BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031F04

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                377   4e-129   Sesamum indicum [beniseed]
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           377   4e-129   Sesamum indicum [beniseed]
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    376   6e-129   Tarenaya hassleriana [spider flower]
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                376   9e-129   Erythranthe guttata [common monkey flower]
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              375   2e-128   Prunus mume [ume]
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    374   3e-128   Tarenaya hassleriana [spider flower]
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         374   4e-128   Tarenaya hassleriana [spider flower]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         374   4e-128   Pyrus x bretschneideri [bai li]
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                374   5e-128   Vitis vinifera
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             375   6e-128   
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         373   9e-128   Tarenaya hassleriana [spider flower]
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             373   1e-127   Phaseolus vulgaris [French bean]
dbj|BAE20168.1|  ribosomal protein S4                                   373   1e-127   Panax ginseng [Asiatic ginseng]
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         373   1e-127   Jatropha curcas
ref|NP_001235428.1|  uncharacterized protein LOC100500000               370   2e-127   
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             372   2e-127   Prunus persica
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         372   2e-127   Jatropha curcas
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    372   2e-127   
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         372   2e-127   Vitis vinifera
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                372   2e-127   Glycine max [soybeans]
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              372   2e-127   Glycine max [soybeans]
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                372   3e-127   Erythranthe guttata [common monkey flower]
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         372   3e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                372   3e-127   Malus domestica [apple tree]
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                372   3e-127   Nicotiana sylvestris
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           372   3e-127   Citrus sinensis [apfelsine]
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              372   3e-127   Pyrus x bretschneideri [bai li]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       372   4e-127   Cucumis sativus [cucumbers]
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              371   5e-127   Fragaria vesca subsp. vesca
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           371   5e-127   
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              371   6e-127   Glycine max [soybeans]
ref|NP_001235826.1|  40S ribosomal S4 protein                           371   6e-127   Glycine max [soybeans]
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                371   6e-127   Solanum lycopersicum
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          371   7e-127   
gb|AGZ15374.1|  40S ribosomal S4 protein                                371   7e-127   Phaseolus vulgaris [French bean]
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              371   8e-127   Vitis vinifera
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              371   8e-127   Cucumis melo [Oriental melon]
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 371   8e-127   Ricinus communis
ref|XP_003604568.1|  40S ribosomal protein S4                           371   8e-127   Medicago truncatula
ref|NP_001275093.1|  40S ribosomal protein S4-like                      371   9e-127   Solanum tuberosum [potatoes]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           371   9e-127   
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           371   9e-127   
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         370   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                370   1e-126   Prunus mume [ume]
ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           370   1e-126   Nicotiana tomentosiformis
gb|KHN48586.1|  40S ribosomal protein S4-2                              370   1e-126   Glycine soja [wild soybean]
ref|NP_001275148.1|  40S ribosomal protein S4                           370   1e-126   Solanum tuberosum [potatoes]
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              370   1e-126   Populus euphratica
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              370   1e-126   Eucalyptus grandis [rose gum]
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             370   1e-126   Prunus persica
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             370   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              370   2e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              370   2e-126   Elaeis guineensis
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             370   2e-126   Citrus clementina [clementine]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         370   2e-126   Nelumbo nucifera [Indian lotus]
gb|ACU24295.1|  unknown                                                 370   2e-126   Glycine max [soybeans]
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           370   2e-126   Nicotiana sylvestris
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             370   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         370   2e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 370   2e-126   Ricinus communis
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         369   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             369   3e-126   Eutrema salsugineum [saltwater cress]
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              369   3e-126   Fragaria vesca subsp. vesca
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           369   3e-126   Cucumis sativus [cucumbers]
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         369   3e-126   Elaeis guineensis
ref|XP_002884052.1|  40S ribosomal protein S4                           369   3e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         369   3e-126   Cucumis melo [Oriental melon]
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             369   4e-126   Capsella rubella
ref|XP_002871248.1|  40S ribosomal protein S4                           369   4e-126   Arabidopsis lyrata subsp. lyrata
ref|NP_200650.1|  40S ribosomal protein S4-3                            369   4e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             369   5e-126   Capsella rubella
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                369   5e-126   Nicotiana tomentosiformis
ref|XP_002864574.1|  40S ribosomal protein S4                           369   5e-126   Arabidopsis lyrata subsp. lyrata
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           369   6e-126   Fragaria vesca subsp. vesca
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              369   6e-126   Nelumbo nucifera [Indian lotus]
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         369   7e-126   Eucalyptus grandis [rose gum]
ref|NP_565414.1|  40S ribosomal protein S4-1                            368   7e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           369   7e-126   Nicotiana sylvestris
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          369   7e-126   Sorghum bicolor [broomcorn]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             368   7e-126   Capsella rubella
ref|NP_568179.1|  40S ribosomal protein S4-2                            368   7e-126   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266498.1|  40S ribosomal protein S4                           369   7e-126   Zea mays [maize]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             368   8e-126   Eutrema salsugineum [saltwater cress]
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              368   8e-126   Camelina sativa [gold-of-pleasure]
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         368   9e-126   Cucumis melo [Oriental melon]
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              368   9e-126   Populus euphratica
ref|XP_006374217.1|  40S ribosomal protein S4                           368   9e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         368   9e-126   Eucalyptus grandis [rose gum]
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         368   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    368   1e-125   
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           368   1e-125   Solanum lycopersicum
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         368   1e-125   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL49933.1|  AT5g58420/mqj2_10                                       368   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         368   1e-125   Elaeis guineensis
ref|XP_003623356.1|  40S ribosomal protein S4                           368   1e-125   Medicago truncatula
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         368   1e-125   Cicer arietinum [garbanzo]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         368   1e-125   Cicer arietinum [garbanzo]
gb|ACU24626.1|  unknown                                                 368   1e-125   Glycine max [soybeans]
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           368   1e-125   Solanum lycopersicum
gb|KHN38535.1|  40S ribosomal protein S4-1                              368   1e-125   Glycine soja [wild soybean]
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           367   2e-125   Solanum tuberosum [potatoes]
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         367   2e-125   Cicer arietinum [garbanzo]
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           367   2e-125   Solanum lycopersicum
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           367   2e-125   Nicotiana tomentosiformis
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         367   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         367   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         367   2e-125   Pyrus x bretschneideri [bai li]
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         367   3e-125   Nelumbo nucifera [Indian lotus]
gb|ABK92450.1|  unknown                                                 367   3e-125   Populus trichocarpa [western balsam poplar]
emb|CDY60025.1|  BnaAnng16450D                                          368   3e-125   Brassica napus [oilseed rape]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              367   3e-125   
gb|KCW60004.1|  hypothetical protein EUGRSUZ_H02737                     365   3e-125   Eucalyptus grandis [rose gum]
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         367   4e-125   Populus euphratica
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         366   4e-125   Camelina sativa [gold-of-pleasure]
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          367   4e-125   Sorghum bicolor [broomcorn]
dbj|BAB11167.1|  40S ribosomal protein S4                               366   5e-125   Arabidopsis thaliana [mouse-ear cress]
gb|ACV70143.1|  putative 40S ribosomal protein S4                       366   5e-125   Jatropha curcas
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              366   5e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    366   6e-125   
