLGVAKDLG
Sbjct  4    LQGKLRSFLNNRWLVFVAAMWMQSWAGIGYLFGSISPVIKSSLGYNQRQLASLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW  452
            DSVGFLAGTL E+LPLWA LL+G  QN +GYGWVWL++ GR+P LP+W MC  I  GN  
Sbjct  64   DSVGFLAGTLCEVLPLWAALLIGALQNLIGYGWVWLVVIGRVPVLPLWVMCILIFVGNNG  123

Query  453  *DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
               F      SC++   FP+      G  +GF         T IYA   +    A I+
Sbjct  124  ETYFNTAALVSCVQ--NFPKSRGPVVGILKGFAGLSGAIL-TQIYAMIHTPDHAALIF  178


 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IH+PD
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMIHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP +V+I+LMF+IRPVG
Sbjct  173  HAALIFMVAVGPTMVVIALMFIIRPVG  199



>ref|XP_008790755.1| PREDICTED: uncharacterized protein LOC103707850 isoform X2 [Phoenix 
dactylifera]
Length=561

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 122/178 (69%), Gaps = 6/178 (3%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+ K+ SF +NRWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQ+QL+SLGVAKDLG
Sbjct  4    LQGKLRSFLNNRWLVFVAAMWMQSWAGIGYLFGSISPVIKSSLGYNQRQLASLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW  452
            DSVGFLAGTL E+LPLWA LL+G  QN +GYGWVWL++ GR+P LP+W MC  I  GN  
Sbjct  64   DSVGFLAGTLCEVLPLWAALLIGALQNLIGYGWVWLVVIGRVPVLPLWVMCILIFVGNNG  123

Query  453  *DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
               F      SC++   FP+      G  +GF         T IYA   +    A I+
Sbjct  124  ETYFNTAALVSCVQ--NFPKSRGPVVGILKGFAGLSGAIL-TQIYAMIHTPDHAALIF  178


 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IH+PD
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMIHTPD  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP +V+I+LMF+IRPVG
Sbjct  173  HAALIFMVAVGPTMVVIALMFIIRPVG  199



>ref|XP_002964117.1| hypothetical protein SELMODRAFT_62386, partial [Selaginella moellendorffii]
 gb|EFJ34450.1| hypothetical protein SELMODRAFT_62386, partial [Selaginella moellendorffii]
Length=562

 Score =   125 bits (314),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RWLV VASMW+Q C GVGY++GS SP+IK+ + YNQ+Q+++L VAK++G SVG  AG+L
Sbjct  1    SRWLVLVASMWLQACGGVGYIYGSYSPVIKARLHYNQRQMNTLAVAKNIGGSVGIFAGSL  60

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            S +LP W ++L+G  QN VGYG +WL++T      P+W MC
Sbjct  61   STVLPPWGLILLGGFQNLVGYGGIWLLVTSLALPSPLWLMC  101


 Score = 99.4 bits (246),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI +GTN E+YFNT +LVS V+NFP++RGPVVGILKGF+GL GAI T  Y  + +P 
Sbjct  100  MCVLIMIGTNEESYFNTVSLVSAVRNFPRNRGPVVGILKGFSGLCGAIFTLAYGALLAPH  159

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
              + + ++AV P IV + +M +IRP+
Sbjct  160  QEAFILLVAVTPIIVGVIVMPIIRPL  185



>tpg|DAA48224.1| TPA: hypothetical protein ZEAMMB73_995020 [Zea mays]
Length=117

 Score =   170 bits (430),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
             +  +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IK+++GYNQ+Q++ LGVAKDL
Sbjct  3    EIGSRVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKASLGYNQRQVAGLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            GDSVGFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WA+
Sbjct  63   GDSVGFLAGTLCSVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAL  113



>ref|NP_001152103.1| nodulin-like protein [Zea mays]
 gb|ACG45781.1| nodulin-like protein [Zea mays]
Length=596

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
             +  +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IK+++GYNQ+Q++ LGVAKDL
Sbjct  3    EIGSRVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKASLGYNQRQVAGLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNK  449
            GDSVGFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  GN 
Sbjct  63   GDSVGFLAGTLCSVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFIGNN  122

Query  450  W*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
                F      SC++   FP+   S  G  +GF         T IYA   S    A I+
Sbjct  123  GETYFNTAALVSCVQ--NFPKSRGSIVGILKGFAGLSGAIL-TQIYAIVHSPDDAALIF  178


 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+G NGETYFNTAALVS VQNFPKSRG +VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGSIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +++I+LMF++RPVG
Sbjct  167  IVHSPDDAALIFMVAVGPTMIVIALMFIVRPVG  199



>ref|XP_002992050.1| hypothetical protein SELMODRAFT_42415, partial [Selaginella moellendorffii]
 gb|EFJ06899.1| hypothetical protein SELMODRAFT_42415, partial [Selaginella moellendorffii]
Length=563

 Score =   124 bits (311),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RWLV VASMW+Q C GVGY++GS SP+IK+ + YNQ+Q+++L VAK++G SVG  AG+L
Sbjct  1    SRWLVLVASMWLQACGGVGYIYGSYSPVIKARLLYNQRQMNTLAVAKNIGGSVGIFAGSL  60

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            S +LP W ++L+G  QN VGYG +WL++T      P+W MC
Sbjct  61   STVLPPWGLILLGGFQNLVGYGGIWLLVTSLALPSPLWLMC  101


 Score = 98.2 bits (243),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI +GTN E+Y+NT +LVS V+NFP++RGPVVGILKGF+GL GAI T  Y  + +P 
Sbjct  100  MCVLIMIGTNEESYYNTVSLVSAVRNFPRNRGPVVGILKGFSGLCGAIFTLAYGALLAPH  159

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
              + + ++AV P IV + +M +IRP+
Sbjct  160  QEAFILLVAVTPIIVGVIVMPIIRPL  185



>ref|XP_008664391.1| PREDICTED: uncharacterized protein LOC103643013 [Zea mays]
Length=596

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
             +  +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IK+++GYNQ+Q++ LGVAKDL
Sbjct  3    EIGSRVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKASLGYNQRQVAGLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNK  449
            GDSVGFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  GN 
Sbjct  63   GDSVGFLAGTLCSVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFIGNN  122

Query  450  W*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
                F      SC++   FP+      G  +GF         T IYA   S    A I+
Sbjct  123  GETYFNTAALVSCVQ--NFPKSRGPIVGILKGFAGLSGAIL-TQIYAIVHSPDDAALIF  178


 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +++I+LMF++RPVG
Sbjct  167  IVHSPDDAALIFMVAVGPTMIVIALMFIVRPVG  199



>ref|NP_001146179.1| uncharacterized protein LOC100279749 [Zea mays]
 gb|ACL53414.1| unknown [Zea mays]
Length=595

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +  +  +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IK+++GYNQ+Q++ LGVAK
Sbjct  1    MAEVGSRVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKASLGYNQRQVAGLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  G
Sbjct  61   DLGDSVGFLAGTLCAVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFIG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACI  617
            N     F      SC++   FP+      G  +GF         T IYA   S    A I
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPIVGILKGFAGLSGAIL-TQIYAIVHSPDDAALI  177

Query  618  Y  620
            +
Sbjct  178  F  178


 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  IVHSPDDAALIFMVAVGPTMVVIALMFIVRPVG  199



>ref|XP_009385482.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
 ref|XP_009385483.1| PREDICTED: probable transporter mch1 [Musa acuminata subsp. malaccensis]
Length=594

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = +3

Query  93   RLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDL  272
            RL+  + SFF NRWLVFVA+MW+Q+ AG+GYLFGSISP+IKS+MGYNQ+Q++SLGVAKDL
Sbjct  3    RLQGNLQSFFHNRWLVFVAAMWMQSWAGIGYLFGSISPVIKSSMGYNQRQIASLGVAKDL  62

Query  273  GDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNK  449
            GDSVGFLAGTL EILPLW  LL+G  QN +GYG VWL++T ++P LP+W MC  I  GN 
Sbjct  63   GDSVGFLAGTLCEILPLWVALLIGALQNLIGYGLVWLVVTRQVPVLPLWVMCILIFVGNN  122

Query  450  W*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
                F      SC++   FP+      G  +GF
Sbjct  123  GETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  153


 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQ+Y +IH P+
Sbjct  113  MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQLYAMIHIPN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP +V+++LMF++RPVG
Sbjct  173  HAALIFMVAVGPTMVVMALMFIVRPVG  199



>gb|AFW61584.1| nodulin-like protein [Zea mays]
Length=595

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +  +  +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IK+++GYNQ+Q++ LGVAK
Sbjct  1    MAEVGSRVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKASLGYNQRQVAGLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  G
Sbjct  61   DLGDSVGFLAGTLCAVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFIG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACI  617
            N     F      SC++   FP+      G  +GF         T IYA   S    A I
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKSRGPIVGILKGFAGLSGAIL-TQIYAIVHSPDDAALI  177

Query  618  Y  620
            +
Sbjct  178  F  178


 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  IVHSPDDAALIFMVAVGPTMVVIALMFIVRPVG  199



>dbj|BAJ95281.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=587

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +  ++ +V  F  NRWLVFVA+MW+Q+ AGVGYLFGS+SP IKS++GYNQ+Q++SLGVAK
Sbjct  1    MAEVRSRVRGFLRNRWLVFVAAMWMQSVAGVGYLFGSLSPAIKSSLGYNQRQVASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAGTL  +LPLWA LL+G AQN VGYGWVWL +T R+P  P+WAMC  I  G
Sbjct  61   DLGDSVGFLAGTLCAVLPLWAALLIGAAQNLVGYGWVWLAVTHRVPVPPLWAMCMLIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACI  617
            N     F      SC++   FP+      G  +GF         T +YA   S    A I
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKNRGPIVGILKGFAGLSGAIL-TQVYAIMHSPDDAALI  177

Query  618  Y  620
            +
Sbjct  178  F  178


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIFVG NGETYFNTAALVS VQNFPK+RGP+VGILKGFAGLSGAILTQ+Y 
Sbjct  107  VPPLWAMCMLIFVGNNGETYFNTAALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQVYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +V+I+LMF++RPV 
Sbjct  167  IMHSPDDAALIFMVAVGPTMVVIALMFIVRPVN  199



>ref|XP_004974007.1| PREDICTED: uncharacterized protein LOC101764387 [Setaria italica]
Length=595

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP+IKS++GYNQ+Q++ LGVAKDLGDSV
Sbjct  7    RVRGFLRNRWLVFVAAMWMQSCAGVGYLFGSLSPVIKSSLGYNQRQVAGLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW*DL  461
            GFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R P  P+WAMC  I  GN     
Sbjct  67   GFLAGTLCAVLPLWAALLVGAAQNLVGYGWVWLAVTRRAPTPPLWAMCILIFIGNNGETY  126

Query  462  F*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
            F      SC++   FP+      G  +GF         T IYA   S    A I+
Sbjct  127  FNTAALVSCVQ--NFPKNRGPIVGILKGFAGLSGAIL-TQIYAMINSPDDAALIF  178


 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C+LIF+G NGETYFNTAALVS VQNFPK+RGP+VGILKGFAGLSGAILTQIY +
Sbjct  108  PPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQIYAM  167

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            I+SPD A+L+FM+AVGP +V+I L+F++RPVG
Sbjct  168  INSPDDAALIFMVAVGPTMVVIGLVFIVRPVG  199



>ref|XP_003553263.1| PREDICTED: uncharacterized protein LOC100796700 isoform X1 [Glycine 
max]
Length=587

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+EK++SF+ +RWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQKQL+ LGVAK
Sbjct  1    MGVLQEKLSSFYKSRWLVFVAAMWLQSWAGIGYLFGSISPVIKSSLGYNQKQLAMLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            DLGD+VGF+ G L EILP+W  LLVG A N VGYGWVWL++T ++P LP+WAMC+ I
Sbjct  61   DLGDAVGFMTGLLCEILPIWGALLVGAALNLVGYGWVWLVVTSQVPVLPLWAMCALI  117


