BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031E06

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB41076.1|  MAR-binding protein                                    351   6e-115   Nicotiana tabacum [American tobacco]
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          350   2e-114   Nicotiana sylvestris
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          349   4e-114   Nicotiana tomentosiformis
emb|CAN73717.1|  hypothetical protein VITISV_038844                     343   4e-113   Vitis vinifera
emb|CBI34244.3|  unnamed protein product                                342   1e-112   Vitis vinifera
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2          344   2e-112   
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...    344   2e-112   
emb|CDP04715.1|  unnamed protein product                                339   6e-112   Coffea canephora [robusta coffee]
ref|XP_008649917.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    335   9e-112   
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          342   2e-111   Vitis vinifera
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298              338   3e-111   
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          342   3e-111   Nelumbo nucifera [Indian lotus]
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2          342   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2          342   4e-111   Elaeis guineensis
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2          338   7e-111   Phoenix dactylifera
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2          339   1e-110   Solanum lycopersicum
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...    340   2e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008671899.1|  PREDICTED: probable nucleolar protein 5-2          335   2e-110   
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2          339   3e-110   Zea mays [maize]
ref|XP_010097360.1|  hypothetical protein L484_010238                   338   3e-110   
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like     338   3e-110   Solanum tuberosum [potatoes]
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2          338   5e-110   Zea mays [maize]
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260          338   7e-110   
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2          339   9e-110   Elaeis guineensis
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1          338   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008666415.1|  PREDICTED: probable nucleolar protein 5-2          332   2e-109   
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2          337   2e-109   Brachypodium distachyon [annual false brome]
ref|NP_001050112.1|  Os03g0350100                                       337   3e-109   
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like     337   4e-109   Setaria italica
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed             336   4e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like     336   5e-109   Oryza brachyantha
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...    336   6e-109   Phoenix dactylifera
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...    337   6e-109   Phoenix dactylifera
ref|NP_001050113.1|  Os03g0350300                                       336   6e-109   
dbj|BAN15014.1|  SAR DNA binding protein                                334   1e-108   Bromus inermis [awnless brome grass]
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2          335   1e-108   Beta vulgaris subsp. vulgaris [field beet]
emb|CAK22424.1|  matrix attachment region binding protein               335   1e-108   Beta vulgaris [beet]
dbj|BAA31260.1|  SAR DNA binding protein                                332   1e-108   Oryza sativa [red rice]
gb|EEC75255.1|  hypothetical protein OsI_11566                          338   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          335   1e-108   Sesamum indicum [beniseed]
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like     335   2e-108   Setaria italica
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          334   4e-108   Sesamum indicum [beniseed]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...    334   4e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          334   4e-108   Eucalyptus grandis [rose gum]
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             333   4e-108   Prunus persica
ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          333   5e-108   Prunus mume [ume]
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                       331   4e-107   Triticum urartu
ref|XP_002533223.1|  nucleolar protein nop56, putative                  330   8e-107   Ricinus communis
gb|KDP23603.1|  hypothetical protein JCGZ_23436                         330   1e-106   Jatropha curcas
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                329   2e-106   Erythranthe guttata [common monkey flower]
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                329   3e-106   Erythranthe guttata [common monkey flower]
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     327   9e-106   Glycine max [soybeans]
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2          327   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          327   1e-105   
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          327   1e-105   Pyrus x bretschneideri [bai li]
gb|KHN25404.1|  Putative nucleolar protein 5-2                          327   2e-105   Glycine soja [wild soybean]
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     327   2e-105   Glycine max [soybeans]