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         366   6e-125   Pyrus x bretschneideri [bai li]
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           366   6e-125   Nicotiana tomentosiformis
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           366   7e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           365   9e-125   Solanum tuberosum [potatoes]
gb|EPS63485.1|  hypothetical protein M569_11297                         365   9e-125   Genlisea aurea
gb|AAS48726.1|  ribosomal protein S4                                    365   1e-124   Zea mays [maize]
gb|EPS70681.1|  hypothetical protein M569_04077                         365   1e-124   Genlisea aurea
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   365   1e-124   Citrus sinensis [apfelsine]
emb|CDY05015.1|  BnaAnng01970D                                          367   2e-124   
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         365   2e-124   
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             365   2e-124   Phaseolus vulgaris [French bean]
ref|XP_003611879.1|  40S ribosomal protein S4                           365   2e-124   Medicago truncatula
emb|CDY14056.1|  BnaC02g01730D                                          366   2e-124   Brassica napus [oilseed rape]
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           365   2e-124   
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    367   2e-124   Phoenix dactylifera
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           364   2e-124   Setaria italica
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             366   3e-124   
ref|NP_001043015.1|  Os01g0358400                                       364   3e-124   
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          364   3e-124   Sorghum bicolor [broomcorn]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             365   3e-124   
ref|NP_001242281.1|  uncharacterized protein LOC100812132               364   3e-124   Glycine max [soybeans]
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         364   3e-124   Brassica rapa
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             364   3e-124   Populus trichocarpa [western balsam poplar]
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              364   4e-124   Brassica rapa
gb|KHN00473.1|  40S ribosomal protein S4-1                              365   4e-124   Glycine soja [wild soybean]
emb|CDY32986.1|  BnaA10g11920D                                          365   4e-124   Brassica napus [oilseed rape]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           364   4e-124   Setaria italica
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              363   5e-124   Brassica rapa
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        363   5e-124   Theobroma cacao [chocolate]
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           363   5e-124   Oryza brachyantha
gb|KHG30713.1|  40S ribosomal S4                                        364   5e-124   Gossypium arboreum [tree cotton]
emb|CDY57385.1|  BnaCnng31910D                                          365   5e-124   Brassica napus [oilseed rape]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        363   6e-124   
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    363   7e-124   Arabis alpina [alpine rockcress]
ref|NP_001045624.1|  Os02g0105900                                       363   7e-124   
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           363   1e-123   Oryza brachyantha
gb|KJB71672.1|  hypothetical protein B456_011G136800                    363   1e-123   Gossypium raimondii
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         362   1e-123   Populus euphratica
gb|KHG02126.1|  40S ribosomal S4                                        362   1e-123   Gossypium arboreum [tree cotton]
gb|KJB37999.1|  hypothetical protein B456_006G231800                    362   2e-123   Gossypium raimondii
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    362   2e-123   Arabis alpina [alpine rockcress]
emb|CDY69841.1|  BnaAnng31720D                                          363   3e-123   Brassica napus [oilseed rape]
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         362   3e-123   Populus euphratica
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    362   4e-123   Arabis alpina [alpine rockcress]
dbj|BAJ94984.1|  predicted protein                                      361   4e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001288485.1|  40S ribosomal protein S4-like                      361   5e-123   Zea mays [maize]
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             361   5e-123   Populus trichocarpa [western balsam poplar]
ref|NP_001055342.1|  Os05g0368300                                       361   5e-123   
gb|KHG02041.1|  40S ribosomal S4                                        361   6e-123   Gossypium arboreum [tree cotton]
emb|CDX81032.1|  BnaC03g02860D                                          362   6e-123   
gb|KHG26321.1|  40S ribosomal S4                                        361   6e-123   Gossypium arboreum [tree cotton]
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         361   7e-123   
ref|XP_010087529.1|  40S ribosomal protein S4                           362   1e-122   
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              360   2e-122   Brassica rapa
emb|CDX99006.1|  BnaC09g48290D                                          360   2e-122   
emb|CDY58877.1|  BnaA03g55550D                                          360   3e-122   Brassica napus [oilseed rape]
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           359   4e-122   Gossypium hirsutum [American cotton]
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                357   1e-121   Brachypodium distachyon [annual false brome]
gb|EAY97774.1|  hypothetical protein OsI_19685                          358   2e-121   Oryza sativa Indica Group [Indian rice]
emb|CDX70008.1|  BnaA10g23570D                                          357   2e-121   
dbj|BAD22763.1|  ribosomal protein                                      357   2e-121   Bromus inermis [awnless brome grass]
emb|CDY02821.1|  BnaC02g10680D                                          356   1e-120   
gb|KHG30303.1|  40S ribosomal S4                                        355   1e-120   Gossypium arboreum [tree cotton]
gb|EEE63465.1|  hypothetical protein OsJ_18278                          360   2e-120   Oryza sativa Japonica Group [Japonica rice]
gb|KJB29915.1|  hypothetical protein B456_005G123400                    354   3e-120   Gossypium raimondii
emb|CDY32700.1|  BnaA02g07620D                                          354   1e-119   Brassica napus [oilseed rape]
ref|NP_001189539.1|  40S ribosomal protein S4-1                         349   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           352   3e-119   Nicotiana sylvestris
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    350   7e-118   
gb|EMT14698.1|  40S ribosomal protein S4                                347   2e-117   
gb|ABK21170.1|  unknown                                                 340   9e-115   Picea sitchensis
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           340   9e-115   Prunus armeniaca
gb|ABK22322.1|  unknown                                                 339   2e-114   Picea sitchensis
emb|CDP06439.1|  unnamed protein product                                335   4e-113   Coffea canephora [robusta coffee]
emb|CBI15899.3|  unnamed protein product                                335   4e-113   Vitis vinifera
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         335   8e-113   Phoenix dactylifera
gb|KHN03095.1|  40S ribosomal protein S4                                334   1e-112   Glycine soja [wild soybean]
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   333   2e-112   Citrus sinensis [apfelsine]
emb|CBI25428.3|  unnamed protein product                                332   7e-112   Vitis vinifera
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   331   1e-111   Citrus sinensis [apfelsine]
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    334   3e-111   
dbj|BAB10257.1|  ribosomal protein S4                                   330   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031846.1|  40S ribosomal protein S4-2                         330   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         330   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_001759850.1|  predicted protein                                  329   2e-110   
ref|XP_001780588.1|  predicted protein                                  329   2e-110   
ref|XP_001759591.1|  predicted protein                                  328   8e-110   
ref|XP_001751877.1|  predicted protein                                  327   9e-110   
gb|KHG11751.1|  40S ribosomal S4                                        327   1e-109   Gossypium arboreum [tree cotton]
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    325   2e-109   Arabis alpina [alpine rockcress]
ref|XP_001766039.1|  predicted protein                                  328   3e-109   
gb|KJB77064.1|  hypothetical protein B456_012G118500                    325   4e-109   Gossypium raimondii
ref|XP_001785339.1|  predicted protein                                  326   4e-109   
gb|KJB38000.1|  hypothetical protein B456_006G231800                    325   6e-109   Gossypium raimondii
gb|AAT38019.1|  putative 40S ribosomal protein S4                       324   8e-109   Oryza sativa Japonica Group [Japonica rice]
gb|KJB29916.1|  hypothetical protein B456_005G123400                    319   1e-106   Gossypium raimondii
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    317   6e-106   Glycine max [soybeans]
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   315   1e-104   Citrus sinensis [apfelsine]
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             314   2e-104   Selaginella moellendorffii
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   313   3e-104   Citrus sinensis [apfelsine]
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             313   3e-104   Selaginella moellendorffii
gb|KJB36905.1|  hypothetical protein B456_006G184600                    307   3e-102   Gossypium raimondii
gb|KJB77063.1|  hypothetical protein B456_012G118500                    308   3e-102   Gossypium raimondii
gb|KJB17112.1|  hypothetical protein B456_002G266000                    304   7e-101   Gossypium raimondii
dbj|GAN07411.1|  40S ribosomal protein S4                               302   7e-100   Mucor ambiguus
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                    301   2e-99    Rhizopus microsporus
gb|EIE83303.1|  40S ribosomal protein S4                                300   6e-99    Rhizopus delemar RA 99-880
emb|CEG72922.1|  Putative 40S ribosomal protein S4-A                    300   8e-99    Rhizopus microsporus
emb|CEI87363.1|  Putative 40S ribosomal protein S4-A                    299   1e-98    Rhizopus microsporus
ref|XP_005850141.1|  hypothetical protein CHLNCDRAFT_59606              298   2e-98    Chlorella variabilis
gb|EIE90129.1|  40S ribosomal protein S4-A                              298   3e-98    Rhizopus delemar RA 99-880
gb|EIE79548.1|  40S ribosomal protein S4-A                              298   3e-98    Rhizopus delemar RA 99-880
gb|KFH71854.1|  40S ribosomal protein S4                                298   4e-98    Mortierella verticillata NRRL 6337
emb|CEP14949.1|  hypothetical protein                                   298   4e-98    Parasitella parasitica
gb|KDD75424.1|  hypothetical protein H632_c691p0                        294   1e-96    Helicosporidium sp. ATCC 50920