 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +S    LP  + +C LIFVGTNGETYFNT +LVS VQNFPKSRGPVVG
Sbjct  90   NLVGYGWVWLVVTSQVPVLPL-WAMCALIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVG  148

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGLSGAILTQIY L H+P+ ASL+FM+AVGP++V I LMF++RPVG
Sbjct  149  ILKGFAGLSGAILTQIYALFHAPNQASLIFMVAVGPSLVGIGLMFIVRPVG  199



>gb|KHN40970.1| Putative transporter MCH1 [Glycine soja]
Length=587

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+EK++SF+ +RWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQKQL+ LGVAK
Sbjct  1    MGVLQEKLSSFYKSRWLVFVAAMWLQSWAGIGYLFGSISPVIKSSLGYNQKQLAMLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            DLGD+VGF+ G L EILP+W  LLVG A N VGYGWVWL++T ++P LP+WAMC+ I
Sbjct  61   DLGDAVGFMTGLLCEILPIWGALLVGAALNLVGYGWVWLVVTSQVPVLPLWAMCALI  117


 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +S    LP  + +C LIFVGTNGETYFNT +LVS VQNFPKSRGPVVG
Sbjct  90   NLVGYGWVWLVVTSQVPVLPL-WAMCALIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVG  148

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGLSGAILTQIY L HSP+ ASL+FM+AVGP++V I LMF++RPVG
Sbjct  149  ILKGFAGLSGAILTQIYALFHSPNQASLIFMVAVGPSLVGIGLMFIVRPVG  199



>ref|XP_003547642.1| PREDICTED: uncharacterized protein LOC100818484 [Glycine max]
Length=587

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L+EK++SF+ +RWLVFVA+MW+Q+ AG+GYLFGSISP+IKS++GYNQKQL+ LGVAK
Sbjct  1    MGVLQEKLSSFYKSRWLVFVAAMWLQSWAGIGYLFGSISPVIKSSLGYNQKQLAMLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            DLGD+VGF+ G L EILP+W  LLVG A N VGYGWVWL++T ++P LP+WAMC+ I
Sbjct  61   DLGDAVGFMTGLLCEILPIWGALLVGAALNVVGYGWVWLVVTSQVPVLPVWAMCALI  117


 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S    LP  + +C LIFVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAI
Sbjct  102  TSQVPVLPV-WAMCALIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAI  160

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY L HSP+ ASL+FM+AVGP++V I LMF++RPVG
Sbjct  161  LTQIYALFHSPNQASLIFMVAVGPSLVGIGLMFIVRPVG  199



>gb|EMT08736.1| hypothetical protein F775_20527 [Aegilops tauschii]
Length=586

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 115/169 (68%), Gaps = 6/169 (4%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +  ++ +V  F  NRWLVFVA+MW+Q+ AGVGYLFGS+SP IKS++GYNQ+Q++SLGVAK
Sbjct  1    MAEVRSRVRGFLRNRWLVFVAAMWMQSVAGVGYLFGSLSPAIKSSLGYNQRQVASLGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CG  443
            DLGDSVGFLAGTL  +LPLWA LL+G AQN VGYGWVWL +T R+P  P+WAMC  I  G
Sbjct  61   DLGDSVGFLAGTLCAVLPLWAALLIGAAQNLVGYGWVWLAVTHRVPVPPLWAMCMLIFVG  120

Query  444  NKW*DLF*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYA  584
            N     F      SC++   FP+      G  +GF         T +YA
Sbjct  121  NNGETYFNTAALVSCVQ--NFPKNRGPIVGILKGFAGLSGAIL-TQVYA  166


 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIFVG NGETYFNTAALVS VQNFPK+RGP+VGILKGFAGLSGAILTQ+Y 
Sbjct  107  VPPLWAMCMLIFVGNNGETYFNTAALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQVYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++H+PD A+L+FM+AVGP +V+I+LMF++RPV 
Sbjct  167  IMHTPDDAALIFMVAVGPTMVVIALMFIVRPVN  199



>gb|AFW58066.1| hypothetical protein ZEAMMB73_861058 [Zea mays]
Length=117

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP+IK+ +GYNQ+Q+++LGVAK
Sbjct  1    MGALGDRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVIKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIW  419
            DLGD VGFLAG+LS +LP WA+LL+G AQNF+GYGW+WLI+T + PALP+W
Sbjct  61   DLGDCVGFLAGSLSAVLPSWAMLLIGSAQNFLGYGWLWLIVTRQAPALPLW  111



>ref|XP_002445809.1| hypothetical protein SORBIDRAFT_07g026140 [Sorghum bicolor]
 gb|EES15304.1| hypothetical protein SORBIDRAFT_07g026140 [Sorghum bicolor]
Length=595

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q+CAGVGYLFGS+SP IK+++GYNQ+Q++ LGVAKDLGDSV
Sbjct  7    RVRGFLHNRWLVFVAAMWMQSCAGVGYLFGSLSPGIKASLGYNQRQVAGLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW*DL  461
            GFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  GN     
Sbjct  67   GFLAGTLCAVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFIGNNGETY  126

Query  462  F*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
            F      SC++   FP+      G  +GF         T IYA   S    A I+
Sbjct  127  FNTAALVSCVQ--NFPKSRGPIVGILKGFAGLSGAIL-TQIYAIVHSPDDAALIF  178


 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFIGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPD A+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  IVHSPDDAALIFMVAVGPTMVVIALMFIVRPVG  199



>ref|XP_003574828.1| PREDICTED: probable transporter mch1 [Brachypodium distachyon]
Length=589

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 115/175 (66%), Gaps = 6/175 (3%)
 Frame = +3

Query  105  KVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSV  284
            +V  F  NRWLVFVA+MW+Q+ AGVGYLFGS+SP+IKS++GY Q+QL+ LGVAKDLGDSV
Sbjct  7    RVRGFLRNRWLVFVAAMWMQSFAGVGYLFGSLSPVIKSSLGYTQRQLAGLGVAKDLGDSV  66

Query  285  GFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW*DL  461
            GFLAGTL  +LPLWA LLVG AQN VGYGWVWL +T R+P  P+WAMC  I  GN     
Sbjct  67   GFLAGTLCAVLPLWAALLVGAAQNLVGYGWVWLAVTRRVPVPPLWAMCILIFVGNNGETY  126

Query  462  F*YCG--SCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
            F      SC++   FP+      G  +GF         T IYA   S    A I+
Sbjct  127  FNTAALVSCVQ--NFPKNRGPIVGILKGFAGLSGAIL-TQIYAMVHSPDHAALIF  178


 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  403  LPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYT  582
            +P  + +C+LIFVG NGETYFNTAALVS VQNFPK+RGP+VGILKGFAGLSGAILTQIY 
Sbjct  107  VPPLWAMCILIFVGNNGETYFNTAALVSCVQNFPKNRGPIVGILKGFAGLSGAILTQIYA  166

Query  583  LIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ++HSPDHA+L+FM+AVGP +V+I+LMF++RPVG
Sbjct  167  MVHSPDHAALIFMVAVGPTMVVIALMFIVRPVG  199



>gb|KHG00245.1| putative transporter MCH1 [Gossypium arboreum]
Length=593

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 5/152 (3%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            LKE+  +F +NRWLVFVA+MW+Q+C G GY+FGSISP++KS++ YNQ+QLS LGVAKDLG
Sbjct  4    LKERFQAFVNNRWLVFVAAMWMQSCTGPGYIFGSISPVMKSSLNYNQRQLSKLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW  452
             SVGF+AG+LSEILPLW VLLVG  QN +GY  +WLI+TG++P   +WAMC  I  GN  
Sbjct  64   GSVGFIAGSLSEILPLWGVLLVGALQNLIGYSSLWLIVTGKVPVFQLWAMCVLIFVGNNG  123

Query  453  *DLF*YCG--SCLRGAKFPQKPWSCGGNTQGF  542
               F      SC++   FP+      G  +GF
Sbjct  124  ETYFNTAALVSCVQ--NFPKSRGPVVGILKGF  153


 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFA LSGAILTQIYT+I+ 
Sbjct  111  WAMCVLIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAALSGAILTQIYTMINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PD ASL+FM+AVGP +V+ +LMF+IRPVG
Sbjct  171  PDQASLIFMVAVGPTMVVFALMFIIRPVG  199



>gb|EMS47360.1| hypothetical protein TRIUR3_13858 [Triticum urartu]
Length=126

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G L +++ +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISPI+K+ +GYNQ+ +++LG+AK
Sbjct  1    MGVLADRLRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPILKAALGYNQRHVAALGIAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPI  416
            DLGD VGFLAG+LS +LP WA+LL+G  QNF+GYGW+WLI+T + P LP+
Sbjct  61   DLGDCVGFLAGSLSAMLPAWAMLLIGALQNFLGYGWLWLIVTKQAPPLPL  110



>gb|KEH22006.1| nodulin-like/MFS transporter [Medicago truncatula]
Length=589

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            LKEK  + + +RW VFV +MW+Q+ AG+GYLFGSISP+IKS++ YNQKQL+ LGVAKDLG
Sbjct  4    LKEKFVTLYKSRWFVFVGAMWLQSWAGIGYLFGSISPVIKSSLNYNQKQLAMLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            D VGFL G L EILP+WA L +G + N VGYGWVWLI+T ++P LP+WAMC
Sbjct  64   DCVGFLTGVLCEILPIWAALFIGASLNLVGYGWVWLIVTSKVPVLPLWAMC  114


 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 6/111 (5%)
 Frame = +1

Query  364  GMVGFG-----SSSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVG  528
             +VG+G      +S    LP  + +C+LIFVGTNGETYFNT +LVS VQNFPKSRGPVVG
Sbjct  90   NLVGYGWVWLIVTSKVPVLPL-WAMCILIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVG  148

Query  529  ILKGFAGLSGAILTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            ILKGFAGLSGAILTQIY +IHSPDHASL+FM+AVGPA+V I LMF++RPVG
Sbjct  149  ILKGFAGLSGAILTQIYAVIHSPDHASLIFMVAVGPALVGIGLMFIVRPVG  199



>ref|XP_009597103.1| PREDICTED: probable transporter mch1 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009597104.1| PREDICTED: probable transporter mch1 isoform X2 [Nicotiana tomentosiformis]
Length=570

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  153  MWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAV  332
            MW+QTCAG+GYLFGSISP IK ++ YNQ+Q++ LGVAKDLGDSVGFLAGTL EILPLWA 
Sbjct  1    MWIQTCAGIGYLFGSISPTIKKSLNYNQRQIARLGVAKDLGDSVGFLAGTLCEILPLWAA  60

Query  333  LLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            LLVG  QNF+GYGWVWLI+T R P+LP+WAMC
Sbjct  61   LLVGAIQNFIGYGWVWLIVTSRAPSLPLWAMC  92


 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S A  LP  + +C+LIF+GTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAI
Sbjct  80   TSRAPSLPL-WAMCILIFIGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAI  138

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY +IHSPDHASL+FMIAVGPA+VII+LMF+IRPVG
Sbjct  139  LTQIYAVIHSPDHASLIFMIAVGPAMVIIALMFIIRPVG  177



>dbj|BAG89634.1| unnamed protein product [Oryza sativa Japonica Group]
Length=505

 Score =   144 bits (364),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTA+LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+PD
Sbjct  32   MCLLIFVGTNGETYFNTASLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVLHTPD  91

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  92   HATLVFMVAVGPSLVAIGLMFVIRPVG  118


 Score = 56.2 bits (134),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  330  VLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            +LLVG AQNF+GYGW+WLI+T +LPALP+  MC
Sbjct  1    MLLVGAAQNFLGYGWLWLIVTRQLPALPLSMMC  33



>gb|KJB33996.1| hypothetical protein B456_006G042600 [Gossypium raimondii]
Length=569

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 109/176 (62%), Gaps = 15/176 (9%)
 Frame = +3