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          327   2e-105   
ref|XP_002512277.1|  nucleolar protein nop56, putative                  327   3e-105   Ricinus communis
gb|KDP35364.1|  hypothetical protein JCGZ_10348                         326   6e-105   Jatropha curcas
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2          325   8e-105   Brachypodium distachyon [annual false brome]
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             325   8e-105   Phaseolus vulgaris [French bean]
gb|KJB26511.1|  hypothetical protein B456_004G245100                    318   1e-103   Gossypium raimondii
ref|XP_006838803.1|  hypothetical protein AMTR_s00002p00260990          323   1e-103   Amborella trichopoda
gb|KJB82563.1|  hypothetical protein B456_013G202500                    317   2e-103   Gossypium raimondii
gb|KJB45049.1|  hypothetical protein B456_007G287100                    317   2e-103   Gossypium raimondii
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2          321   6e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70798.1|  hypothetical protein M569_03961                         315   7e-103   Genlisea aurea
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2-li...    319   1e-102   Cucumis sativus [cucumbers]
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2          319   1e-102   Cucumis melo [Oriental melon]
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     319   1e-102   Citrus sinensis [apfelsine]
gb|KJB26509.1|  hypothetical protein B456_004G245100                    319   2e-102   Gossypium raimondii
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...    315   2e-102   
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like     318   2e-102   Cicer arietinum [garbanzo]
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             318   3e-102   Citrus clementina [clementine]
gb|KJB45047.1|  hypothetical protein B456_007G287100                    319   3e-102   Gossypium raimondii
ref|XP_004139212.1|  PREDICTED: probable nucleolar protein 5-2-li...    318   3e-102   
gb|KJB82560.1|  hypothetical protein B456_013G202500                    318   3e-102   Gossypium raimondii
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                    318   4e-102   Gossypium arboreum [tree cotton]
ref|XP_008650437.1|  PREDICTED: probable nucleolar protein 5-2          315   4e-102   
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                    318   4e-102   Gossypium arboreum [tree cotton]
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g             316   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          315   5e-101   Populus euphratica
ref|XP_007030689.1|  NOP56-like pre RNA processing ribonucleoprot...    310   5e-101   
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          315   5e-101   Populus euphratica
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                    315   5e-101   Gossypium arboreum [tree cotton]
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...    315   5e-101   
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g             315   7e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2          314   2e-100   Populus euphratica
ref|XP_003611088.1|  SAR DNA-binding protein-1                          313   9e-100   Medicago truncatula
gb|AAC16330.1|  SAR DNA-binding protein-1                               310   9e-99    Pisum sativum [garden pea]
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...    309   9e-99    
ref|XP_003606983.1|  SAR DNA-binding protein-1                          309   2e-98    
tpg|DAA47456.1|  TPA: hypothetical protein ZEAMMB73_782083              300   2e-98    
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          309   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          307   4e-98    Tarenaya hassleriana [spider flower]
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    307   7e-98    Citrus sinensis [apfelsine]
gb|ACJ85748.1|  unknown                                                 307   7e-98    Medicago truncatula
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    307   9e-98    Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    307   1e-97    Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    307   1e-97    Citrus sinensis [apfelsine]
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             306   2e-97    Citrus clementina [clementine]
tpg|DAA47457.1|  TPA: hypothetical protein ZEAMMB73_782083              301   8e-97    
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             299   5e-95    Eutrema salsugineum [saltwater cress]
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                    300   9e-95    
emb|CDX80674.1|  BnaC07g27700D                                          298   2e-94    
gb|AAC16331.1|  SAR DNA-binding protein-2                               298   2e-94    Pisum sativum [garden pea]
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1          297   3e-94    Brassica rapa
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1          297   4e-94    Brassica rapa
emb|CDY00004.1|  BnaC09g02970D                                          296   5e-94    
emb|CDY19706.1|  BnaA09g03590D                                          296   5e-94    Brassica napus [oilseed rape]
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1          296   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...    296   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1          295   3e-93    Camelina sativa [gold-of-pleasure]
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                    293   6e-93    Arabis alpina [alpine rockcress]