emb|CDH52779.1|  40s ribosomal protein s4                               294   2e-96    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS09843.1|  Putative 40S ribosomal protein S4-A                    293   2e-96    Lichtheimia ramosa
gb|EPZ32691.1|  40S ribosomal protein S4                                291   2e-95    Rozella allomycis CSF55
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                    290   4e-95    Rhizopus microsporus
dbj|BAK03384.1|  predicted protein                                      290   6e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEI97230.1|  Putative 40S ribosomal protein S4-A                    289   9e-95    Rhizopus microsporus
gb|KGG52703.1|  hypothetical protein DI09_141p50                        289   9e-95    Mitosporidium daphniae
emb|CCE33652.1|  probable ribosomal protein S4.e, cytosolic             289   9e-95    Claviceps purpurea 20.1
ref|XP_011402198.1|  40S ribosomal protein S4-3                         289   1e-94    Auxenochlorella protothecoides
ref|XP_008600052.1|  ribosomal family S4e                               288   1e-94    Beauveria bassiana ARSEF 2860
ref|XP_003052651.1|  40S ribosomal protein S4                           288   2e-94    [Nectria] haematococca mpVI 77-13-4
gb|KID72648.1|  Ribosomal protein S4e                                   288   2e-94    Metarhizium brunneum ARSEF 3297
ref|XP_009259092.1|  hypothetical protein FPSE_07699                    288   3e-94    Fusarium pseudograminearum CS3096
gb|EXX69253.1|  ribosomal 40S subunit protein S4A                       288   4e-94    Rhizophagus irregularis DAOM 197198w
gb|EGU80487.1|  hypothetical protein FOXB_08947                         287   5e-94    Fusarium oxysporum Fo5176
emb|CEP15508.1|  hypothetical protein                                   287   5e-94    Parasitella parasitica
ref|XP_007807221.1|  ribosomal protein S4                               287   5e-94    Metarhizium acridum CQMa 102
emb|CBI18118.3|  unnamed protein product                                285   5e-94    Vitis vinifera
ref|XP_006685622.1|  ribosomal protein S4e                              287   5e-94    Yamadazyma tenuis ATCC 10573
gb|EQL02576.1|  Ribosomal protein S4e                                   287   5e-94    Ophiocordyceps sinensis CO18
ref|XP_007823560.1|  hypothetical protein MAA_07371                     287   6e-94    Metarhizium robertsii ARSEF 23
gb|KID89485.1|  Ribosomal protein S4e                                   287   6e-94    Metarhizium guizhouense ARSEF 977
gb|KIE00269.1|  Ribosomal protein S4e                                   287   8e-94    Metarhizium majus ARSEF 297
gb|EPB85233.1|  40S ribosomal protein S4-A                              286   9e-94    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001421876.1|  Ribosomal protein S4, component of cytosolic...    286   1e-93    Ostreococcus lucimarinus CCE9901
ref|XP_006691808.1|  40S ribosomal protein S4-like protein              286   1e-93    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003651472.1|  40S ribosomal protein S4                           286   2e-93    Thielavia terrestris NRRL 8126
gb|KIL89636.1|  hypothetical protein FAVG1_07216                        286   2e-93    Fusarium avenaceum
ref|XP_006679983.1|  hypothetical protein BATDEDRAFT_35382              287   2e-93    Batrachochytrium dendrobatidis JAM81
ref|XP_006668474.1|  ribosomal protein S4                               285   4e-93    Cordyceps militaris CM01
emb|CCE33007.1|  probable ribosomal protein S4.e, cytosolic             285   4e-93    Claviceps purpurea 20.1
ref|XP_964251.2|  40S ribosomal protein S4                              285   6e-93    Neurospora crassa OR74A
gb|ELU11454.1|  hypothetical protein CAPTEDRAFT_152725                  284   7e-93    Capitella teleta
ref|XP_001222557.1|  40S ribosomal protein S4                           285   7e-93    Chaetomium globosum CBS 148.51
ref|XP_005650091.1|  ribosomal protein S4 component of cytosolic ...    284   8e-93    Coccomyxa subellipsoidea C-169
ref|XP_006962266.1|  hypothetical protein TRIREDRAFT_74568              284   1e-92    Trichoderma reesei QM6a
ref|XP_005706608.1|  40S ribosomal protein S4e                          284   1e-92    Galdieria sulphuraria
ref|XP_002954897.1|  component of cytosolic 80S ribosome and 40S ...    284   1e-92    Volvox carteri f. nagariensis
ref|XP_005536157.1|  40S ribosomal protein S4                           284   1e-92    Cyanidioschyzon merolae strain 10D
gb|EHK42992.1|  hypothetical protein TRIATDRAFT_300975                  284   1e-92    Trichoderma atroviride IMI 206040
gb|KEY68677.1|  hypothetical protein S7711_00551                        284   1e-92    Stachybotrys chartarum IBT 7711
ref|XP_003660094.1|  hypothetical protein MYCTH_2297948                 284   1e-92    Thermothelomyces thermophila ATCC 42464
ref|XP_001482877.1|  40S ribosomal protein S4                           283   1e-92    Meyerozyma guilliermondii ATCC 6260
ref|XP_001691218.1|  ribosomal protein S4, component of cytosolic...    283   1e-92    Chlamydomonas reinhardtii
gb|ESW97160.1|  40S ribosomal protein S4-A                              283   2e-92    Ogataea parapolymorpha DL-1
ref|XP_002502247.1|  predicted protein                                  283   2e-92    
gb|KFA60798.1|  hypothetical protein S40285_07752                       283   2e-92    
gb|KDN64809.1|  putative ribosomal family S4e                           283   2e-92    
ref|XP_003347065.1|  40S ribosomal protein S4                           283   2e-92    
gb|EFX62690.1|  hypothetical protein DAPPUDRAFT_300650                  282   3e-92    
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                283   3e-92    
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     283   3e-92    
ref|XP_002493655.1|  40S ribosomal protein S4                           283   4e-92    
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    283   4e-92    
ref|XP_010383061.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   5e-92    
dbj|BAB29207.1|  unnamed protein product                                282   5e-92    
ref|XP_011275622.1|  40S ribosomal protein                              282   6e-92    
gb|AJR59975.1|  Rps4ap                                                  282   6e-92    
emb|CEJ90606.1|  Putative 40S ribosomal protein S4                      282   7e-92    
ref|XP_002175438.1|  40S ribosomal protein S4                           282   7e-92    
gb|KFM79678.1|  40S ribosomal protein S4                                281   8e-92    
ref|XP_007913637.1|  putative 40s ribosomal protein s4 protein          281   8e-92    
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           281   8e-92    
ref|NP_001233602.1|  40S ribosomal protein S4                           281   9e-92    
emb|CCF38284.1|  40S ribosomal protein S4                               281   9e-92    
gb|EAW71816.1|  ribosomal protein S4, X-linked, isoform CRA_b           280   9e-92    
gb|EPX72118.1|  40S ribosomal protein S4                                281   9e-92    
gb|EHK22484.1|  hypothetical protein TRIVIDRAFT_84016                   281   1e-91    
ref|NP_012073.1|  ribosomal 40S subunit protein S4B                     281   1e-91    
dbj|BAE22507.1|  unnamed protein product                                281   1e-91    
ref|XP_001387773.1|  40S ribosomal protein S4                           281   1e-91    
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           281   1e-91    
ref|NP_001187069.1|  40S ribosomal protein S4                           281   1e-91    
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    281   1e-91    
gb|AGH70188.1|  40S ribosomal protein S4                                281   1e-91    
emb|CCX29556.1|  Similar to 40S ribosomal protein S4; acc. no. O5...    281   1e-91    
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    281   1e-91    
gb|KGQ99291.1|  40S ribosomal protein S4                                281   1e-91    
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    281   1e-91    
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           281   1e-91    
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           281   1e-91    
dbj|BAM17680.1|  ribosomal protein S4                                   281   1e-91    
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   1e-91    
ref|XP_007829569.1|  40S ribosomal protein S4                           281   2e-91    
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   2e-91    
gb|EPY52081.1|  40S ribosomal protein S4                                281   2e-91    
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   2e-91    
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   2e-91    
gb|EFQ26693.1|  ribosomal family S4e                                    281   2e-91    
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     281   2e-91    
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   2e-91    
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         281   2e-91    
sp|Q95V34.1|RS4_SPOFR  RecName: Full=40S ribosomal protein S4           281   2e-91    
ref|XP_461869.1|  40S ribosomal protein S4                              281   2e-91    
emb|CDH61332.1|  40s ribosomal protein s4                               280   2e-91    
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   2e-91    
ref|XP_004015500.1|  PREDICTED: 40S ribosomal protein S4-like           280   2e-91    
gb|ELR52713.1|  40S ribosomal protein S4                                281   2e-91    
gb|AFM89946.1|  40S ribosomal protein S4                                281   2e-91    
gb|EPY52214.1|  40S ribosomal protein S4                                281   2e-91    
ref|XP_004484344.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   2e-91    
gb|EPY50701.1|  40S ribosomal protein S4                                280   2e-91    
ref|XP_007872809.1|  hypothetical protein PNEG_00898                    280   2e-91    
prf||1617101C  ribosomal protein S4                                     280   2e-91 
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           280   2e-91    
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           280   2e-91    
ref|XP_005880123.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    281   3e-91    
gb|KHC68343.1|  40S ribosomal protein S4                                280   3e-91    
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     280   3e-91    
ref|XP_007374214.1|  ribosomal protein S4                               280   3e-91    
emb|CDO92178.1|  unnamed protein product                                280   3e-91    
ref|XP_003684132.1|  40S ribosomal protein S4                           280   3e-91    
gb|ELR61790.1|  hypothetical protein M91_18687                          281   3e-91    
gb|AFM87151.1|  40S ribosomal protein S4                                280   3e-91    
gb|AFM90857.1|  40S ribosomal protein S4                                280   3e-91    
gb|KGQ98564.1|  40S ribosomal protein S4                                280   3e-91    
gb|KIN07653.1|  hypothetical protein OIDMADRAFT_16250                   280   3e-91    
ref|XP_001386303.1|  40S ribosomal protein S4                           280   3e-91    
gb|ACD65137.1|  putative 40S ribosomal protein RPS4                     279   4e-91    
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    280   4e-91    
gb|AFM88094.1|  40S ribosomal protein S4                                280   4e-91    
gb|AFM86034.1|  40S ribosomal protein S4                                280   4e-91    
emb|CDR46586.1|  CYFA0S24e00562g1_1                                     280   4e-91    
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           280   4e-91    
ref|XP_003374555.1|  40S ribosomal protein S4                           280   4e-91    
gb|KHN98797.1|  ribosomal protein S4                                    280   4e-91    