Query  96   LKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLG  275
            L+E   +F +NRWLVFV +MW+Q+C+G GY+FGSIS +IK+++ YNQKQ+S LGVAKDLG
Sbjct  4    LEEGFQAFLNNRWLVFVPAMWLQSCSGPGYIFGSISSVIKTSLNYNQKQISKLGVAKDLG  63

Query  276  DSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW  452
             S+G +AGTLSEILPLW V LV   QN +GYG VWLI+TG++P  P+WAMC  I  GN  
Sbjct  64   GSIGLIAGTLSEILPLWGVSLVDALQNLMGYGSVWLIVTGKVPVFPLWAMCVLIFVGNNG  123

Query  453  *DLF*YCGSCLRGAKFPQKPWSCGGNTQGFCRTEWCYFDTNIYANPFSGSCLACIY  620
               F           FP+      G  +GF                 SG+ LA IY
Sbjct  124  ETYFNTAALVSGLQNFPESTGPVVGILKGF--------------TALSGAILAQIY  165


 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +CVLIFVG NGETYFNTAALVSG+QNFP+S GPVVGILKGF  LSGAIL QIYTLI+ 
Sbjct  111  WAMCVLIFVGNNGETYFNTAALVSGLQNFPESTGPVVGILKGFTALSGAILAQIYTLINF  170

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
             D +SL+FM+AVGP +V+I+LMF+IRPVG
Sbjct  171  RDQSSLIFMVAVGPRMVVIALMFIIRPVG  199



>ref|XP_009783274.1| PREDICTED: uncharacterized protein LOC104231909 [Nicotiana sylvestris]
Length=481

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHSPD
Sbjct  1    MCILIFVGTNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYAVIHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FMIAVGPA+VII+LMF+IRPVG
Sbjct  61   HASLIFMIAVGPAMVIIALMFIIRPVG  87



>ref|XP_008362108.1| PREDICTED: LOW QUALITY PROTEIN: probable transporter mch1 [Malus 
domestica]
Length=507

 Score =   154 bits (390),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+LIFVGTNGET+FNT ALVS VQNFPKSRGPVVGILKGFAGL GAILTQIY +IHS
Sbjct  23   WAMCILIFVGTNGETFFNTVALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQIYVMIHS  82

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            PDHASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  83   PDHASLIFMVAVGPAMVVIALMFIVRPVG  111


 Score = 45.4 bits (106),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  354  NFVGYGWVWLIITGRLPALPIWAMC  428
            N VGYGWVWL++TG  P+L +WAMC
Sbjct  2    NXVGYGWVWLVVTGXAPSLNLWAMC  26



>ref|XP_011007428.1| PREDICTED: probable transporter mch1 [Populus euphratica]
Length=479

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+G NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IHSPD
Sbjct  1    MCILIFIGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAMIHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  61   HASLIFMVAVGPAMVVIALMFIVRPVG  87



>gb|KDO63913.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=453

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+PD
Sbjct  3    MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPD  62

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  63   HANLIFMVAVGPAMVVIALMFIIRPVG  89



>gb|KDO63912.1| hypothetical protein CISIN_1g007654mg [Citrus sinensis]
Length=484

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAILTQ+YT+IH+PD
Sbjct  3    MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPD  62

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGPA+V+I+LMF+IRPVG
Sbjct  63   HANLIFMVAVGPAMVVIALMFIIRPVG  89



>gb|KDP46269.1| hypothetical protein JCGZ_10109 [Jatropha curcas]
Length=566

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C LIF+G NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+IHS
Sbjct  81   WAMCALIFIGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMIHS  140

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            P+HASL+FM+AVGPA+V+I+LMF++RPVG
Sbjct  141  PNHASLIFMVAVGPAMVVIALMFIVRPVG  169


 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +3

Query  177  VGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQN  356
            +GYLFGSISP+IKS++ YNQ+QL+SLGVAKDLGDSVGFLAG+LSEILPLW  LLVGV QN
Sbjct  1    MGYLFGSISPVIKSSLNYNQRQLASLGVAKDLGDSVGFLAGSLSEILPLWGALLVGVLQN  60

Query  357  FVGYGWVWLIITGRLPALPIWAMCSHI-CGNKW*DLF*YCG--SCLRGAKFPQKPWSCGG  527
             VGYGWVWL++TGR P LP+WAMC+ I  GN     F      SC++   FP+      G
Sbjct  61   LVGYGWVWLVVTGRAPVLPLWAMCALIFIGNNGETYFNTAALVSCVQ--NFPKSRGPVVG  118

Query  528  NTQGFC  545
              +GF 
Sbjct  119  ILKGFA  124



>ref|XP_002446302.1| hypothetical protein SORBIDRAFT_06g013870 [Sorghum bicolor]
 gb|EES10630.1| hypothetical protein SORBIDRAFT_06g013870 [Sorghum bicolor]
Length=146

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G+L E + +F +NRWLVFVA+MWVQ+ AG  Y+FG+IS ++K+++GY+Q+QL++LGVAK
Sbjct  1    MGKLAEGLTAFSTNRWLVFVAAMWVQSMAGTTYIFGAISTVLKASLGYDQRQLAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIW  419
            +LG  +G +AG LS   P W +L+VG AQNF+GYGW+WLI+TG+ PALP+W
Sbjct  61   NLGGCLGLVAGALSASQPAWVLLVVGAAQNFLGYGWLWLIVTGQAPALPLW  111



>ref|XP_001757080.1| predicted protein [Physcomitrella patens]
 gb|EDQ78311.1| predicted protein [Physcomitrella patens]
Length=566

 Score =   113 bits (282),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +W+  VA MWVQ  AG  Y+F   SP +KS + YNQ QL++LGVAKD+G++VG LAG 
Sbjct  10   ATKWVGLVAGMWVQASAGNAYMFSFYSPTLKSVLNYNQLQLNNLGVAKDIGENVGLLAGL  69

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            L   +P W +L +G    F GYG +WL+++ ++P LP W MC   C
Sbjct  70   LCNKVPAWTLLFIGALSGFFGYGTMWLVVSEQIPPLPYWQMCVIQC  115


 Score = 80.5 bits (197),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV+  +G+N  T+FNTA LV+ ++NFP SRG VVGILKG   LS AI  QIYT + + D
Sbjct  110  MCVIQCIGSNSTTWFNTAVLVTCMRNFPHSRGTVVGILKGLVALSAAIFAQIYTSLLTDD  169

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
               L+  + + P +V +  M  +RPV
Sbjct  170  TNMLLLFLTLVPTVVCLGSMAFVRPV  195



>ref|XP_006352868.1| PREDICTED: uncharacterized protein LOC102601846 [Solanum tuberosum]
Length=476

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTA LVS V+NFPKSRGPVVGILKGFAGL GAILTQIY +IHSPD
Sbjct  1    MCILIFVGTNGETYFNTATLVSCVRNFPKSRGPVVGILKGFAGLGGAILTQIYAVIHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FMIAV PA+VII+LMF+IRPVG
Sbjct  61   HASLIFMIAVAPAMVIIALMFIIRPVG  87



>gb|KJB76383.1| hypothetical protein B456_012G086100 [Gossypium raimondii]
 gb|KJB76386.1| hypothetical protein B456_012G086100 [Gossypium raimondii]
Length=483

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ PD
Sbjct  3    MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINFPD  62

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FMIAVGPA+V+I+LMF+IRPVG
Sbjct  63   QASLIFMIAVGPAMVVIALMFIIRPVG  89



>gb|EYU45416.1| hypothetical protein MIMGU_mgv1a006811mg [Erythranthe guttata]
Length=327

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTAALVS VQNFPKSRGP+VGILKGFAGL GAILTQ+Y +++SPD
Sbjct  10   MCILIFVGTNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLGGAILTQMYAVMNSPD  69

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGP +V I+LMF+IRPVG
Sbjct  70   HASLIFMVAVGPTMVAIALMFIIRPVG  96



>gb|KJB11690.1| hypothetical protein B456_001G272000 [Gossypium raimondii]
Length=480

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGLSGAILTQIYT+I+ PD
Sbjct  3    MCILIFVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYTMINFPD  62

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+AVGPA+V+++LMF+IRPVG
Sbjct  63   QAALIFMVAVGPAMVVVALMFIIRPVG  89



>gb|AFW60461.1| nodulin-like protein, mRNA [Zea mays]
 tpg|DAA48225.1| TPA: nodulin-like protein, mRNA [Zea mays]
Length=484

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAILTQIY ++HSPD
Sbjct  1    MCILIFIGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQIYAIVHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+AVGP +++I+LMF++RPVG
Sbjct  61   DAALIFMVAVGPTMIVIALMFIVRPVG  87



>ref|XP_006846932.1| hypothetical protein AMTR_s01570p00000230, partial [Amborella 
trichopoda]
 gb|ERN08513.1| hypothetical protein AMTR_s01570p00000230, partial [Amborella 
trichopoda]
Length=258

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIF+G NG+TY+NTA LVS VQNFPK RGP+VGILKGFAGLSGAILTQIYT+I++PD
Sbjct  7    MCVLIFIGANGKTYYNTATLVSCVQNFPKHRGPIVGILKGFAGLSGAILTQIYTMINTPD  66

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A L+FMIAVGPA+V+I+LMF +RPVG
Sbjct  67   DAVLIFMIAVGPAMVVIALMFFVRPVG  93



>gb|EAY83124.1| hypothetical protein OsI_38340 [Oryza sativa Indica Group]
 gb|EAZ20495.1| hypothetical protein OsJ_36102 [Oryza sativa Japonica Group]
Length=597

 Score =   100 bits (248),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  ASM V   +G  Y+F   S  ++ST+GYNQ+ L++L   KDLG +VG ++G +
Sbjct  26   SRWFVVFASMVVMAASGSTYIFALYSKELRSTLGYNQQTLNTLSFFKDLGTNVGVVSGLV  85

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G A N  GY  V+L +  R  A P+W MC +IC
Sbjct  86   QQVAPTWAVLLIGAAMNLAGYLMVYLALDRRTAAPPVWLMCVYIC  130


 Score = 87.8 bits (216),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV I VG N  T+ NT ALVS V+NFP+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  125  MCVYICVGANALTFSNTGALVSCVKNFPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  184

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  185  AKSLVLLIAWLPAAVYIFFVHTIR  208



>ref|NP_001066777.2| Os12g0484600 [Oryza sativa Japonica Group]
 gb|ABA98516.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA98517.1| nodulin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29796.2| Os12g0484600 [Oryza sativa Japonica Group]
Length=599

 Score =   100 bits (248),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  ASM V   +G  Y+F   S  ++ST+GYNQ+ L++L   KDLG +VG ++G +
Sbjct  28   SRWFVVFASMVVMAASGSTYIFALYSKELRSTLGYNQQTLNTLSFFKDLGTNVGVVSGLV  87

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G A N  GY  V+L +  R  A P+W MC +IC
Sbjct  88   QQVAPTWAVLLIGAAMNLAGYLMVYLALDRRTAAPPVWLMCVYIC  132


 Score = 87.4 bits (215),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV I VG N  T+ NT ALVS V+NFP+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  127  MCVYICVGANALTFSNTGALVSCVKNFPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  186

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  187  AKSLVLLIAWLPAAVYIFFVHTIR  210



>ref|XP_002967061.1| hypothetical protein SELMODRAFT_87151 [Selaginella moellendorffii]
 gb|EFJ31660.1| hypothetical protein SELMODRAFT_87151 [Selaginella moellendorffii]
Length=567

 Score =   107 bits (267),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            +WL   AS+W+Q  AG  Y F   SP +K+ + Y+Q +L++LGVAKD+G++VG + G LS
Sbjct  15   KWLGLAASIWIQAFAGNAYTFSHFSPRLKAVLHYSQIELNNLGVAKDIGENVGLITGYLS  74

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
              LP W +L +G  + F+GYG +WL+++ R+  LP W MC  IC
Sbjct  75   NKLPAWLILFIGGLEAFLGYGVLWLVVSERIAPLPYWQMCLAIC  118