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             293   2e-92    Eutrema salsugineum [saltwater cress]
emb|CDY52494.1|  BnaAnng11410D                                          290   1e-91    Brassica napus [oilseed rape]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572             290   1e-91    Arabidopsis lyrata subsp. lyrata
gb|EEE59058.1|  hypothetical protein OsJ_10836                          290   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|NP_187157.1|  putative SAR DNA-binding protein                      290   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAN72071.1|  SAR DNA-binding protein - like                          286   3e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CAE45597.1|  SAR DNA-binding protein-like protein                   289   5e-91    Lotus japonicus
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)            286   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          288   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          289   7e-91    Camelina sativa [gold-of-pleasure]
ref|XP_001756465.1|  predicted protein                                  288   1e-90    
ref|NP_198064.1|  putative SAR DNA-binding protein                      286   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          285   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_001753892.1|  predicted protein                                  286   2e-89    
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610             284   4e-89    
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200               281   8e-89    Arabis alpina [alpine rockcress]
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2          283   1e-88    Fragaria vesca subsp. vesca
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             283   6e-88    
gb|KDO50620.1|  hypothetical protein CISIN_1g0088522mg                  268   7e-88    Citrus sinensis [apfelsine]
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             280   1e-87    
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841             278   3e-86    Selaginella moellendorffii
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625             273   3e-84    Selaginella moellendorffii
ref|XP_005850162.1|  hypothetical protein CHLNCDRAFT_57124              282   3e-84    Chlorella variabilis
ref|XP_005650009.1|  Nop-domain-containing protein                      259   3e-79    Coccomyxa subellipsoidea C-169
gb|KJB26512.1|  hypothetical protein B456_004G245100                    253   2e-77    Gossypium raimondii
gb|KIY95194.1|  putative nucleolar protein NOP5-2                       244   2e-76    Monoraphidium neglectum
gb|AAZ31075.2|  MAR-binding protein                                     249   1e-75    Dunaliella salina
gb|ACA96503.1|  MAR-binding protein                                     249   2e-75    Dunaliella salina
emb|CEF96991.1|  NOSIC                                                  245   1e-74    Ostreococcus tauri
ref|XP_002507734.1|  nucleolar RNA binding protein                      244   2e-74    Micromonas commoda
emb|CDY50583.1|  BnaC02g39570D                                          245   3e-74    Brassica napus [oilseed rape]
ref|XP_009496003.1|  hypothetical protein H696_03867                    241   2e-73    Fonticula alba
gb|AAY34142.1|  Nop58p                                                  241   2e-73    Physarum polycephalum
ref|XP_001416562.1|  predicted protein                                  241   4e-73    Ostreococcus lucimarinus CCE9901
ref|XP_007512606.1|  predicted protein                                  240   7e-73    Bathycoccus prasinos
emb|CAJ82550.1|  nucleolar protein 5                                    238   7e-72    Xenopus tropicalis [western clawed frog]
ref|XP_006681446.1|  hypothetical protein BATDEDRAFT_33621              238   9e-72    Batrachochytrium dendrobatidis JAM81
ref|NP_989298.1|  NOP58 ribonucleoprotein                               238   2e-71    Xenopus tropicalis [western clawed frog]
gb|AAH77204.1|  MGC78950 protein                                        238   2e-71    Xenopus laevis [clawed frog]
ref|NP_001086628.1|  NOP58 ribonucleoprotein                            238   2e-71    Xenopus laevis [clawed frog]
gb|AAI30064.1|  LOC398558 protein                                       235   1e-70    Xenopus laevis [clawed frog]
gb|AAH44082.1|  LOC398558 protein                                       235   1e-70    Xenopus laevis [clawed frog]
gb|KHN07217.1|  Putative nucleolar protein 5-2                          225   2e-70    Glycine soja [wild soybean]
gb|AAI06292.1|  LOC398558 protein                                       235   2e-70    Xenopus laevis [clawed frog]
ref|XP_005995462.1|  PREDICTED: nucleolar protein 58 isoform X1         234   3e-70    Latimeria chalumnae
ref|XP_005995463.1|  PREDICTED: nucleolar protein 58 isoform X2         234   4e-70    Latimeria chalumnae
ref|XP_005777664.1|  hypothetical protein EMIHUDRAFT_206438             229   5e-70    Emiliania huxleyi CCMP1516
emb|CDH51673.1|  loc398558 protein                                      233   9e-70    Lichtheimia corymbifera JMRC:FSU:9682
gb|KDD76960.1|  putative snoRNA binding domain-containing protein       232   1e-69    Helicosporidium sp. ATCC 50920
ref|XP_005771074.1|  hypothetical protein EMIHUDRAFT_75659              229   1e-69    Emiliania huxleyi CCMP1516
emb|CDS04923.1|  hypothetical protein LRAMOSA07453                      232   1e-69    Lichtheimia ramosa
ref|XP_002166198.2|  PREDICTED: nucleolar protein 58-like               228   2e-69    