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           280   4e-91    
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   4e-91    
gb|AFM90173.1|  40S ribosomal protein S4                                280   4e-91    
gb|ADT80676.1|  ribosomal protein S4                                    280   4e-91    
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       280   4e-91    
gb|EPS26877.1|  hypothetical protein PDE_01817                          280   5e-91    
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    280   5e-91    
ref|XP_003680830.1|  40S ribosomal protein S4                           280   5e-91    
dbj|BAO40506.1|  40S ribosomal protein S4                               280   5e-91    
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     280   5e-91    
gb|AFM86071.1|  40S ribosomal protein S4                                280   5e-91    
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   5e-91    
emb|CEP65035.1|  LALA0S18e00254g1_1                                     280   5e-91    
ref|NP_983705.1|  40S ribosomal protein S4                              280   5e-91    
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     280   5e-91    
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     280   5e-91    
gb|EPE05262.1|  40s ribosomal protein s4                                280   5e-91    
ref|XP_001907457.1|  hypothetical protein                               280   5e-91    
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   5e-91    
ref|NP_001090472.1|  40S ribosomal protein S4                           280   5e-91    
ref|XP_717144.1|  likely cytosolic ribosomal protein S4                 280   5e-91    
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4                280   5e-91    
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   5e-91    
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like           280   5e-91    
ref|XP_002112468.1|  conserved hypothetical protein                     280   6e-91    
ref|XP_010758820.1|  40S ribosomal protein S4                           280   6e-91    
ref|NP_001232240.1|  putative ribosomal protein S4                      280   6e-91    
ref|XP_005750964.1|  PREDICTED: 40S ribosomal protein S4-like           280   6e-91    
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    280   6e-91    
ref|XP_003669897.1|  ribosomal protein S4                               279   6e-91    
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     279   7e-91    
ref|XP_002794223.1|  40S ribosomal protein S4                           279   7e-91    
ref|XP_001525769.1|  40S ribosomal protein S4                           279   7e-91    
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     279   7e-91    
ref|NP_988912.1|  40S ribosomal protein S4                              279   7e-91    
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     279   7e-91    
ref|XP_003204899.1|  PREDICTED: 40S ribosomal protein S4-like           279   7e-91    
gb|ABQ18253.1|  ribosomal protein S4e                                   279   8e-91    
ref|XP_451697.1|  40S ribosomal protein S4                              279   8e-91    
ref|NP_990439.1|  40S ribosomal protein S4                              279   8e-91    
ref|XP_003457778.1|  PREDICTED: 40S ribosomal protein S4-like           279   8e-91    
gb|AFM89445.1|  40S ribosomal protein S4                                279   8e-91    
ref|NP_001084941.1|  40S ribosomal protein S4                           279   8e-91    
ref|NP_595677.1|  40S ribosomal protein S4                              279   9e-91    
ref|XP_002553456.1|  40S ribosomal protein S4                           279   9e-91    
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           279   9e-91    
emb|CDS06770.1|  Putative 40S ribosomal protein S4-A                    279   9e-91    
emb|CEG00570.1|  Ribosomal protein S4e                                  279   9e-91    
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4                279   9e-91    
ref|NP_001037257.1|  40S ribosomal protein S4                           279   9e-91    
ref|XP_005900947.1|  PREDICTED: 40S ribosomal protein S4-like           279   1e-90    
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform     279   1e-90    
ref|XP_003957732.1|  hypothetical protein KAFR_0E04470                  279   1e-90    
emb|CCE40910.1|  hypothetical protein CPAR2_109480                      279   1e-90    
gb|AFM85695.1|  40S ribosomal protein S4                                279   1e-90    
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    279   1e-90    
ref|XP_003673582.1|  hypothetical protein NCAS_0A06410                  279   1e-90    
pdb|4CUY|E  Chain E, Kluyveromyces Lactis 80s Ribosome In Complex...    279   1e-90    
gb|AFM90740.1|  40S ribosomal protein S4                                279   1e-90    
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    279   1e-90    
ref|NP_596350.1|  40S ribosomal protein S4                              279   1e-90    
gb|ACY95325.1|  ribosomal protein S4                                    279   1e-90    
ref|XP_007590516.1|  ribosomal family S4e                               279   1e-90    
emb|CCK72874.1|  hypothetical protein KNAG_0M00210                      279   1e-90    
gb|KIL69367.1|  hypothetical protein M378DRAFT_157632                   279   1e-90    
ref|XP_003678541.1|  hypothetical protein NCAS_0J02250                  279   1e-90    
gb|KFO69844.1|  40S ribosomal protein S4                                278   1e-90    
ref|NP_001075891.1|  40S ribosomal protein S4                           279   1e-90    
gb|AFM88708.1|  40S ribosomal protein S4                                279   1e-90    
ref|XP_009227728.1|  40S ribosomal protein S4-A                         279   1e-90    
ref|XP_007003999.1|  hypothetical protein TREMEDRAFT_43729              279   1e-90    
gb|EGE82775.1|  40S ribosomal protein S4                                280   1e-90    
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like           279   1e-90    
ref|XP_001985577.1|  GH17143                                            278   1e-90    
gb|AFM90836.1|  40S ribosomal protein S4                                278   1e-90    
gb|EFB14527.1|  hypothetical protein PANDA_015068                       278   1e-90    
ref|XP_005894604.1|  PREDICTED: 40S ribosomal protein S4-like           278   1e-90    
gb|AAB01670.1|  ribosomal protein S4                                    278   2e-90    
gb|KDR20779.1|  40S ribosomal protein S4                                278   2e-90    
gb|KFP36414.1|  40S ribosomal protein S4                                277   2e-90    
ref|XP_002416828.1|  40S ribosomal protein S4                           278   2e-90    
gb|EHH30841.1|  Single copy abundant mRNA protein                       278   2e-90    
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    278   2e-90    
emb|CAA75242.1|  ribosomal protein S4                                   278   2e-90    
ref|XP_005435883.1|  PREDICTED: 40S ribosomal protein S4-like           280   2e-90    
ref|XP_011122246.1|  hypothetical protein AOL_s00079g69                 278   2e-90    
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   278   2e-90    
ref|NP_594174.1|  40S ribosomal protein S4                              278   2e-90    
emb|CCE44986.1|  hypothetical protein CPAR2_407890                      278   2e-90    
ref|XP_460509.1|  40S ribosomal protein S4                              278   2e-90    
gb|ENH86947.1|  40s ribosomal protein s4                                278   2e-90    
ref|XP_002716797.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    278   2e-90    
gb|ETE69702.1|  40S ribosomal protein S4                                278   2e-90    
ref|XP_446360.1|  40S ribosomal protein S4                              278   2e-90    
ref|XP_004203912.1|  Piso0_000935                                       278   2e-90    
gb|AFM89018.1|  40S ribosomal protein S4                                278   2e-90    
ref|XP_005888436.1|  PREDICTED: 40S ribosomal protein S4-like           278   2e-90    
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like           278   2e-90    
gb|AFM87833.1|  40S ribosomal protein S4                                278   2e-90    
ref|XP_004715961.1|  PREDICTED: 40S ribosomal protein S4, X isoform     280   2e-90    
gb|AEL28856.1|  ribosomal protein S4                                    278   2e-90    
ref|XP_005806467.1|  PREDICTED: 40S ribosomal protein S4-like           278   2e-90    
ref|XP_007276029.1|  40s ribosomal protein s4                           278   2e-90    
ref|XP_004181063.1|  hypothetical protein TBLA_0E04950                  278   3e-90    
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    278   3e-90    
ref|XP_008954190.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    278   3e-90    
ref|XP_009651491.1|  40S ribosomal protein S4-A                         278   3e-90    
emb|CAJ17168.1|  ribosomal protein S4e                                  278   3e-90    
gb|KFQ66872.1|  40S ribosomal protein S4                                276   3e-90    
gb|AFM90738.1|  40S ribosomal protein S4                                278   3e-90    
gb|AFM87393.1|  40S ribosomal protein S4                                278   3e-90    
ref|XP_010372927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    278   3e-90    
ref|XP_005965959.1|  PREDICTED: 40S ribosomal protein S4-like           278   3e-90    
emb|CAJ17164.1|  ribosomal protein S4e                                  278   3e-90    
ref|XP_006822958.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    278   3e-90    
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    278   4e-90    
ref|XP_002498034.1|  40S ribosomal protein S4                           278   4e-90    
ref|XP_006154441.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    276   4e-90    
gb|KHJ31509.1|  putative 40s ribosomal protein s4                       277   4e-90    
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                277   4e-90    
ref|XP_007805433.1|  40S ribosomal protein S4                           277   4e-90    
ref|XP_003956128.1|  hypothetical protein KAFR_0B06960                  277   4e-90    
ref|XP_005313893.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     278   4e-90    
ref|XP_003764080.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    277   4e-90    
gb|EMD39287.1|  hypothetical protein CERSUDRAFT_112935                  277   5e-90    
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    277   5e-90    
ref|XP_008498268.1|  PREDICTED: 40S ribosomal protein S4, X isoform     277   5e-90    
ref|XP_002744145.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    277   5e-90    
ref|XP_003672432.1|  ribosomal protein S4                               277   5e-90    
ref|NP_001279537.1|  ribosomal protein S4, X-linked                     277   5e-90    
ref|XP_010854947.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    277   5e-90    
ref|XP_010747631.1|  PREDICTED: 40S ribosomal protein S4, X isoform     277   5e-90    
ref|XP_006025231.1|  PREDICTED: 40S ribosomal protein S4-like           278   5e-90    
gb|AFM86794.1|  40S ribosomal protein S4                                277   6e-90    
gb|KFH43552.1|  40S ribosomal protein S4-like protein                   277   6e-90    
ref|XP_008054194.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    277   6e-90    
gb|EFW99258.1|  40S ribosomal protein s4                                277   7e-90    
ref|XP_003648106.1|  hypothetical protein Ecym_7471                     277   7e-90    
ref|XP_008527087.1|  PREDICTED: 40S ribosomal protein S4, X isoform     277   8e-90    
ref|XP_003721009.1|  40S ribosomal protein S4-A                         276   8e-90    