 Score = 79.7 bits (195),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I +G N  T+FNTA LV+ ++NFP+SRG VVGILKGF GLSGAI TQ+YT     +
Sbjct  113  MCLAICIGANSATFFNTAVLVTTMRNFPQSRGTVVGILKGFVGLSGAIFTQLYTSFLFKN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
              SL+ +++  P  V ++ M  +RPV
Sbjct  173  PVSLLLLLSTSPFAVSVACMGFVRPV  198



>ref|XP_002960946.1| hypothetical protein SELMODRAFT_266544 [Selaginella moellendorffii]
 gb|EFJ38485.1| hypothetical protein SELMODRAFT_266544 [Selaginella moellendorffii]
Length=551

 Score =   107 bits (267),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            +WL   AS+W+Q  AG  Y F   SP +K+ + Y+Q +L++LGVAKD+G++VG + G LS
Sbjct  15   KWLGLAASIWIQAFAGNAYTFSHFSPRLKAVLHYSQIELNNLGVAKDIGENVGLITGYLS  74

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
              LP W +L +G  + F+GYG +WL+++ R+  LP W MC  IC
Sbjct  75   NKLPAWLILFIGGLEAFLGYGVLWLVVSERIAPLPYWQMCLAIC  118


 Score = 79.7 bits (195),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I +G N  T+FNTA LV+ ++NFP+SRG VVGILKGF GLSGAI TQ+YT     +
Sbjct  113  MCLAICIGANSATFFNTAVLVTTMRNFPQSRGTVVGILKGFVGLSGAIFTQLYTSFLFKN  172

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
              SL+ +++  P  V ++ M  +RPV
Sbjct  173  PVSLLLLLSTSPFAVSVACMGFVRPV  198



>gb|EMT08425.1| hypothetical protein F775_07944 [Aegilops tauschii]
Length=604

 Score =   101 bits (251),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  ASM V   +G  Y+F   S  ++S +GYNQ+ L++LG  KDLG +VG ++G +
Sbjct  23   SRWYVVFASMVVMAASGSTYIFALYSKELRSVLGYNQQTLNTLGFFKDLGTNVGVVSGLV  82

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G   N  GY  VWL +T R  A P+W MC ++C
Sbjct  83   QQVAPTWAVLLIGAGMNLAGYLMVWLALTERTAAPPVWLMCIYMC  127


 Score = 85.1 bits (209),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + VG N  T+ NT ALV+ V+NFP+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  122  MCIYMCVGANALTFSNTGALVACVKNFPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  181

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  182  AKSLVLLIAWLPAAVYIFFVHTIR  205



>ref|XP_010317535.1| PREDICTED: probable transporter mch1 isoform X2 [Solanum lycopersicum]
Length=487

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  409  CQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLI  588
            C   LCVLIF+GTNGETYFNT ALVS VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y + 
Sbjct  10   CLQKLCVLIFIGTNGETYFNTGALVSCVQNFPKSRGPIVGILKGFAGLSGAILTQVYAMF  69

Query  589  HSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            + PD ASLVFM+AVGP+IVI ++MFL+RPVG
Sbjct  70   NFPDQASLVFMVAVGPSIVITAVMFLVRPVG  100



>ref|XP_010485349.1| PREDICTED: uncharacterized protein LOC104763702 isoform X2 [Camelina 
sativa]
Length=468

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVG NGETYFNTA LVSGVQNFPKSRGPVVGILKGFAGL GAIL+Q+YT+IHS D
Sbjct  1    MCILIFVGNNGETYFNTATLVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHSSD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+AV P++V+I LMF IRPVG
Sbjct  61   RASLIFMVAVAPSVVVIPLMFFIRPVG  87



>ref|XP_004150375.1| PREDICTED: uncharacterized protein LOC101208506 [Cucumis sativus]
 ref|XP_004173310.1| PREDICTED: uncharacterized protein LOC101227399 [Cucumis sativus]
Length=607

 Score =   103 bits (256),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 76/136 (56%), Gaps = 4/136 (3%)
 Frame = +3

Query  45   KARKSTQDKVATIMVGRLKEKVNSFF----SNRWLVFVASMWVQTCAGVGYLFGSISPII  212
            +AR         I    L+    SFF    +  W +  AS  + + AG  Y+FG  S  I
Sbjct  8    RARDRGGSSSMEIERRSLRAITTSFFVEVLTGPWFMVFASFLIMSTAGTPYMFGLYSGAI  67

Query  213  KSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIIT  392
            KS +GY+Q  L+ +   KDLG +VG +AG ++EI+P W VL +G   NFVGY  +WL +T
Sbjct  68   KSVLGYDQSTLNLISFFKDLGTNVGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVT  127

Query  393  GRLPALPIWAMCSHIC  440
             ++ A P+W MC +IC
Sbjct  128  EKVAAPPVWLMCLYIC  143


 Score = 82.0 bits (201),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I +G N  ++ NT ALV+ V+N+P  RG V+GILKG+ GLSGAI+TQ Y  I+  D
Sbjct  138  MCLYICIGANSTSFANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDD  197

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA++++  +  IR
Sbjct  198  SKSLILLIAWLPAVILVVFLRTIR  221



>ref|XP_006653332.1| PREDICTED: uncharacterized protein LOC102716407 [Oryza brachyantha]
Length=642

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            +G++ E+  +F +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+Q+++LGVAK
Sbjct  1    MGKVGERWRAFSTNRWLVFVAAMWLQSMAGIGYLFGAISPVVKAALGYNQRQVAALGVAK  60

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVW  380
            DLGD VGFLAG+LS  LP WA+LL+G AQNF+GYGW+W
Sbjct  61   DLGDCVGFLAGSLSATLPAWAMLLIGAAQNFLGYGWLW  98


 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIFVGTNGETYFNTA+LV+ +QNFPKSRGP VGILKGFAGLS AILTQ+YT++H+PD
Sbjct  168  MCLLIFVGTNGETYFNTASLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLYTVLHTPD  227

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  228  HATLVFMVAVGPSLVAIGLMFVIRPVG  254



>ref|XP_008798934.1| PREDICTED: probable transporter mch1 [Phoenix dactylifera]
Length=482

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+LIF+G NGETYFNTAALVS VQNFPKSRGP+VGILKGFAGLSGAIL+QI+T+IH+ D
Sbjct  1    MCILIFLGNNGETYFNTAALVSCVQNFPKSRGPIVGILKGFAGLSGAILSQIFTMIHTSD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            H++L+FM+AVGP++V+ +LMF++RPVG
Sbjct  61   HSALIFMVAVGPSVVVTALMFIVRPVG  87



>ref|XP_008456537.1| PREDICTED: uncharacterized protein LOC103496460 [Cucumis melo]
Length=600

 Score =   103 bits (258),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 4/136 (3%)
 Frame = +3

Query  45   KARKSTQDKVATIMVGRLKEKVNSFF----SNRWLVFVASMWVQTCAGVGYLFGSISPII  212
            +AR         I    L+    SFF    +  W +  AS  V + AG  Y+FG  S  I
Sbjct  8    RARDRGGSSSMEIERRSLRAITTSFFVEVLTGPWFMVFASFLVMSTAGTPYMFGLYSGAI  67

Query  213  KSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIIT  392
            KS +GY+Q  L+ +   KDLG +VG +AG ++EI+P W VL +G   NFVGY  +WL +T
Sbjct  68   KSVLGYDQSTLNLISFFKDLGTNVGIIAGLIAEIMPPWVVLAIGAGMNFVGYFMIWLSVT  127

Query  393  GRLPALPIWAMCSHIC  440
             ++ A P+W MC +IC
Sbjct  128  EKVAAPPVWLMCLYIC  143


 Score = 81.3 bits (199),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I +G N  ++ NT ALV+ V+N+P  RG V+GILKG+ GLSGAI+TQ Y  I+  D
Sbjct  138  MCLYICIGANSTSFANTGALVTCVKNYPARRGAVLGILKGYVGLSGAIMTQFYHAIYGDD  197

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ ++A  PA++++  +  IR
Sbjct  198  SKSLILLLAWLPAVILVVFLRTIR  221



>ref|XP_009397027.1| PREDICTED: uncharacterized protein LOC103981971 [Musa acuminata 
subsp. malaccensis]
Length=597

 Score =   100 bits (248),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW +  AS  V + AG  Y+F   S  IK+++GYNQ+ L+++   KDLG +VG ++G L+
Sbjct  17   RWFMAFASFLVMSTAGATYIFAIYSKDIKTSLGYNQETLNTISFFKDLGANVGIVSGLLA  76

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            E+ P W +L +G A NF GY  ++L ITGRL    +W MC +IC
Sbjct  77   ELAPPWVILAMGAAMNFFGYLMIYLAITGRLAHTQVWQMCLYIC  120


 Score = 85.1 bits (209),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I VG N  T+ NTAALV+ V+NFP+SRG V+G+LKGF GLSGAI TQ+Y   +  D
Sbjct  115  MCLYICVGANSGTFANTAALVAAVKNFPESRGIVLGLLKGFVGLSGAIFTQLYLAFYGTD  174

Query  601  HASLVFMIAVGPAIVIISLMFL  666
              SLV +IA  PA   IS++FL
Sbjct  175  STSLVLLIAWLPA--AISVLFL  194



>ref|XP_003576191.1| PREDICTED: uncharacterized protein LOC100839547 [Brachypodium 
distachyon]
Length=596

 Score = 99.4 bits (246),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  ASM V   +G  Y+F   S  ++S +GYNQ+ L++LG  KDLG +VG ++G +
Sbjct  27   SRWYVVFASMVVMAASGSTYIFALYSKELRSVLGYNQQTLNTLGFFKDLGTNVGIVSGLV  86

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G A N  GY  V+L +T R  A P+W MC ++C
Sbjct  87   QQVAPTWAVLLIGAAMNLGGYLMVYLALTERTAAPPVWLMCIYMC  131


 Score = 85.1 bits (209),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + VG N  T+ NT ALV+ V+NFP+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  126  MCIYMCVGANALTFSNTGALVACVKNFPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  185

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  186  AKSLVLLIAWLPAAVYIFFVHTIR  209



>dbj|BAJ89452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score = 99.0 bits (245),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = +3

Query  108  VNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVG  287
            V     +RW V  ASM V   +G  Y+F   S  ++S +GYNQ+ L++LG  KDLG +VG
Sbjct  17   VGRVLRSRWYVVFASMVVMAASGSTYIFALYSKELRSVLGYNQQTLNTLGFFKDLGTNVG  76

Query  288  FLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++G + ++ P WAVLL+G   N  GY  V+L +T R  A P+W MC ++C
Sbjct  77   VVSGLVQQVAPTWAVLLIGAGMNLAGYLMVYLALTERTAAPPVWLMCIYMC  127


 Score = 85.1 bits (209),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + VG N  T+ NT ALV+ V+NFP+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  122  MCIYMCVGANALTFSNTGALVACVKNFPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  181

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  182  AKSLVLLIAWLPAAVYIFFVHTIR  205



>ref|XP_008441327.1| PREDICTED: uncharacterized protein LOC103485475 isoform X2 [Cucumis 
melo]
 ref|XP_008441328.1| PREDICTED: uncharacterized protein LOC103485475 isoform X2 [Cucumis 
melo]
Length=484

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVL+FVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY +IHSPD
Sbjct  1    MCVLVFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYAIIHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             A+L+FM+AVGPA+V I +MF IRPV 
Sbjct  61   SANLIFMVAVGPALVAIGVMFFIRPVA  87



>gb|KHN09928.1| Putative transporter MCH1 [Glycine soja]
Length=519

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +1

Query  385  SSPADFLPCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAI  564
            +S    LP  + +C LIFVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAI
Sbjct  34   TSQVPVLPV-WAMCALIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAI  92

Query  565  LTQIYTLIHSPDHASLVFMIAVGPAIVIISLMFLIRPVG  681
            LTQIY L HSP+ ASL+FM+AVGP++V I LMF++RPVG
Sbjct  93   LTQIYALFHSPNQASLIFMVAVGPSLVGIGLMFIVRPVG  131


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +3

Query  291  LAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            + G L EILP+W  LLVG A N VGYGWVWL++T ++P LP+WAMC+ I
Sbjct  1    MTGLLCEILPIWGALLVGAALNVVGYGWVWLVVTSQVPVLPVWAMCALI  49



>ref|XP_010086962.1| hypothetical protein L484_010108 [Morus notabilis]
 gb|EXB25241.1| hypothetical protein L484_010108 [Morus notabilis]
Length=488

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            LC+ I+VGTNGET+FNTA L+S VQNFPKSRGP+VGILKGFAGLSGAILTQ+Y +I++P+
Sbjct  13   LCICIYVGTNGETFFNTATLISCVQNFPKSRGPIVGILKGFAGLSGAILTQVYAMINAPN  72

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FMIAVGP++V+I+LMF++RPVG
Sbjct  73   EASLIFMIAVGPSMVVIALMFIVRPVG  99



>ref|XP_004962674.1| PREDICTED: uncharacterized protein LOC101763766 [Setaria italica]
Length=602

 Score =   100 bits (250),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  AS+ V   +G  Y+F   S +++S +GYNQ+ L+ L   KDLG +VG ++G +
Sbjct  21   SRWFVVFASIVVMAASGSTYIFALYSKVLRSKLGYNQETLNKLSFFKDLGTNVGIISGLV  80

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G   N  GY  ++L +TGR  A P+W MC +IC
Sbjct  81   QQVAPTWAVLLIGAGMNLAGYLMIYLALTGRTAAPPVWLMCFYIC  125


 Score = 79.7 bits (195),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C  I  G N  T+ NT ALV+ V+NFP+SRG V+G+LK F GLSGAI TQ+Y  I+  D
Sbjct  120  MCFYICFGANALTFSNTGALVACVKNFPESRGIVIGLLKSFVGLSGAIYTQLYLAIYGDD  179

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
             ASLV ++A  PA   I  ++ IR
Sbjct  180  AASLVLLVAWLPAAFNIFTVYTIR  203



>gb|KJB33995.1| hypothetical protein B456_006G042500 [Gossypium raimondii]
Length=452

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVG NGETYFNTAALVS V+NFPKSRGPVVGILKGFA LSGAILTQIYT+I+ PD
Sbjct  3    MCVLIFVGHNGETYFNTAALVSCVRNFPKSRGPVVGILKGFAALSGAILTQIYTMINFPD  62

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+A GP +V+ +LMF+IRPVG
Sbjct  63   QASLIFMVAFGPTMVVFALMFIIRPVG  89



>ref|XP_006604148.1| PREDICTED: uncharacterized protein LOC100796700 isoform X2 [Glycine 
max]
Length=527

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C LIFVGTNGETYFNT +LVS VQNFPKSRGPVVGILKGFAGLSGAILTQIY L H+P+
Sbjct  53   MCALIFVGTNGETYFNTVSLVSCVQNFPKSRGPVVGILKGFAGLSGAILTQIYALFHAPN  112

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
             ASL+FM+AVGP++V I LMF++RPVG
Sbjct  113  QASLIFMVAVGPSLVGIGLMFIVRPVG  139



>gb|EMS47359.1| hypothetical protein TRIUR3_13857 [Triticum urartu]
Length=482

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIFVGTNGETYFNT +LV+ +QNFPKSRGP VGILKGFAGLS AILTQ++ ++H+PD
Sbjct  2    MCVLIFVGTNGETYFNTTSLVTCIQNFPKSRGPTVGILKGFAGLSSAILTQLFAVMHTPD  61

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  62   HATLIFMVAVGPSLVAIGLMFVIRPVG  88



>ref|XP_002442137.1| hypothetical protein SORBIDRAFT_08g014860 [Sorghum bicolor]
 gb|EES15975.1| hypothetical protein SORBIDRAFT_08g014860 [Sorghum bicolor]
Length=590

 Score = 99.8 bits (247),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  AS+ V   +G  Y+F   S +++S +GYNQ+ L+ L   KDLG +VG ++G +
Sbjct  20   SRWFVVYASIIVMAASGSTYIFALYSKVLRSKLGYNQETLNKLSFFKDLGTNVGIISGLV  79

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P W VLL+G   N  GY  ++L +TGR  A P+W MC +IC
Sbjct  80   QQVAPTWVVLLIGAGMNLAGYLMIYLALTGRTAAPPVWLMCFYIC  124


 Score = 80.1 bits (196),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C  I  G N  T+ NT ALV+ V+NFP+SRG V+G+LK F GLSGAI TQ+Y  I+  D
Sbjct  119  MCFYICFGANALTFSNTGALVACVKNFPESRGIVIGLLKAFVGLSGAIYTQLYLAIYGDD  178

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
             ASLV ++A  PA   I  ++ IR
Sbjct  179  AASLVLLVAWLPAAFNIFTVYTIR  202



>gb|EPS63811.1| hypothetical protein M569_10970, partial [Genlisea aurea]
Length=531

 Score = 95.1 bits (235),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 63/108 (58%), Gaps = 0/108 (0%)
 Frame = +3

Query  114  SFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFL  293
            SF  N+W+  VAS+W+Q  +G  Y F   SPI+KST GY+Q  L ++ V KDLG ++G L
Sbjct  11   SFVDNKWVATVASIWIQCTSGSLYTFTVYSPILKSTQGYDQSTLDTVSVFKDLGANIGIL  70

Query  294  AGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            +G L      W  L  G  Q F GY  +WL +TG LP  P   MC ++
Sbjct  71   SGLLYTPAAPWRALFAGAVQCFAGYLLIWLTVTGALPPPPAAVMCFYM  118


 Score = 84.3 bits (207),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C  +F+  +  T+FNTA +VSGV NFP  RG +VGI+KGF GLSGA+L Q+Y  I   +
Sbjct  114  MCFYMFLAAHAMTFFNTADVVSGVHNFPNYRGVIVGIMKGFLGLSGAVLIQVYQTIFKNN  173

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
             AS + ++A+ P+I  I LM  +R
Sbjct  174  TASYILLLALLPSINAIVLMGFVR  197



>dbj|BAC83908.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 dbj|BAD31842.1| putative nodule-specific protein [Oryza sativa Japonica Group]
 gb|EAZ38960.1| hypothetical protein OsJ_23380 [Oryza sativa Japonica Group]
Length=624

 Score = 93.2 bits (230),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +3

Query  63   QDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQ  242
            Q+ +  I+      +V      RW    AS+ + T +G  Y+FG  SP +K+++GY+Q  
Sbjct  25   QNPLRVILTAAFARQVAV---GRWFTVFASLLILTASGATYIFGIYSPALKASLGYDQHT  81

Query  243  LSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWA  422
            L+++   KDLG ++G L+G ++E+ P W VL +G A N  GY  V+L + GR  A P+W 
Sbjct  82   LNTVSFFKDLGANLGVLSGLINEVTPPWVVLAIGAAMNLSGYLMVYLAVAGRTAAPPVWL  141

Query  423  MCSHI  437
            +C ++
Sbjct  142  VCLYV  146


 Score = 84.7 bits (208),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ +FVG N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y   +  D
Sbjct  142  VCLYVFVGANSQSFANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYLAFYGDD  201

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA V +  +  +R
Sbjct  202  AKSLILLIAWLPAAVSVVFVHTVR  225



>ref|XP_003522712.1| PREDICTED: uncharacterized protein LOC100813607 [Glycine max]
Length=544

 Score = 99.4 bits (246),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            ++WL  VA++W+Q  +G  Y F + S  +KS M   Q +L++L VAKD+G + G LAG  
Sbjct  9    SKWLGLVAAVWIQAISGNNYTFSNYSDALKSLMSLTQIELNNLSVAKDVGKAFGLLAGLA  68

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            S+  P WA+LL+G  Q  +GYG  WL+++ R+  LP W MC  +C
Sbjct  69   SDKFPTWAILLIGSLQGLIGYGVQWLVVSQRIQPLPYWQMCVFLC  113


 Score = 78.6 bits (192),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV + +G N  T+ NTA LV+ ++NF ++RGPV GILKGF GLS AI T + + + + D
Sbjct  108  MCVFLCIGGNSTTWMNTAVLVTCIRNFRRNRGPVSGILKGFVGLSTAIFTDLCSALFADD  167

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             AS + M+A+ P  V +S MF +R +
Sbjct  168  PASFLLMLALIPFAVCLSGMFFLREI  193



>gb|EAZ03041.1| hypothetical protein OsI_25182 [Oryza sativa Indica Group]
Length=623

 Score = 93.2 bits (230),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 73/125 (58%), Gaps = 3/125 (2%)
 Frame = +3

Query  63   QDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQ  242
            Q+ +  I+      +V      RW    AS+ + T +G  Y+FG  SP +K+++GY+Q  
Sbjct  25   QNPLRVILTAAFARQVAV---GRWFTVFASLLILTASGATYIFGIYSPALKASLGYDQHT  81

Query  243  LSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWA  422
            L+++   KDLG ++G L+G ++E+ P W VL +G A N  GY  V+L + GR  A P+W 
Sbjct  82   LNTVSFFKDLGANLGVLSGLINEVTPPWVVLAIGAAMNLSGYLMVYLAVAGRTAAPPVWL  141

Query  423  MCSHI  437
            +C ++
Sbjct  142  VCLYV  146


 Score = 85.1 bits (209),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ +FVG N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y   +  D
Sbjct  142  VCLYVFVGANSQSFANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYLAFYGDD  201

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA V +  +  +R
Sbjct  202  AKSLILLIAWLPAAVSVVFVHTVR  225



>gb|ABR18255.1| unknown [Picea sitchensis]
Length=626

 Score =   101 bits (251),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            +W+ FV ++WVQ  AG  Y F + S  +KS +  NQ QL++L VAKD+G + G +AG  S
Sbjct  16   KWVGFVTAIWVQAIAGNNYTFSNYSVALKSILDVNQVQLNNLSVAKDVGKAFGLVAGFAS  75

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            + LP W +LL+G  + F+GYG  WL+++ R+  LP W MC  +C
Sbjct  76   DYLPAWLILLIGSLEGFLGYGAQWLVLSQRIRPLPYWQMCIFLC  119


 Score = 76.3 bits (186),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF ++RGPVVGILKG+ GLS AI T + + + +  
Sbjct  114  MCIFLCMGGNSTTWMNTAVLVTCMRNFRRNRGPVVGILKGYIGLSTAIFTDLCSALFASS  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S V M+ + P IV ++ M  +RPV
Sbjct  174  PSSFVLMLTLIPGIVCVTSMIFLRPV  199



>ref|XP_003612193.1| hypothetical protein MTR_5g022380 [Medicago truncatula]
 gb|AES95151.1| MFS transporter [Medicago truncatula]
Length=537

 Score =   100 bits (250),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  111  NSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGF  290
            N+F + +WL FV ++WVQ   G  Y F + S ++KS M   Q QL+ L VAKD+G + G 
Sbjct  7    NNFAAEKWLGFVTAIWVQAICGNNYTFANYSDVLKSLMALTQMQLNDLSVAKDVGKAFGI  66

Query  291  LAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            L+G +S+  P  A+L++G    F+GYG  WL+++ R+  LP W MC  +C
Sbjct  67   LSGLVSDRWPTSAILIIGAIMGFIGYGAQWLVVSQRIAPLPYWLMCIFLC  116


 Score = 76.6 bits (187),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 1/83 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NFPK+RGP+ GILKG+ GLS AI T I T + S D
Sbjct  111  MCIFLCMGGNSSTWMNTAVLVTCMRNFPKNRGPISGILKGYVGLSTAIFTDICTALFSSD  170

Query  601  HASLVFMIAVGPAIV-IISLMFL  666
             +  + M+ + PAI+ +I+ +FL
Sbjct  171  PSKFLLMLTIVPAIICLIAAIFL  193



>ref|NP_001168963.1| uncharacterized protein LOC100382788 [Zea mays]
 gb|ACN31236.1| unknown [Zea mays]
Length=481