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   376 bits (966),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/187 (95%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   376 bits (965),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRH+LVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFGKKGIP+INTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGKKGIPYINTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   375 bits (963),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   374 bits (961),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
             ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  2    QARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  61

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  62   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  121

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  122  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  181

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  182  VMVTGGR  188



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   374 bits (960),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLC+VRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCRVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   374 bits (960),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   374 bits (960),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   375 bits (962),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  33   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  92

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  93   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  152

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  153  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  212

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  213  VMVTGGR  219



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   373 bits (958),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VQSILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001235428.1| uncharacterized protein LOC100500000 [Glycine max]
 gb|ACU14556.1| unknown [Glycine max]
Length=205

 Score =   370 bits (950),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKV+ VQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVKGVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   372 bits (955),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   372 bits (955),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRH+LVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHILVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  YKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   372 bits (955),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/187 (94%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   372 bits (955),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   372 bits (954),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   372 bits (954),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   372 bits (954),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   371 bits (953),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NKV+DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKVIDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   371 bits (953),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   371 bits (953),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   371 bits (953),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   371 bits (952),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   371 bits (953),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  66   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSL  245
            ++ T ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKY+L
Sbjct  1    MAKTWARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYAL  60

Query  246  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  425
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS++D
Sbjct  61   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVKD  120

Query  426  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  605
            EEAKFKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFD
Sbjct  121  EEAKFKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFD  180

Query  606  VGNVVMVTGGR  638
            VGNVVMVTGGR
Sbjct  181  VGNVVMVTGGR  191



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   371 bits (952),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRH+ VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHIFVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   371 bits (952),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   371 bits (952),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   371 bits (952),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   371 bits (952),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE N +VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENNIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP+INTYDGRTIRYPDPLI+ANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYINTYDGRTIRYPDPLIRANDTIKLDLETNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKK++KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKYLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ +FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   369 bits (947),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   369 bits (948),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KR+NAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRINAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDTVKLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTVKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   369 bits (947),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   369 bits (946),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   369 bits (947),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYGE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   369 bits (946),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEA+
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAQ  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   369 bits (946),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   369 bits (946),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE+NK++DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLETNKIIDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   369 bits (946),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   368 bits (945),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   369 bits (946),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGSKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   369 bits (946),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   368 bits (945),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   368 bits (945),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   369 bits (946),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   368 bits (945),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   368 bits (945),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   368 bits (945),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKT+PAGFMD++SIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDILSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLESNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   368 bits (945),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   368 bits (945),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   368 bits (945),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP+IKANDTVKLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPVIKANDTVKLDLEANKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSV+FG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVRFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEANKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRL+Y+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLEYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETYKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEQNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMD VSIPKTNENF L YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDAVSIPKTNENFHLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   368 bits (944),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNA KHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNARKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIKANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGK+RTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKIRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   367 bits (943),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHAIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGTKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   367 bits (942),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   367 bits (942),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
             KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  LKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   367 bits (942),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPLVLI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLVLILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   367 bits (942),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+K+DLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKIDLEANKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   367 bits (942),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKF VGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFGVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   368 bits (944),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +3

Query  69   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLT  248
            +T MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LT
Sbjct  21   ATHMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  80

Query  249  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  428
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDE
Sbjct  81   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  140

Query  429  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDV  608
            EAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDV
Sbjct  141  EAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDV  200

Query  609  GNVVMVTGGR  638
            GNVVMVTGGR
Sbjct  201  GNVVMVTGGR  210



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   367 bits (941),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+L YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KCW60004.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=215

 Score =   365 bits (936),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLDLETNKITDFIKFDVGNV  180

Query  618  VMVT  629
            VMVT
Sbjct  181  VMVT  184



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   367 bits (941),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKK+MKRL+APKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKNMKRLHAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   366 bits (940),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+ K+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAKKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   367 bits (941),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   366 bits (940),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
             ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  2    QARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  61

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  62   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  121

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  122  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  181

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  182  VMVTGGR  188



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   366 bits (940),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRL Y+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLPYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLV GKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVVGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   366 bits (940),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+L YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   366 bits (939),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   366 bits (940),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE++K+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETSKITDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   366 bits (939),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIIMRNRLKYALTYGE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   366 bits (939),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   365 bits (938),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDL+SNK+VDFIKFDVGNV
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLDSNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   365 bits (938),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAKF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEEAKF  120

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGNV+
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIADFIKFDVGNVI  180

Query  621  MVTGGR  638
            MVTGGR
Sbjct  181  MVTGGR  186



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   365 bits (938),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPPIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   365 bits (937),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEE+KF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEESKF  120

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLDLE NK+VDFIKFDVGNVV
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLEENKIVDFIKFDVGNVV  180

Query  621  MVTGGR  638
            MVTGGR
Sbjct  181  MVTGGR  186



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   365 bits (938),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 184/194 (95%), Gaps = 7/194 (4%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  -------FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFI  596
                   FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FI
Sbjct  121  ALILLFQFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITEFI  180

Query  597  KFDVGNVVMVTGGR  638
            KFDVGNVVMVTGGR
Sbjct  181  KFDVGNVVMVTGGR  194



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  60   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  239
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  38   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  97

Query  240  SLTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  419
            +LTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  98   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  157

Query  420  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  599
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIK
Sbjct  158  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK  217

Query  600  FDVGNVVMVTGGR  638
            FDVGNVVMVTGGR
Sbjct  218  FDVGNVVMVTGGR  230



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   365 bits (937),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  66   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSL  245
            ++  +ARGLKKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPLVLI+RNRLKY+L
Sbjct  1    MTEDLARGLKKHLKRLNAPKHWMLDKLGGXFAPKPSSGPHKARECLPLVLILRNRLKYAL  60

Query  246  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  425
            TYREV+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRD
Sbjct  61   TYREVVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRD  120

Query  426  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  605
            EEAKFKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFD
Sbjct  121  EEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLDLEANKITDFIKFD  180

Query  606  VGNVVMVTGGR  638
            VGNVVMVTGGR
Sbjct  181  VGNVVMVTGGR  191



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   365 bits (937),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKV+SVQFG+KGIP++NT+DGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVKSVQFGQKGIPYLNTFDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   365 bits (937),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSVRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+I+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGG+
Sbjct  181  VMVTGGK  187



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   366 bits (939),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  60   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  239
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  24   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  83

Query  240  SLTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  419
            +LTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+
Sbjct  84   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSL  143

Query  420  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  599
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIK
Sbjct  144  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIK  203

Query  600  FDVGNVVMVTGGR  638
            FDVGNVVMVTGGR
Sbjct  204  FDVGNVVMVTGGR  216



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   365 bits (938),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 185/191 (97%), Gaps = 0/191 (0%)
 Frame = +3

Query  66   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSL  245
            L T  ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+L
Sbjct  17   LGTDAARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYAL  76

Query  246  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  425
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++D
Sbjct  77   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKD  136

Query  426  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFD  605
            E+AKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFD
Sbjct  137  EDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFD  196

Query  606  VGNVVMVTGGR  638
            VGNVVMVTGGR
Sbjct  197  VGNVVMVTGGR  207



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLDLETNKIADFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   364 bits (935),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DL++NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLDTNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   366 bits (940),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 3/200 (2%)
 Frame = +3

Query  48   RRPNTQL---STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  218
            + P ++L   +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI
Sbjct  38   KSPGSELRLQTPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  97

Query  219  IRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKG  398
            IRNRLKY+L YREV+SILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKG
Sbjct  98   IRNRLKYALNYREVVSILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKG  157

Query  399  RFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESN  578
            RFRLHSIRDEEAK+KLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+N
Sbjct  158  RFRLHSIRDEEAKYKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEAN  217

Query  579  KVVDFIKFDVGNVVMVTGGR  638
            K+V+FIKFDVGNVVMVTGGR
Sbjct  218  KIVEFIKFDVGNVVMVTGGR  237



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FK+CKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKMCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   365 bits (937),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = +3

Query  72   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTY  251
              MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECL LVLIIRN LKY+LTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLTLVLIIRNSLKYALTY  84

Query  252  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEE  431
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  432  AKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVG  611
            AKFKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVG
Sbjct  145  AKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVG  204

Query  612  NVVMVTGGR  638
            NVVMVTGGR
Sbjct  205  NVVMVTGGR  213



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLK +LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKCALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   364 bits (935),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   364 bits (934),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   364 bits (934),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   365 bits (937),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREV
Sbjct  34   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  93

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAKF
Sbjct  94   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAKF  153

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLDLE NK+VDFIKFDVGNVV
Sbjct  154  KLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLDLEENKIVDFIKFDVGNVV  213

Query  621  MVTGGR  638
            MVTGGR
Sbjct  214  MVTGGR  219



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   365 bits (936),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  27   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  86

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  87   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  146

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  147  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  206

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  207  VMVTGGR  213



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   364 bits (934),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+L YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  TKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   363 bits (933),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   363 bits (933),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   363 bits (933),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL SI+DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSIKDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   364 bits (934),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = +3

Query  63   QLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYS  242
            QL   +ARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+
Sbjct  2    QLLGFLARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYA  61

Query  243  LTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIR  422
            LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I 
Sbjct  62   LTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAIS  121

Query  423  DEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKF  602
             +E KFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKF
Sbjct  122  GDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKF  181

Query  603  DVGNVVMVTGGR  638
            DVGNVVMVTGGR
Sbjct  182  DVGNVVMVTGGR  193



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   365 bits (937),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  37   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  96

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  97   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  156

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  157  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  216

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  217  VMVTGGR  223



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   363 bits (933),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   363 bits (932),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   363 bits (932),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   362 bits (930),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 185/187 (99%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   362 bits (930),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   362 bits (929),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   362 bits (929),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   363 bits (933),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = +3

Query  69   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLT  248
            +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LT
Sbjct  47   TPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  106

Query  249  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  428
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDE
Sbjct  107  YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  166

Query  429  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDV  608
            EAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLDLE NK+V+FIKFDV
Sbjct  167  EAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLDLEENKIVEFIKFDV  226

Query  609  GNVVMVTGGR  638
            GNVVMVTGGR
Sbjct  227  GNVVMVTGGR  236



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   362 bits (929),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VDFIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   362 bits (928),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   361 bits (927),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKY+L YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTMENYRLLYDTKGRFRLHPIRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 184/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+ K+VD+IKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENYKIVDYIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   361 bits (927),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AK
Sbjct  61   VISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   361 bits (926),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGLKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   362 bits (928),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  138

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVR++Q G+KGIPF+NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVV
Sbjct  139  KLCKVRTIQLGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVV  198