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI+VGTNGET+FNT ALV+ +QNFPKSRG  VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  2    MCVLIYVGTNGETFFNTTALVTCIQNFPKSRGQTVGIMKGFAGLSSAILTQLYAVMHTPD  61

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V I LMF+IRPVG
Sbjct  62   HATLVFMVAVGPSLVAIGLMFIIRPVG  88



>ref|XP_004249479.1| PREDICTED: uncharacterized protein LOC101244433 [Solanum lycopersicum]
Length=569

 Score = 91.3 bits (225),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            S RW +F AS+ + + AG  Y+FG  S  +K ++GY+Q  L+ LG  KDLG +VG ++G 
Sbjct  10   SGRWFMFFASILILSVAGGTYIFGLYSEEVKISLGYDQTTLNLLGFFKDLGANVGIISGL  69

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            ++EI P W V+L+G   NF GY  +WL +T +     +W MC
Sbjct  70   INEITPPWVVILLGAFMNFFGYFSIWLAVTKKFSNPKVWEMC  111


 Score = 85.9 bits (211),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C  IF+G N +T+ NT  +V+ V+NFP+SRG V+G+LKGF GLSGA+LTQ Y  
Sbjct  105  PKVWEMCFCIFIGANSQTFVNTGVIVTCVKNFPQSRGIVIGLLKGFVGLSGAVLTQFYHA  164

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIRPV  678
             +  D  SL+ +IA  P +V   L+ +IR +
Sbjct  165  FYGSDGKSLILLIAWLPTVVSCVLLRVIRAI  195



>ref|NP_001183397.1| hypothetical protein [Zea mays]
 ref|XP_008668552.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR36645.1| unknown [Zea mays]
 tpg|DAA38149.1| TPA: hypothetical protein ZEAMMB73_173755 [Zea mays]
Length=481

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV+IF+GTNG+TYF TA+LV+ +QNFPKSRGP VGILKGF GL+ AILTQ+YT++H+PD
Sbjct  1    MCVVIFIGTNGQTYFITASLVTSIQNFPKSRGPTVGILKGFMGLTSAILTQVYTVMHTPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  61   HAALIFMVAVGPSLVAIGLMFVIRPVG  87



>ref|XP_009606524.1| PREDICTED: uncharacterized protein LOC104100872 [Nicotiana tomentosiformis]
Length=568

 Score = 91.7 bits (226),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW +  AS+ + + AG  Y+FG  S  +K+++GY+Q  L+ LG  KDLG +VG ++G ++
Sbjct  12   RWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLGANVGIISGLIN  71

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            E+ P W VLL+G   NF GY  +WL  TG+L    +W MC
Sbjct  72   EVTPPWVVLLLGAIMNFSGYFSIWLATTGKLTKPKVWQMC  111


 Score = 84.7 bits (208),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C  IF+G N +T+ NT  LV+ V+NFP+SRG V+G+LKGF GLSGAILTQ+Y  
Sbjct  105  PKVWQMCFCIFIGANSQTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHA  164

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIR  672
             +  +  SL+ +IA  PA+V    + +IR
Sbjct  165  FYGNNGKSLILLIAWLPAVVSCVFLRVIR  193



>ref|XP_009783152.1| PREDICTED: uncharacterized protein LOC104231797 [Nicotiana sylvestris]
Length=568

 Score = 91.3 bits (225),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW +  AS+ + + AG  Y+FG  S  +K+++GY+Q  L+ LG  KDLG +VG ++G ++
Sbjct  12   RWFMVFASLLILSVAGGTYIFGLYSEEVKTSLGYDQTTLNLLGFFKDLGANVGIISGLIN  71

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            E+ P W VLL+G   NF GY  +WL  TG+L    +W MC
Sbjct  72   EVTPPWVVLLLGAFMNFSGYFSIWLATTGKLTKPKVWQMC  111


 Score = 84.7 bits (208),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C  IF+G N +T+ NT  LV+ V+NFP+SRG V+G+LKGF GLSGAILTQ+Y  
Sbjct  105  PKVWQMCFCIFIGANSQTFANTGVLVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHA  164

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIR  672
             +  +  SL+ +IA  PA+V    + +IR
Sbjct  165  FYGNNGKSLILLIAWLPAVVSCVFLRVIR  193



>ref|XP_003557448.1| PREDICTED: uncharacterized protein LOC100822987 [Brachypodium 
distachyon]
Length=626

 Score = 90.1 bits (222),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
             RW    AS  + T +G  Y+FG  S  +KS++GY+Q+ L+++   KDLG ++G  +G +
Sbjct  33   GRWFTVFASFAILTASGATYIFGIYSKTLKSSLGYDQQTLNTISFFKDLGANLGVFSGLI  92

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            +E+ P W VL +G A N VGY  V+L + GR    P+W +C +I
Sbjct  93   NEVTPPWVVLAIGAAMNLVGYLMVYLAVDGRTSRPPVWLVCLYI  136


 Score = 85.9 bits (211),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ IFVG N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y  ++  D
Sbjct  132  VCLYIFVGANSQSFANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLALYGDD  191

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA + +  +  IR
Sbjct  192  AKSLILLIAWLPAAISVVFVHTIR  215



>ref|XP_008662107.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=486

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLI+VGTNGET+FNT ALV+ +QNFPKSRG  VGI+KGFAGLS AILTQ+Y ++H+PD
Sbjct  7    MCVLIYVGTNGETFFNTTALVTCIQNFPKSRGQTVGIMKGFAGLSSAILTQLYAVMHTPD  66

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+LVFM+AVGP++V + LMF+IRPVG
Sbjct  67   HATLVFMVAVGPSLVALGLMFIIRPVG  93



>ref|XP_008668551.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=522

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV+IF+GTNG+TYF TA+LV+ +QNFPKSRGP VGILKGF GL+ AILTQ+YT++H+PD
Sbjct  42   MCVVIFIGTNGQTYFITASLVTSIQNFPKSRGPTVGILKGFMGLTSAILTQVYTVMHTPD  101

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HA+L+FM+AVGP++V I LMF+IRPVG
Sbjct  102  HAALIFMVAVGPSLVAIGLMFVIRPVG  128



>ref|XP_006339087.1| PREDICTED: uncharacterized protein LOC102587756 [Solanum tuberosum]
Length=569

 Score = 89.4 bits (220),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW +F AS+ + + AG  Y+FG  S  +K ++GY+Q  L+ LG  KDLG +VG ++G ++
Sbjct  12   RWFMFFASILILSVAGGTYIFGLYSEEVKISLGYDQTTLNLLGFFKDLGANVGIISGLIN  71

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMC  428
            E+ P W V+L+G   NF GY  +WL +T +     +W MC
Sbjct  72   EVTPPWVVILLGAFMNFFGYFSIWLAVTKKFSNPKVWEMC  111


 Score = 86.3 bits (212),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C  IF+G N +T+ NT  +V+ V+NFP+SRG V+G+LKGF GLSGAILTQ+Y  
Sbjct  105  PKVWEMCFCIFIGANSQTFVNTGVIVTCVKNFPESRGIVIGLLKGFVGLSGAILTQLYHA  164

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIRPV  678
             +  D  SL+ +IA  P +V   L+ +IR +
Sbjct  165  FYGSDGKSLILLIAWLPTVVSCVLLRVIRTM  195



>gb|EPS72388.1| hypothetical protein M569_02370, partial [Genlisea aurea]
Length=516

 Score =   102 bits (254),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            S +WL  VA++WVQ+ +G  Y F + S  +K  M   Q QL++L VAKD+G + G LAG 
Sbjct  3    SGKWLGLVAAIWVQSISGNNYTFSNYSDALKLIMALTQLQLNTLSVAKDVGKAFGLLAGI  62

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ L   A+LL+G  + FVGYG  WL+++GR+P LP W MC  +C
Sbjct  63   ASDRLSTPAILLIGSIEGFVGYGAQWLVVSGRIPPLPYWTMCIFMC  108


 Score = 73.2 bits (178),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKGF GLS AI T + + + S D
Sbjct  103  MCIFMCMGGNSTTWMNTAVLVTCIRNFRKNRGPVSGILKGFVGLSTAIFTDLCSALFSSD  162

Query  601  HASLVFMIAVGPAIVIISLMFLIRP  675
             A  + M+A+ P  V ++ +  +R 
Sbjct  163  PAKFLLMLAIVPFFVCLTAVAFLRE  187



>ref|XP_010673913.1| PREDICTED: uncharacterized protein LOC104890215 [Beta vulgaris 
subsp. vulgaris]
Length=598

 Score =   102 bits (253),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 66/104 (63%), Gaps = 1/104 (1%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW +   S+ +   +G GY+FG  S  IKS+MGY+Q  L+ L   KD+G +VG  +G ++
Sbjct  27   RWFMAFGSILIMAMSGSGYMFGLFSNNIKSSMGYDQATLNLLSFFKDMGSNVGVFSGLIN  86

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            EI P W VL +G   NF GY  +WL +TGRL  +P+W MC +IC
Sbjct  87   EITPPWVVLFIGALMNF-GYVMIWLAVTGRLKGVPVWQMCLYIC  129


 Score = 73.2 bits (178),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ I +G + +++ NT  LV+ V+NFP+SRG V+G+LKG+ GLSGAILTQ+Y   +  +
Sbjct  124  MCLYICIGADSQSFANTGGLVTCVKNFPESRGIVLGLLKGYVGLSGAILTQLYHTFYGNN  183

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
               L+  IA  PA V I  +  IR
Sbjct  184  SKGLILFIAWLPAAVSIIFLPTIR  207



>ref|XP_006367793.1| PREDICTED: uncharacterized protein LOC102602269 [Solanum tuberosum]
Length=541

 Score =   102 bits (255),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FVA++WVQ  +G  Y F + S  +KS M   Q QL++L VAKD+G + G  AG 
Sbjct  11   ARKWLGFVAAVWVQAISGNNYTFSNYSDALKSLMSLTQLQLNNLSVAKDVGKAFGIFAGL  70

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP  A+LL+G  + F+GYG  WL+++GR+  LP W MC  +C
Sbjct  71   ASDRLPTPAILLIGSIEGFIGYGVQWLVVSGRIQPLPYWVMCIFLC  116


 Score = 72.4 bits (176),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T I + + + D
Sbjct  111  MCIFLCMGGNSTTWMNTAILVTCIRNFRKNRGPVSGILKGYVGLSTAIFTDICSALFAND  170

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S + ++AV P +V  + +  +R +
Sbjct  171  PSSFLLLLAVVPFVVCFTAVLFLREI  196



>ref|XP_007046677.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX90834.1| Major facilitator superfamily protein [Theobroma cacao]
Length=544

 Score = 92.8 bits (229),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (62%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  FSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAG  299
            ++ +WL  V ++WVQ   G  Y F + S  +KS M   Q +L++L VAKD+G + G L+G
Sbjct  9    YAGKWLGLVTAIWVQAICGNNYTFANYSDALKSLMALTQLELNNLSVAKDVGKAFGLLSG  68

Query  300  TLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
              S+ LP   +L++G  + F+GYG  WL+++ R+  LP W MC  +C
Sbjct  69   FASDCLPTSVLLIIGSLEGFIGYGVQWLVVSQRIRPLPYWQMCIFLC  115


 Score = 82.0 bits (201),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NFPK+RGPV GILKG+ GLS AI T I T + S D
Sbjct  110  MCIFLCLGGNSTTWMNTAVLVTCMRNFPKNRGPVSGILKGYVGLSTAIFTDICTALFSSD  169

Query  601  HASLVFMIAVGPAIVIISLMFLIRP  675
             ++ +F++AV PA+V ++ +F +  
Sbjct  170  PSTFLFILAVVPAVVCLTAVFFLHE  194