Query  621  MVTGGR  638
            MVTGGR
Sbjct  199  MVTGGR  204



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   361 bits (926),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+V+FIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVNFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   361 bits (926),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VIS LMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISSLMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNV
Sbjct  121  FKLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   362 bits (929),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 184/201 (92%), Gaps = 15/201 (7%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREV
Sbjct  41   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  100

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFM---------------DVVSIPKTNENFRLFYDTK  395
            ISILMQRHVLVDGKVRTDKTYP+GFM               DVVSIPKTNENFRL YDTK
Sbjct  101  ISILMQRHVLVDGKVRTDKTYPSGFMVQVVVFFESNVTLVTDVVSIPKTNENFRLLYDTK  160

Query  396  GRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLES  575
            GRFRLHSIRD+EAKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLES
Sbjct  161  GRFRLHSIRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLES  220

Query  576  NKVVDFIKFDVGNVVMVTGGR  638
            NK+ DFIKFDVGNVVMVTGGR
Sbjct  221  NKITDFIKFDVGNVVMVTGGR  241



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   360 bits (923),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVGNV
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   360 bits (925),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = +3

Query  72   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTY  251
              MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTY  84

Query  252  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEE  431
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  432  AKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVG  611
            AKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IKFDVG
Sbjct  145  AKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIKFDVG  204

Query  612  NVVMVTGGR  638
            NVVMVTGGR
Sbjct  205  NVVMVTGGR  213



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   360 bits (923),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKF  138

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVVDFIKFDVGNVV
Sbjct  139  KLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVDFIKFDVGNVV  198

Query  621  MVTGGR  638
            MVTGGR
Sbjct  199  MVTGGR  204



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   359 bits (921),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   357 bits (917),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR +LVDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE++K
Sbjct  61   VQSILMQRQILVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDSK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   358 bits (918),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYREV
Sbjct  18   ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  77

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  78   ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  137

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK++DFIKFDVGNVV
Sbjct  138  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIMDFIKFDVGNVV  197

Query  621  MVTGGR  638
            MVTGGR
Sbjct  198  MVTGGR  203



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   357 bits (917),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = +3

Query  60   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  239
            ++     ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  2    SECKILQARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  61

Query  240  SLTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  419
            +LTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  62   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  121

Query  420  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIK  599
            RDEEAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+VD IK
Sbjct  122  RDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVDSIK  181

Query  600  FDVGNVVMVTGGR  638
            FDVGNVVMVTGGR
Sbjct  182  FDVGNVVMVTGGR  194



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   357 bits (916),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG+KGIP++NT DGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTNDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   356 bits (913),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +3

Query  69   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLT  248
            + TM RGLKKH+KRLNAPK W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LT
Sbjct  14   TPTMTRGLKKHLKRLNAPKIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  73

Query  249  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  428
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DE
Sbjct  74   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDE  133

Query  429  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDV  608
            EAKFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDV
Sbjct  134  EAKFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDV  193

Query  609  GNVVMVTGGR  638
            GNVVMVTGGR
Sbjct  194  GNVVMVTGGR  203



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   355 bits (911),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYP GFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPTGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREV  260
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYREV
Sbjct  137  ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  196

Query  261  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  440
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  197  ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  256

Query  441  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVV  620
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+V
Sbjct  257  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIV  316

Query  621  MVTGGR  638
            MVTGGR
Sbjct  317  MVTGGR  322



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   354 bits (909),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MTRGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNV
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  75   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYR  254
            TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LTYR
Sbjct  42   TMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  101

Query  255  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  434
            EVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DEEA
Sbjct  102  EVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDEEA  161

Query  435  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGN  614
            KFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NKVV+FIKFDVGN
Sbjct  162  KFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKVVEFIKFDVGN  221

Query  615  VVMVTGGR  638
            VVMVTGGR
Sbjct  222  VVMVTGGR  229



>ref|NP_001189539.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AEC06617.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=184

 Score =   349 bits (896),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVG  
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGKC  180

Query  618  V  620
            V
Sbjct  181  V  181



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   352 bits (902),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 5/187 (3%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPK+WMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKYWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS     AK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS-----AK  115

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNV
Sbjct  116  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNV  175

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  176  VMVTGGR  182



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   350 bits (898),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  69   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLT  248
            + TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY+LT
Sbjct  58   TPTMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  117

Query  249  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  428
            YREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DE
Sbjct  118  YREVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDE  177

Query  429  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDV  608
            EAKFKLCKVR++ FG+KGIP++NTYDGR IRYPDPLIK NDT+KLDLE NKVV+FIKFDV
Sbjct  178  EAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLDLEENKVVEFIKFDV  237

Query  609  GNVVMVTGGR  638
            GNVVMVTGGR
Sbjct  238  GNVVMVTGGR  247



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   347 bits (890),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWM++KLGGAFAPKPSSGPHK+RECLPL+L++RNRLKY+LTY E
Sbjct  1    MARGLKKHVKRLNAPKHWMVEKLGGAFAPKPSSGPHKARECLPLILMLRNRLKYALTYSE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SI+MQRH++VDGKVRTDKTYPAGFMDVVSIPKT ENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VVSIMMQRHIMVDGKVRTDKTYPAGFMDVVSIPKTGENFRLLYDTKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR+VQ G+KG+P +NTYDGRTIRYPDP IK NDT+K+DLE+NK+VDFIKF+VGN 
Sbjct  121  FKLCKVRTVQCGQKGVPSLNTYDGRTIRYPDPAIKPNDTIKIDLETNKIVDFIKFEVGNF  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   340 bits (872),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKIDLETGKIKEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   340 bits (872),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 4/187 (2%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQRH+LVDGK+     +     DVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  116

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ DFIKFDVGNV
Sbjct  117  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLDLETNKITDFIKFDVGNV  176

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  177  VMVTGGR  183



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   339 bits (870),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKVDLETGKIKEFIKFDVGNV  180

Query  618  VMVTGGR  638
            +MVTGGR
Sbjct  181  IMVTGGR  187



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   335 bits (860),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVISILMQRH+LVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVISILMQRHILVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGR  169



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   335 bits (860),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGR  169



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   335 bits (858),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 168/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLETNKIVDFIKFDVGNVVMVTGGR  169



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDTVKLDLESNK+ DFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTVKLDLESNKITDFIKFDVGNVVMVTGGR  169



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   333 bits (855),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHVLVD KVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            INTYDGRTIRYPDPLIKANDT+KLDLE+NK+ +FIKFDVGNVVMVTGGR
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLDLETNKITEFIKFDVGNVVMVTGGR  169



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   332 bits (852),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHIFVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGR  169



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKY+LTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            INTYDGRTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGR
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGR  169



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 178/217 (82%), Gaps = 29/217 (13%)
 Frame = +3

Query  75   TMARGLKKHMKRLNAPKHWMLDKLGGAF-----------------------------APK  167
            TMARGLKKH+KRLNAP  W LDKLGGAF                             APK
Sbjct  60   TMARGLKKHLKRLNAPTIWGLDKLGGAFVCLLVSLYTHAFHLFIVWMTMLARIGSKQAPK  119

Query  168  PSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVV  347
            PSSGPHKSRECLPLVLIIRN+LKY+LTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVV
Sbjct  120  PSSGPHKSRECLPLVLIIRNKLKYALTYREVIAILMQRHIQVDGKVRTDKTYPAGFMDVV  179

Query  348  SIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYP  527
            SIPKTNE FRL YDTKGRFRLHSI+DEEAKFKLCKVR++ FG+KGIP++NTYDGR IRYP
Sbjct  180  SIPKTNECFRLLYDTKGRFRLHSIKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYP  239

Query  528  DPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            DPLIK NDT+KLDLE NKVV+FIKFDVGNVVMVTGGR
Sbjct  240  DPLIKPNDTIKLDLEENKVVEFIKFDVGNVVMVTGGR  276



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   330 bits (847),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGR  169



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   330 bits (845),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIK NDT+KLDLE NK+V+FIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGR  169



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY+LTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGR  169



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   328 bits (840),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   327 bits (839),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   327 bits (837),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGR  169



>gb|KFK40122.1| hypothetical protein AALP_AA3G333200 [Arabis alpina]
Length=216

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIR+RLKY+LTY EVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRDRLKYALTYSEVISILMQRHIQVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIK NDT+KLDLE+NK+V+FIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGR  169



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   328 bits (840),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFDVGN+
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDVGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   325 bits (833),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGR  169



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKY+LTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVR+ QFG KG+P + T+DGRTIRYPDPLIKANDTVK++LE+ KVV+FIKFD+GN+
Sbjct  121  YKLCKVRAAQFGDKGVPHVTTFDGRTIRYPDPLIKANDTVKINLETGKVVEFIKFDIGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   325 bits (832),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGRKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+K DLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKFDLESNKIVDFIKFDVGNVVMVTGGR  169



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   324 bits (831),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKY+LTYREVISILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVISILMQRHVMVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKFKLCKVRSVQFG+KGIPF
Sbjct  61   DKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKFKLCKVRSVQFGQKGIPF  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NT DGRTIRYPDPLIKANDT+K+DLE+NK+VDFIKFDVGN+VMVTGGR
Sbjct  121  LNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNIVMVTGGR  169



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  132  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRT  311
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  312  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  491
            DKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETKFKLCKVRSVQFGQKGIPY  120

Query  492  INTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            +NTYDGRTIRYPDPLIKANDT+KLDLE+NK+VDFIKFDVGNVVMVTGGR
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLDLENNKIVDFIKFDVGNVVMVTGGR  169



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   317 bits (813),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = +3

Query  153  AFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAG  332
            + APKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHVLVDGKVRTDKTYPAG
Sbjct  10   SLAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAG  69