>emb|CDM84956.1| unnamed protein product [Triticum aestivum]
Length=624

 Score = 89.7 bits (221),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 0/103 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS  + T +G  Y+FG  S  +KS++GYNQ+ L+++   KDLG ++G  +G ++
Sbjct  38   RWFTVFASFAILTASGATYIFGIYSKTLKSSLGYNQQTLNTISFFKDLGANLGVFSGLIN  97

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            E+ P W VL +G   N VGY  V+L + GR    P+W +C +I
Sbjct  98   EVTPPWVVLAIGATMNLVGYLMVYLAVDGRTARPPVWLVCLYI  140


 Score = 84.7 bits (208),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ IF+G N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y   +  D
Sbjct  136  VCLYIFIGANSQSFANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLAFYGDD  195

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA + +  +  IR
Sbjct  196  TKSLILLIAWLPAAISVVFVHTIR  219



>ref|XP_004248658.1| PREDICTED: probable transporter mch1 [Solanum lycopersicum]
Length=533

 Score =   102 bits (254),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FVA++WVQ  +G  Y F + S  +KS M   Q QL++L VAKD+G + G  AG 
Sbjct  11   ARKWLGFVAAVWVQAISGNNYTFSNYSHALKSLMSLTQLQLNNLSVAKDVGKAFGIFAGL  70

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP  A+LL+G  + F+GYG  WL+++GR+  LP W MC  +C
Sbjct  71   ASDRLPTPAILLIGSIEGFIGYGVQWLVVSGRIQPLPYWVMCIFLC  116


 Score = 72.4 bits (176),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T I + + + D
Sbjct  111  MCIFLCMGGNSTTWMNTAILVTCIRNFRKNRGPVSGILKGYVGLSTAIFTDICSALFAND  170

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             +S + ++AV P +V  + +  +R +
Sbjct  171  PSSFLLLLAVVPFVVCFTAVLFLREI  196



>ref|XP_010246855.1| PREDICTED: probable transporter mch1 [Nelumbo nucifera]
Length=547

 Score = 97.1 bits (240),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FV ++W+Q  +G  Y F + S  +KS MG  Q QL++L VAKD+G + G ++G 
Sbjct  12   AGKWLGFVTAVWIQAISGNNYTFSNYSDALKSLMGLTQLQLNNLSVAKDVGKAFGLVSGL  71

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP   +LL+G  + F+GYG  WL+++ R+  LP W MC  +C
Sbjct  72   ASDRLPTSIILLIGSVEGFIGYGVQWLVVSQRIRPLPYWQMCIFLC  117


 Score = 77.4 bits (189),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T I T + S D
Sbjct  112  MCIFLCMGGNSTTWMNTAVLVTCMRNFRKNRGPVSGILKGYVGLSTAIFTDICTAVFSAD  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ++ + M+A+ PA+V  + +  +R V
Sbjct  172  PSTFILMLAIIPALVCFTGVLFLREV  197



>dbj|BAJ90449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score = 89.4 bits (220),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 0/103 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS  + T +G  Y+F   S  +KS++GYNQ+ L+++   KDLG ++G  +G ++
Sbjct  38   RWFTVFASFAILTASGATYIFSIYSKTLKSSLGYNQQTLNTISFFKDLGANLGVFSGLIN  97

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            E+ P W VL +G A N VGY  V+L + GR    P+W +C +I
Sbjct  98   EVTPPWVVLAIGAAMNLVGYLMVYLAVDGRTARPPVWLVCLYI  140


 Score = 84.7 bits (208),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ IF+G N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y   +  D
Sbjct  136  VCLYIFIGANSQSFANTGALVTCVKNFPESRGIVLGILKGFVGLSGAVYTQLYLAFYGDD  195

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA + +  +  IR
Sbjct  196  TKSLILLIAWLPAAISVVFVHTIR  219



>ref|XP_010266799.1| PREDICTED: probable transporter mch1 [Nelumbo nucifera]
Length=549

 Score = 97.4 bits (241),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FV ++W+Q  +G  Y F + S  +KS M   Q QL++L VAKD+G + G LAG 
Sbjct  12   AGKWLGFVTAVWIQAISGNNYTFSNYSDALKSLMALTQLQLNNLSVAKDVGKAFGLLAGL  71

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP   +LL+G  + F+GYG  WL+I+ R+  LP W MC  +C
Sbjct  72   ASDRLPTSVLLLIGSVEGFIGYGVQWLVISQRIRPLPYWQMCIFLC  117


 Score = 75.9 bits (185),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T + T + S D
Sbjct  112  MCIFLCMGGNSTTWMNTAVLVTCIRNFRKNRGPVSGILKGYVGLSTAIFTDLCTALFSAD  171

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             ++ V M+++ PA+V  + +  +R V
Sbjct  172  PSTFVLMLSIIPALVCFTGILFLREV  197



>ref|XP_010550225.1| PREDICTED: uncharacterized protein LOC104821135 isoform X2 [Tarenaya 
hassleriana]
Length=476

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CVLIF+G NGETYFNTAALVS VQNFPKSRGPVVGILKGFAGL GAIL+QIYT+IHSPD
Sbjct  1    MCVLIFIGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILSQIYTMIHSPD  60

Query  601  HASLVFMIAVGPAIVIISLMFLIRPVG  681
            HASL+FM+AVGPA+V+++LMF IRPVG
Sbjct  61   HASLIFMVAVGPAVVVVALMFFIRPVG  87



>ref|XP_008680679.1| PREDICTED: uncharacterized protein LOC103655757 [Zea mays]
Length=503

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  153  MWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAV  332
            MW+Q+ AG+ YLFG+ISP++K+ +GYNQ Q+++LGVAKDLGD VGFLAG+LS +LP WA+
Sbjct  1    MWLQSMAGIRYLFGAISPVMKAALGYNQCQVAALGVAKDLGDCVGFLAGSLSVVLPSWAM  60

Query  333  LLVGVAQNFVGYGWVWLIITGRLPALPIWAM  425
            LL+G AQNF+GYGW+WLI+T + PALP+W +
Sbjct  61   LLIGSAQNFLGYGWLWLIVTRQAPALPLWML  91



>ref|XP_006658348.1| PREDICTED: uncharacterized protein LOC102709579 [Oryza brachyantha]
Length=338

 Score = 88.2 bits (217),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS+ + T +G  Y+FG  S  +K  +GY+Q+ L+++   KDLG ++G L+G ++
Sbjct  36   RWFTGFASLLILTASGATYIFGIYSRALKEALGYDQRTLNTVSFFKDLGANLGVLSGLIN  95

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHI  437
            E+ P W VL +G A N  GY  V+L + GR  A P+W +C ++
Sbjct  96   EVTPPWVVLAIGAAMNLSGYLMVYLAVAGRTGAPPVWLVCLYV  138


 Score = 85.1 bits (209),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ +FVG N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y   +  D
Sbjct  134  VCLYVFVGANSQSFANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYLAFYGDD  193

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SL+ +IA  PA V +  +  IR
Sbjct  194  AKSLILLIAWLPAAVSVVFVHTIR  217



>ref|XP_011092895.1| PREDICTED: probable transporter mch1 [Sesamum indicum]
Length=541

 Score = 99.0 bits (245),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FV ++WVQ  +G  Y F + S  +KS MG  Q QL+SL VAKD+G + G LAG 
Sbjct  11   AGKWLGFVTAVWVQAISGNNYTFSNYSDALKSLMGLTQLQLNSLSVAKDVGKAFGLLAGL  70

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP   +LL+G  + F+GYG  WL+++ R+  LP WAM   +C
Sbjct  71   ASDRLPTPVILLIGSIEGFIGYGVQWLVVSRRIQPLPYWAMSIFLC  116


 Score = 73.2 bits (178),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + + + + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T I + + +
Sbjct  109  WAMSIFLCMGGNSTTWMNTAILVTCIRNFRKNRGPVSGILKGYVGLSTAIFTDICSALFA  168

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPV  678
             D A  + M+A+ P +V ++ +F +R +
Sbjct  169  DDPAKFLLMLAIVPFVVCLTAIFFLREI  196



>ref|XP_010935083.1| PREDICTED: probable transporter mch1 [Elaeis guineensis]
Length=540

 Score = 95.5 bits (236),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (63%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RWL FV ++WVQ  +G  Y F + S  +KS MG  Q +L++L VAKD+G + G LAG  S
Sbjct  13   RWLGFVTAVWVQCISGNNYTFSNYSRALKSLMGLTQLELNNLSVAKDVGKAFGLLAGLAS  72

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            + L    +LL+G  + F+GYG  WL++   +P LP W MC  +C
Sbjct  73   DRLSTPLILLIGSLEGFIGYGAQWLVVRRSIPPLPYWQMCVFLC  116


 Score = 76.3 bits (186),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV + +G N  T+ NTA LV+ ++NF ++RGPV GILKG+ GLS AI T   + +   D
Sbjct  111  MCVFLCLGGNSTTWMNTAVLVTCMRNFRRNRGPVSGILKGYVGLSTAIFTDFLSALFGDD  170

Query  601  HASLVFMIAVGPAIVIISLMFLIRP  675
             A+ + M+AV PA V  + MF +R 
Sbjct  171  PAAFLLMLAVVPAAVCTAAMFFLRE  195



>gb|AFW81675.1| putative xylose isomerase family protein [Zea mays]
Length=561

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            +NRWLVFVA+MW+Q+ AG+GYLFG+ISP++K+ +GYNQ+Q+++LGVAKDLGD VGFLAG+
Sbjct  477  ANRWLVFVAAMWLQSMAGIGYLFGAISPVMKAALGYNQRQVAALGVAKDLGDCVGFLAGS  536

Query  303  LSEILPLWAVLLVGVAQNFVGYGWV  377
            LS +LP WA+LL+G AQNF+GY W+
Sbjct  537  LSAVLPSWAMLLIGSAQNFLGYSWL  561



>ref|XP_009379410.1| PREDICTED: uncharacterized protein LOC103967826 [Pyrus x bretschneideri]
Length=539

 Score = 95.9 bits (237),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FV ++WVQ  +G  Y F + S  +KS M  +Q QL++L VAKD+G + G L+G 
Sbjct  12   AGKWLGFVTAIWVQAISGNNYTFSNYSGALKSLMELSQTQLNTLSVAKDVGKAFGLLSGL  71

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP  A+L+VG  +  +GYG  WL+++ R+  LP W MC  +C
Sbjct  72   ASDRLPTSAILIVGALEGLIGYGVQWLVVSQRISPLPYWQMCIFMC  117


 Score = 75.1 bits (183),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T + T + S +
Sbjct  112  MCIFMCMGGNSTTWMNTAVLVTCMRNFTKNRGPVSGILKGYVGLSTAIFTDLCTALFSSN  171

Query  601  HASLVFMIAVGPAIV-IISLMFL  666
             +  +FM+AV PA++ +I+ +FL
Sbjct  172  PSKFLFMLAVVPAVICLIATLFL  194



>tpg|DAA42500.1| TPA: nitrate and chloride transporter [Zea mays]
Length=609

 Score = 89.4 bits (220),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  120  FSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAG  299
             + RWL   AS+ +   +G  Y+FGS S  +KS++GY+Q+ L+++   KDLG ++G  +G
Sbjct  32   LAGRWLTVFASLLIMASSGATYIFGSYSGTLKSSLGYDQRTLNTVSFFKDLGANLGVFSG  91

Query  300  TLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSH  434
             ++E+ P W VL +G A N  GY  V+L ++GR    P+W +C +
Sbjct  92   LINEVTPPWVVLAMGAAMNLSGYLMVYLAVSGRTAPPPLWLVCLY  136


 Score = 81.3 bits (199),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+  FVG N +++ NT ALV+ V+NFP SRG V+GILKGF GLSGA+ TQ+Y  ++  D
Sbjct  133  VCLYFFVGANSQSFANTGALVTCVKNFPDSRGVVLGILKGFVGLSGAVYTQLYLALYGGD  192

Query  601  HA-SLVFMIAVGPAIVIISLMFLIR  672
             A SL+ ++A  PA V +  +  IR
Sbjct  193  DAESLILLVAWLPAAVSVVFVHTIR  217