Query  333  FMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGR  512
            FMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGIP++NTYDGR
Sbjct  70   FMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPYLNTYDGR  129

Query  513  TIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            TIRYPDPLIKANDT+KLDLESNK+ DFIKFDVGNVVMVTGGR
Sbjct  130  TIRYPDPLIKANDTIKLDLESNKITDFIKFDVGNVVMVTGGR  171



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   315 bits (807),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  150  GAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPA  329
            G  APKPSSGPHKSRECLPL+L++RNRLKY+LTYREVI+ILMQRHVLVDGKVRTDKTYPA
Sbjct  47   GLQAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPA  106

Query  330  GFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDG  509
            GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDG
Sbjct  107  GFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDG  166

Query  510  RTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            RTIRYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGR
Sbjct  167  RTIRYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGR  209



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL Y+LTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINAEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGNV
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  APKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGFM  338
            APKPSSGPHKSRECLPL+L++RNRLKY+LTYREVI+ILMQRHVLVDGKVRTDKTYPAGFM
Sbjct  20   APKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFM  79

Query  339  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  518
            DVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDGRTI
Sbjct  80   DVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTI  139

Query  519  RYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            RYPDPLIKANDT+KLDLE NK+ DFIKFDVGN+VMVTGGR
Sbjct  140  RYPDPLIKANDTIKLDLEENKITDFIKFDVGNIVMVTGGR  179



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL Y+LTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINSEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+DLE+ K+ +FIKFDVGN+
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKIDLETGKIKEFIKFDVGNL  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  APKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGFM  338
            APKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  339  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  518
            DVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  519  RYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            RYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  123  RYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGR  162



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = +3

Query  156  FAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGF  335
            +APKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRTDKTYPAGF
Sbjct  16   YAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGF  75

Query  336  MDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRT  515
            MDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRT
Sbjct  76   MDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRT  135

Query  516  IRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            IRYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  136  IRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGR  176



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  APKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQRHVLVDGKVRTDKTYPAGFM  338
            APKPSSGPHKSRECLPL+LI+RNRLKY+LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  339  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  518
            DVVSIPKTNE+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  519  RYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            RYPDPLIKANDT+KLDLESNK+VDFIKFDVGNVVMVTGGR
Sbjct  123  RYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGR  162



>dbj|GAN07411.1| 40S ribosomal protein S4 [Mucor ambiguus]
 dbj|GAN00618.1| 40S ribosomal protein S4 [Mucor ambiguus]
Length=262

 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRL APKHWMLDKL GA+APKPSSGPHK RECLPL++ IRNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGAYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KG+P+I T+DGR+IRYPDPLIKANDT++ +LE+NK+ +F+KF+VGNV
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRSIRYPDPLIKANDTIRFNLETNKIEEFVKFEVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CEG70586.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI95018.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKVR V  G KG+P+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVRKVMIGAKGVPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EIE83303.1| 40S ribosomal protein S4 [Rhizopus delemar RA 99-880]
Length=263

 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ ++E+ K+ DF+KFDVGN+
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRTIRYPDPLIKTNDTVRFNIETGKIEDFVKFDVGNI  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CEG72922.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI90971.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVLVGAKGIPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CEI87363.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVLIGAKGIPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>ref|XP_005850141.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
 gb|EFN58039.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
Length=261

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKH+KRLNAPKHWMLDKLGG FAPKPS GPHK+RECLPL+L++RNRLKY+LT +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLGGIFAPKPSPGPHKTRECLPLILLLRNRLKYALTGKE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTDKTYP GFMDV+ IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VTSILMQRLVEVDGKVRTDKTYPVGFMDVIDIPKTDEHFRLVYDAKGRFVVHRITKEEAS  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ + FGK GIP I T+DGRT+RYPDP IK NDTV LDLES KV DFIKFDVGN+
Sbjct  121  YKLCKVKRLAFGKGGIPHIGTHDGRTVRYPDPEIKVNDTVMLDLESGKVKDFIKFDVGNL  180

Query  618  VMVTGG  635
             M TGG
Sbjct  181  AMATGG  186



>gb|EIE90129.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ ++E+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFNIETGKIEDFVKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EIE79548.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKY+L  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ ++E+ K+ DF+KFDVGNV
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFNIETGKIEDFVKFDVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KFH71854.1| 40S ribosomal protein S4 [Mortierella verticillata NRRL 6337]
Length=259

 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKH+KRLNAPKHWMLDKL G +AP+P++GPHK RECLPLV++IRNRLKY+L  +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLTGTYAPRPTAGPHKLRECLPLVILIRNRLKYALNGKE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD TYPAGFMD ++I KT ENFRL YDTKGRF +H I  EEA+
Sbjct  61   VQSILMQRLVKVDGKVRTDSTYPAGFMDAITIEKTGENFRLVYDTKGRFTVHRITAEEAQ  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ VQ G KGIPF+ T+DGRT+RYPDPLIK NDT+KLDLES K  +FIKF+VGNV
Sbjct  121  YKLCKVKKVQLGAKGIPFVVTHDGRTLRYPDPLIKVNDTIKLDLESGKFNEFIKFEVGNV  180

Query  618  VMVTGGR  638
             MVTGGR
Sbjct  181  AMVTGGR  187



>emb|CEP14949.1| hypothetical protein [Parasitella parasitica]
Length=264

 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK RECLPL++ IRNRLKY+L  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ +LES+K+ +F+KF+VGNV
Sbjct  121  YKLCKVKKVLVGSKGVPYITTHDGRTIRYPDPLIKVNDTVRFNLESSKIEEFVKFEVGNV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KDD75424.1| hypothetical protein H632_c691p0 [Helicosporidium sp. ATCC 50920]
Length=262

 Score =   294 bits (752),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPL+L++RNRLKY+LT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSSGPHKTRECLPLILMLRNRLKYALTGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILM R V VDGKVRTDKTYP GFMDVV+IPKT+E+FRL YD+KGRF +H I  EEA 
Sbjct  61   VTSILMNRLVEVDGKVRTDKTYPVGFMDVVTIPKTSEHFRLIYDSKGRFAVHRITPEEAT  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ +QFG+ G+P++ T+DGRT+RYPDP I+  DTV  D+E NK+ DF++F+VGN+
Sbjct  121  YKLCKVKRMQFGRGGVPYVATHDGRTMRYPDPAIREGDTVVFDIEENKIRDFVRFEVGNL  180

Query  618  VMVTGG  635
             MVTGG
Sbjct  181  AMVTGG  186



>emb|CDH52779.1| 40s ribosomal protein s4 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=263

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRLNAPKHWMLDKL G++APKPS+GPHK+RECLPL++ +RNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLNAPKHWMLDKLLGSYAPKPSAGPHKTRECLPLIIFLRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V +ILMQR V VD KVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQAILMQRLVKVDHKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAIHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLC+V+ +  GKKGIP+  T+DGRT+RYPDP IK ND+V+ DLE+NK+ DF+KFD+GNV
Sbjct  121  YKLCRVKKITIGKKGIPYAVTHDGRTMRYPDPAIKVNDSVRFDLENNKITDFVKFDIGNV  180

Query  618  VMVTGGR  638
             MVTGGR
Sbjct  181  CMVTGGR  187



>emb|CDS09843.1| Putative 40S ribosomal protein S4-A [Absidia idahoensis var. 
thermophila]
Length=263

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKRLNAPKHWMLDKL G++APKPS+GPHK+RECLPL++ +RNRLKY+L  RE
Sbjct  1    MARGPKKHMKRLNAPKHWMLDKLLGSYAPKPSAGPHKTRECLPLIIFLRNRLKYALNGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V +ILMQR V VD KVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQAILMQRLVKVDHKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAIHRITDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLC+V+ +  GKKGIP+  T+DGRT+RYPDP IK ND+V+ DLE+NK+ DF+KFD+GNV
Sbjct  121  YKLCRVKKITIGKKGIPYAVTHDGRTMRYPDPAIKVNDSVRFDLENNKITDFVKFDIGNV  180

Query  618  VMVTGGR  638
             M+TGGR
Sbjct  181  CMITGGR  187



>gb|EPZ32691.1| 40S ribosomal protein S4 [Rozella allomycis CSF55]
Length=261

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKH+KRLNAPKHWMLDKL G +AP+PSSGPHK RE LPL++ +RNRLKY+LT  E
Sbjct  1    MTRGPKKHLKRLNAPKHWMLDKLSGVWAPRPSSGPHKLRESLPLIVFLRNRLKYALTGHE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V +I+MQR + VD K+RTD TYPAGFMDV+SI KTNENFRL YD KGRF +H I DEEAK
Sbjct  61   VTAIMMQRLIKVDHKIRTDSTYPAGFMDVISIEKTNENFRLIYDVKGRFTIHRISDEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLC+V+ +  G KGIP+I T+DGRTIRYPDPLI+ANDTVKL+LES K+ +FIKFD GNV
Sbjct  121  YKLCRVKKLAIGAKGIPYIVTHDGRTIRYPDPLIRANDTVKLNLESGKIEEFIKFDSGNV  180

Query  618  VMVTGGR  638
             M+TGGR
Sbjct  181  AMITGGR  187



>emb|CEG70587.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=255

 Score =   290 bits (742),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +3

Query  102  MKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQR  281
            MKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKY+L  REV SILMQR
Sbjct  1    MKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGREVQSILMQR  60

Query  282  HVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRS  461
             V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK+KLCKVR 
Sbjct  61   LVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAKYKLCKVRK  120

Query  462  VQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            V  G KG+P+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNVVMVTGGR
Sbjct  121  VMIGAKGVPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNVVMVTGGR  179