>ref|XP_002461592.1| hypothetical protein SORBIDRAFT_02g005120 [Sorghum bicolor]
 gb|EER98113.1| hypothetical protein SORBIDRAFT_02g005120 [Sorghum bicolor]
Length=661

 Score = 87.8 bits (216),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = +3

Query  24   STSQRKIKARKSTQDKVATIMVGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSIS  203
            S S     A   + + +  I+  R   +V      RW    AS+ +   +G  Y+FGS S
Sbjct  6    SGSSSPATAPPPSGNPLGVILTRRFARQV---LLGRWFTVFASLLIMAASGATYIFGSYS  62

Query  204  PIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWL  383
              +KS++GY+Q+ L+++   KDLG ++G  +G ++E+ P W VL +G   N  GY  V+L
Sbjct  63   GTLKSSLGYDQRTLNTVSFFKDLGANLGVFSGLINEVTPPWVVLAMGAGMNLFGYLMVYL  122

Query  384  IITGRLPALPIWAMC  428
             ++GR    P+W +C
Sbjct  123  AVSGRTSRPPLWLVC  137


 Score = 82.8 bits (203),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+  FVG+N +++ NT ALV+ V+NFP+SRG V+GILKGF GLSGA+ TQ+Y  ++  D
Sbjct  136  VCLYFFVGSNSQSFANTGALVTCVKNFPESRGVVLGILKGFVGLSGAVYTQLYQALYGGD  195

Query  601  HA-SLVFMIAVGPAIVIISLMFLIR  672
             A SL+ +IA  PA V +  +  IR
Sbjct  196  DAESLILLIAWLPAAVSVVFVHTIR  220



>ref|NP_001152028.1| nitrate and chloride transporter [Zea mays]
 gb|ACG45446.1| nitrate and chloride transporter [Zea mays]
Length=600

 Score = 89.4 bits (220),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (64%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RWL   AS+ +   +G  Y+FGS S  +KS++GY+Q+ L+++   KDLG ++G  +G ++
Sbjct  35   RWLTVFASLLIMASSGATYIFGSYSGTLKSSLGYDQRTLNTVSFFKDLGANLGVFSGLIN  94

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSH  434
            E+ P W VL +G A N  GY  V+L ++GR    P+W +C +
Sbjct  95   EVTPPWVVLAMGAAMNLSGYLMVYLAVSGRTAPPPLWLVCLY  136


 Score = 81.3 bits (199),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C+  FVG N +++ NT ALV+ V+NFP SRG V+GILKGF GLSGA+ TQ+Y  ++  D
Sbjct  133  VCLYFFVGANSQSFANTGALVTCVKNFPDSRGVVLGILKGFVGLSGAVYTQLYLALYGGD  192

Query  601  HA-SLVFMIAVGPAIVIISLMFLIR  672
             A SL+ ++A  PA V +  +  IR
Sbjct  193  DAESLILLVAWLPAAVSVVFVHTIR  217



>ref|XP_004230920.1| PREDICTED: uncharacterized protein LOC101255930 [Solanum lycopersicum]
Length=554

 Score = 88.6 bits (218),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  117  FFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLA  296
            FF+ RW    AS+ + + +G  YLFG  S  +KS++GY+Q  L+ L   KD+G +VG +A
Sbjct  17   FFNGRWFTAFASILILSVSGGTYLFGLYSQHVKSSLGYDQTTLNLLSFFKDVGANVGIIA  76

Query  297  GTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALP-IWAMC  428
            G ++E+ P W VLL+G   NF GY ++WL + G     P +W MC
Sbjct  77   GLINEVCPPWVVLLIGSLMNFSGYIYLWLAVNGDELVKPQVWQMC  121


 Score = 81.6 bits (200),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +C+ + +G N +T+ NT ALV+ V+NFP+SRG V+G+LKGF GLSGAI+TQ++  
Sbjct  115  PQVWQMCLCLMIGANSQTFTNTGALVTCVKNFPESRGIVIGLLKGFVGLSGAIITQLFHA  174

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIR  672
            I+  +  SLV +IA  P  V  +L+  +R
Sbjct  175  IYGNNGKSLVLLIAWLPPFVCCALLRYVR  203



>emb|CAN82898.1| hypothetical protein VITISV_026994 [Vitis vinifera]
Length=599

 Score = 86.3 bits (212),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS  V    G  YLFG  S  IKS +GY+Q  L+ LG  KD+G ++G  AG ++
Sbjct  32   RWFSVCASFLVMIGPGTTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGTNIGVPAGLVA  91

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSH  434
            E+ P W VLL+G A N  GY  +WL +T R+    +W MC +
Sbjct  92   EVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVY  133


 Score = 83.6 bits (205),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +CV  FVG+N + + NT ALV+ V+NFP+SRG ++G+LKGF GL GAI+TQ Y  
Sbjct  125  PKVWHMCVYNFVGSNSQNFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFA  184

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIR  672
            I+  D  +L+ M+   PA + +  ++ IR
Sbjct  185  IYGDDSKALILMVGWFPAALCVIFVYTIR  213



>ref|XP_004505781.1| PREDICTED: uncharacterized membrane protein YMR155W-like [Cicer 
arietinum]
Length=546

 Score = 97.8 bits (242),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +3

Query  123  SNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGT  302
            + +WL FVA++W+Q  +G  Y F + S  +KS M   Q +L++L VAKD+G + G LAG 
Sbjct  14   ATKWLGFVAALWIQAISGNNYTFSNYSDALKSLMHLTQTELNNLSVAKDVGKAFGLLAGL  73

Query  303  LSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             S+ LP WA+LL+G  +  +GYG  WL++   +  LP W MC  +C
Sbjct  74   ASDRLPTWAILLIGSFEGLIGYGVQWLVVGQIIQPLPYWQMCVFLC  119


 Score = 72.0 bits (175),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +CV + +G N  T+ NTA LV+ ++NF ++RGPV GILKG+ GLS AI T + + + S D
Sbjct  114  MCVFLCMGGNSTTWMNTAVLVTCIRNFRRNRGPVSGILKGYVGLSTAIFTNLCSALFSED  173

Query  601  HASLVFMIAVGPAIVIISLMFLIRPV  678
             A  +  +A+ P IV ++ +F +R V
Sbjct  174  PAFFLLTLALIPFIVCLTGVFFLREV  199



>ref|XP_009622121.1| PREDICTED: probable transporter mch1 [Nicotiana tomentosiformis]
Length=543

 Score = 98.2 bits (243),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            +WL FVA++WVQ  +G  Y F + S  +KS M   Q QL++L VAKD+G + G LAG  S
Sbjct  13   KWLGFVAAVWVQAISGNNYTFSNYSDALKSLMALTQLQLNNLSVAKDVGKAFGILAGLAS  72

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            + L    +LL+G  + F+GYG  WL+++G +  LP WAMC  +C
Sbjct  73   DRLSTPVILLIGSIEGFIGYGVQWLVVSGTIKPLPYWAMCIFLC  116


 Score = 71.2 bits (173),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +1

Query  415  YGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHS  594
            + +C+ + +G N  T+ NTA LV+ ++NF K+RGPV GILKG+ GLS AI T I + + +
Sbjct  109  WAMCIFLCMGGNSTTWMNTAILVTCIRNFRKNRGPVTGILKGYVGLSTAIFTDICSALFA  168

Query  595  PDHASLVFMIAVGPAIVIISLMFLIRPV  678
             D ++ + ++AV P  V ++ +  +R +
Sbjct  169  SDPSTFLLLLAVVPFAVCLTAIVFLREI  196



>ref|XP_006664561.1| PREDICTED: uncharacterized protein LOC102703921 [Oryza brachyantha]
Length=587

 Score = 87.4 bits (215),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 9/105 (9%)
 Frame = +3

Query  126  NRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTL  305
            +RW V  AS          Y+F   S  ++S +GYNQ+ L++L   KDLG +VG ++G +
Sbjct  26   SRWFVVFAST---------YIFALYSKELRSALGYNQQTLNTLSFFKDLGTNVGVVSGLV  76

Query  306  SEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
             ++ P WAVLL+G A N  GY  ++L +  R  A P+W MC++IC
Sbjct  77   QQVAPTWAVLLIGAAMNLAGYLMIYLALERRTAAPPVWLMCAYIC  121


 Score = 82.0 bits (201),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  421  LCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTLIHSPD  600
            +C  I VG N  T+ NT ALVS V+N P+SRG V+G+LKGF GLSGAI TQ+Y  I+  D
Sbjct  116  MCAYICVGANALTFSNTGALVSCVKNSPESRGIVIGLLKGFVGLSGAIYTQLYLAIYGDD  175

Query  601  HASLVFMIAVGPAIVIISLMFLIR  672
              SLV +IA  PA V I  +  IR
Sbjct  176  ARSLVLLIAWLPAAVYIFFVHTIR  199



>emb|CBI17146.3| unnamed protein product [Vitis vinifera]
Length=1107

 Score = 85.5 bits (210),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS  V    G  YLFG  S  IKS +GY+Q  L+ LG  KD+G ++G  AG ++
Sbjct  563  RWFSVCASFLVMIGPGSTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGTNIGVPAGLVA  622

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSH  434
            E+ P W VLL+G A N  GY  +WL +T R+    +W MC +
Sbjct  623  EVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVY  664


 Score = 84.0 bits (206),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +CV  FVG+N + + NT ALV+ V+NFP+SRG ++G+LKGF GL GAI+TQ Y  
Sbjct  656  PKVWHMCVYNFVGSNSQNFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFA  715

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIRPV  678
            I+  D  +L+ M+   PA + +  ++ IR +
Sbjct  716  IYGDDSKALILMVGWFPAALCVIFVYTIRTM  746


 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 3/118 (3%)
 Frame = +3

Query  87   VGRLKEKVNSFFSNRWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAK  266
            VGR    V      RW    AS  +   AG  YLFG  S  IKS+MGY+Q  L+ +G  K
Sbjct  99   VGRFAVHV---IRGRWFSVYASFLIMVGAGATYLFGIYSKEIKSSMGYDQSTLNLIGFFK  155

Query  267  DLGDSVGFLAGTLSEILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSHIC  440
            DLG +VG  AG ++E+ P W VLLVG A NF G+  +WL +TG++    +W +C++IC
Sbjct  156  DLGANVGVPAGLIAEVTPTWFVLLVGSALNFSGFFMIWLAVTGQIAKPKVWQICAYIC  213



>ref|XP_002273103.2| PREDICTED: uncharacterized protein LOC100249900 [Vitis vinifera]
Length=599

 Score = 85.5 bits (210),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  RWLVFVASMWVQTCAGVGYLFGSISPIIKSTMGYNQKQLSSLGVAKDLGDSVGFLAGTLS  308
            RW    AS  V    G  YLFG  S  IKS +GY+Q  L+ LG  KD+G ++G  AG ++
Sbjct  32   RWFSVCASFLVMIGPGSTYLFGIYSQEIKSALGYDQTTLNLLGFFKDMGTNIGVPAGLVA  91

Query  309  EILPLWAVLLVGVAQNFVGYGWVWLIITGRLPALPIWAMCSH  434
            E+ P W VLL+G A N  GY  +WL +T R+    +W MC +
Sbjct  92   EVTPTWFVLLLGSALNLWGYLMIWLAVTARIARPKVWHMCVY  133


 Score = 83.6 bits (205),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +1

Query  406  PCQYGLCVLIFVGTNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQIYTL  585
            P  + +CV  FVG+N + + NT ALV+ V+NFP+SRG ++G+LKGF GL GAI+TQ Y  
Sbjct  125  PKVWHMCVYNFVGSNSQNFANTGALVTCVKNFPESRGIMIGLLKGFVGLGGAIMTQFYFA  184

Query  586  IHSPDHASLVFMIAVGPAIVIISLMFLIR  672
            I+  D  +L+ M+   PA + +  ++ IR
Sbjct  185  IYGDDSKALILMVGWFPAALCVIFVYTIR  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060