>dbj|BAK03384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   290 bits (742),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG KKHMKR+ AP HWMLDK+ G FAP+PS+GPHK RECLPL++++RNRL+Y+LT  E
Sbjct  1    MARGPKKHMKRIAAPSHWMLDKMSGVFAPRPSAGPHKLRECLPLIILLRNRLRYALTRTE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V  I+MQR + +DGKVRTD TYP GF DVV+I KT ENFRL +DTKGRF +  I  EEAK
Sbjct  61   VTKIVMQRLIKIDGKVRTDGTYPCGFQDVVTIDKTGENFRLLFDTKGRFVVQPISSEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ V  GK+GIPFI T+DGR IRYPDPLIKAND+VKLDLES K+ DF+KFD+G V
Sbjct  121  YKLCKVKRVTVGKEGIPFITTHDGRNIRYPDPLIKANDSVKLDLESGKITDFVKFDIGQV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CEI97230.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=255

 Score =   289 bits (739),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +3

Query  102  MKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQR  281
            MKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKY+L  REV SILMQR
Sbjct  1    MKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGREVQSILMQR  60

Query  282  HVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRS  461
             V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK+KLCKVR 
Sbjct  61   LVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAKYKLCKVRK  120

Query  462  VQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            V  G KG+P+I T+DGRTIRYPDPLIKANDT++ +LE+ K+ DF+KFDVGNVVMVTGGR
Sbjct  121  VMIGAKGVPYITTHDGRTIRYPDPLIKANDTIRFNLETGKIEDFVKFDVGNVVMVTGGR  179



>gb|KGG52703.1| hypothetical protein DI09_141p50 [Microsporidia sp. UGP3]
Length=261

 Score =   289 bits (740),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH+KR+ APK WMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKY+LT +E
Sbjct  1    MARGIKKHLKRMAAPKSWMLDKLSGTFAPRPSTGPHKLRECLPLIVFLRNRLKYALTRKE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V+SILMQR V VD KVRTD TYPAGFMDV+SI KTNENFRL YDTKGRF +H I +EEAK
Sbjct  61   VMSILMQRLVKVDHKVRTDTTYPAGFMDVISIEKTNENFRLLYDTKGRFVIHRISEEEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+  Q G KG+PFI T+DGRT RYPDP I+ NDTVK ++E+ K+ +FIKF+ GNV
Sbjct  121  YKLCKVKKCQLGAKGVPFIVTHDGRTFRYPDPSIRVNDTVKFNMETGKLEEFIKFETGNV  180

Query  618  VMVTGG  635
            VM+TGG
Sbjct  181  VMITGG  186



>emb|CCE33652.1| probable ribosomal protein S4.e, cytosolic [Claviceps purpurea 
20.1]
Length=260

 Score =   289 bits (740),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+CLPL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCLPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
              SILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKSILMQRLVKVDGKVRTDSTYPAGFMDVISIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DFIKFD G V
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLTTGKITDFIKFDTGAV  180

Query  618  VMVTGGR  638
             MVTGGR
Sbjct  181  AMVTGGR  187



>ref|XP_011402198.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
 gb|KFM29145.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
Length=263

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL+L++RNRLKY+LT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSAGPHKTRECLPLILLLRNRLKYALTGRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V++IL  R V VDGKVRTDKTYP GFMD ++IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VVAILKNRLVQVDGKVRTDKTYPVGFMDTITIPKTDEHFRLVYDAKGRFVVHRISKEEAT  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KLCKV+ +QFGK  IP+I T+DGRTIRYPDP I+ NDTV LDLE+ K+ +F+ FDVG++
Sbjct  121  YKLCKVKRMQFGKGAIPYIATHDGRTIRYPDPDIRENDTVLLDLETGKIREFVHFDVGSL  180

Query  618  VMVTGG  635
            VMVTGG
Sbjct  181  VMVTGG  186



>ref|XP_008600052.1| ribosomal family S4e [Beauveria bassiana ARSEF 2860]
 gb|EJP64351.1| ribosomal family S4e [Beauveria bassiana ARSEF 2860]
 gb|KGQ07265.1| 40S ribosomal protein S4 [Beauveria bassiana D1-5]
Length=259

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
              SILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TRSILMQRLVKVDGKVRTDMTYPAGFMDVISIEKTGENFRLIYDTKGRFTVHRIQAEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ GK GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DF+KFD G +
Sbjct  121  YKLGKVKRVQLGKGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLATGKITDFVKFDTGAI  180

Query  618  VMVTGGR  638
             MVTGGR
Sbjct  181  AMVTGGR  187



>ref|XP_003052651.1| 40S ribosomal protein S4 [Nectria haematococca mpVI 77-13-4]
 gb|EEU46938.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=261

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
              SILMQR V VDGKVRTD TYP+GFMDV++I KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKSILMQRLVKVDGKVRTDSTYPSGFMDVITIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DFIKFD G V
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLATGKITDFIKFDTGAV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|KID72648.1| Ribosomal protein S4e, partial [Metarhizium brunneum ARSEF 3297]
Length=261

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+CLPL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCLPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
              +ILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDMTYPAGFMDVISIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DFIKFD G V
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLATGKITDFIKFDTGAV  180

Query  618  VMVTGGR  638
             MVTGGR
Sbjct  181  AMVTGGR  187



>ref|XP_009259092.1| hypothetical protein FPSE_07699 [Fusarium pseudograminearum CS3096]
 ref|XP_011320018.1| 40S ribosomal protein S4 [Fusarium graminearum PH-1]
 gb|EKJ72074.1| hypothetical protein FPSE_07699 [Fusarium pseudograminearum CS3096]
 gb|ESU14593.1| 40S ribosomal protein S4 [Fusarium graminearum PH-1]
 gb|EYB29880.1| hypothetical protein FG05_08714 [Fusarium graminearum]
 emb|CEF77124.1| unnamed protein product [Fusarium graminearum]
Length=261

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V +ILMQR V VDGKVRTD T+P+GFMDV++I KT ENFRL YDTKGRF +H I++EEA+
Sbjct  61   VKAILMQRLVKVDGKVRTDSTFPSGFMDVITIEKTGENFRLVYDTKGRFTVHRIQNEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DFIKFD G V
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLATGKITDFIKFDTGAV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>gb|EXX69253.1| ribosomal 40S subunit protein S4A [Rhizophagus irregularis DAOM 
197198w]
Length=260

 Score =   288 bits (736),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG +KH+KRLNAPKHWMLDKL G +AP+PS GPHK RECLPLV+ +RNRLKY+LT ++
Sbjct  1    MARGPRKHLKRLNAPKHWMLDKLTGTYAPRPSPGPHKLRECLPLVIFLRNRLKYALTSKD  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
            V SILMQR V VDGKVRTD TYPAGFMDV+SI +  ENFRL YDTKGRF +H I  +EAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTYPAGFMDVISIERNGENFRLIYDTKGRFTVHRITADEAK  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G K IP+I T+DGRTIRYPDPLIK NDT++ D E+NK+ +FIKF+VGN+
Sbjct  121  YKLAKVKKVQVGSKAIPYIVTHDGRTIRYPDPLIKVNDTIRFDFETNKITEFIKFEVGNI  180

Query  618  VMVTGGR  638
             M+TGGR
Sbjct  181  AMITGGR  187



>gb|EGU80487.1| hypothetical protein FOXB_08947 [Fusarium oxysporum Fo5176]
 gb|ENH61974.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. cubense race 
1]
 emb|CCT70766.1| probable ribosomal protein S4.e, cytosolic [Fusarium fujikuroi 
IMI 58289]
 gb|EWG38854.1| 40S ribosomal protein S4 [Fusarium verticillioides 7600]
 gb|EWY88268.1| 40S ribosomal protein S4 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ40223.1| 40S ribosomal protein S4 [Fusarium oxysporum Fo47]
 gb|EWZ87681.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA41025.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK34072.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99148.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44856.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL88040.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM09131.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
 gb|EXM34680.1| 40S ribosomal protein S4 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=261

 Score =   287 bits (735),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  78   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYRE  257
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKY+L YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  258  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  437
              +ILMQR V VDGKVRTD TYP+GFMDV++I KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDSTYPSGFMDVITIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  438  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNV  617
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+DL + K+ DFIKFD G V
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKIDLATGKITDFIKFDTGAV  180

Query  618  VMVTGGR  638
            VMVTGGR
Sbjct  181  VMVTGGR  187



>emb|CEP15508.1| hypothetical protein [Parasitella parasitica]
Length=255

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +3

Query  102  MKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYSLTYREVISILMQR  281
            MKRL APKHWMLDKL GA+APKPSSGPHK RECL L++ IRNRLKY+L  REV SILMQR
Sbjct  1    MKRLAAPKHWMLDKLLGAYAPKPSSGPHKQRECLSLIVFIRNRLKYALNGREVQSILMQR  60

Query  282  HVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRS  461
             V VDGKVRTD T+PAGFMDV++I KT ENFRL YD KGRF +H I DEEAK+KLCKV+ 
Sbjct  61   LVKVDGKVRTDSTFPAGFMDVITIEKTGENFRLVYDVKGRFAIHRITDEEAKYKLCKVKK  120

Query  462  VQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLDLESNKVVDFIKFDVGNVVMVTGGR  638
            V  G KGIP+I T+DGRT+RYPDPLIKANDTV+ +LESNK+ +F+KF+VGNVVMVTGGR
Sbjct  121  VLVGSKGIPYITTHDGRTMRYPDPLIKANDTVRFNLESNKIEEFVKFEVGNVVMVTGGR  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750