tpg|DAA42144.1|  TPA: hypothetical protein ZEAMMB73_016967              226   4e-69    
ref|XP_003611091.1|  SAR DNA-binding protein-1                          221   4e-69    
ref|XP_001690352.1|  nucleolar protein, component of C/D snoRNPs        231   6e-69    Chlamydomonas reinhardtii
ref|XP_011399356.1|  putative nucleolar protein 5-2                     230   7e-69    Auxenochlorella protothecoides
ref|XP_007501981.1|  PREDICTED: nucleolar protein 58 isoform X4         229   3e-68    Monodelphis domestica
ref|XP_007501980.1|  PREDICTED: nucleolar protein 58 isoform X3         229   3e-68    Monodelphis domestica
ref|XP_007501979.1|  PREDICTED: nucleolar protein 58 isoform X2         229   3e-68    Monodelphis domestica
ref|XP_003230376.2|  PREDICTED: nucleolar protein 58-like               229   4e-68    Anolis carolinensis [Carolina anole]
ref|XP_006567771.1|  PREDICTED: nucleolar protein 58-like               230   4e-68    Apis mellifera [bee]
ref|XP_001371978.1|  PREDICTED: nucleolar protein 58 isoform X1         229   4e-68    Monodelphis domestica
ref|XP_006618628.1|  PREDICTED: nucleolar protein 58-like               230   4e-68    Apis dorsata [rock honeybee]
ref|XP_003056558.1|  nucleolar RNA binding protein                      227   7e-68    Micromonas pusilla CCMP1545
emb|CEI90787.1|  Putative NOSIC domain-containing protein               218   1e-67    Rhizopus microsporus
ref|XP_003491528.1|  PREDICTED: nucleolar protein 58-like               228   3e-67    Bombus impatiens
ref|XP_002598583.1|  hypothetical protein BRAFLDRAFT_113716             226   4e-67    Branchiostoma floridae
gb|EIE91295.1|  hypothetical protein RO3G_16006                         226   4e-67    Rhizopus delemar RA 99-880
ref|XP_001750802.1|  hypothetical protein                               224   9e-67    Monosiga brevicollis MX1
gb|EFX84998.1|  hypothetical protein DAPPUDRAFT_300779                  225   9e-67    Daphnia pulex
emb|CEP14638.1|  hypothetical protein                                   224   2e-66    Parasitella parasitica
gb|EIE85756.1|  hypothetical protein RO3G_10466                         223   2e-66    Rhizopus delemar RA 99-880
ref|XP_008618047.1|  hypothetical protein SDRG_13728                    223   3e-66    Saprolegnia diclina VS20
gb|KDO24106.1|  hypothetical protein SPRG_10894                         223   3e-66    Saprolegnia parasitica CBS 223.65
ref|XP_009054674.1|  hypothetical protein LOTGIDRAFT_144966             222   8e-66    Lottia gigantea
dbj|GAN04212.1|  nop-domain-containing protein                          222   1e-65    Mucor ambiguus
ref|XP_008113176.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    220   1e-65    Anolis carolinensis [Carolina anole]
gb|EPB89396.1|  hypothetical protein HMPREF1544_03765                   222   1e-65    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011064344.1|  PREDICTED: nucleolar protein 58-like               225   2e-65    Acromyrmex echinatior
emb|CEI87149.1|  Putative U3 snoRNP protein Nop58                       218   2e-65    Rhizopus microsporus
ref|XP_011341650.1|  PREDICTED: nucleolar protein 58                    224   4e-65    Ooceraea biroi
ref|XP_006897028.1|  PREDICTED: nucleolar protein 58-like               211   6e-65    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_011267939.1|  PREDICTED: nucleolar protein 58                    224   6e-65    Camponotus floridanus
emb|CEG70655.1|  Putative Nucleolar protein 58                          219   1e-64    Rhizopus microsporus
emb|CEI96131.1|  Putative Nucleolar protein 58                          219   1e-64    Rhizopus microsporus
ref|XP_007422082.1|  PREDICTED: nucleolar protein 58                    219   2e-64    Python bivittatus
ref|XP_009086324.1|  PREDICTED: nucleolar protein 58                    219   3e-64    Serinus canaria [canary]
emb|CCA22673.1|  nucleolar protein NOP5 putative                        218   3e-64    Albugo laibachii Nc14
ref|XP_006273562.1|  PREDICTED: nucleolar protein 58                    219   3e-64    Alligator mississippiensis
ref|XP_005519952.1|  PREDICTED: nucleolar protein 58                    219   3e-64    Pseudopodoces humilis [Tibetan ground-jay]
gb|EMC81163.1|  Nucleolar protein 58                                    217   3e-64    
ref|XP_005049217.1|  PREDICTED: nucleolar protein 58                    219   4e-64    Ficedula albicollis
ref|XP_006017720.1|  PREDICTED: nucleolar protein 58                    218   5e-64    Alligator sinensis
ref|XP_010563240.1|  PREDICTED: nucleolar protein 58 isoform X2         217   5e-64    Haliaeetus leucocephalus
ref|XP_010711773.1|  PREDICTED: nucleolar protein 58                    218   6e-64    Meleagris gallopavo [common turkey]
ref|XP_421942.1|  PREDICTED: nucleolar protein 58                       218   6e-64    Gallus gallus [bantam]
gb|EGW06124.1|  Nucleolar protein 58                                    209   6e-64    Cricetulus griseus [Chinese hamsters]
ref|XP_004378293.1|  PREDICTED: nucleolar protein 58                    218   8e-64    Trichechus manatus latirostris
ref|XP_010563232.1|  PREDICTED: nucleolar protein 58 isoform X1         218   1e-63    Haliaeetus leucocephalus
ref|XP_009836884.1|  hypothetical protein H257_11594                    217   1e-63    Aphanomyces astaci
emb|CAG04989.1|  unnamed protein product                                207   1e-63    Tetraodon nigroviridis
ref|XP_005306283.1|  PREDICTED: nucleolar protein 58 isoform X1         217   1e-63    Chrysemys picta bellii
ref|XP_005144700.1|  PREDICTED: nucleolar protein 58                    217   1e-63    Melopsittacus undulatus
ref|XP_002874404.1|  hypothetical protein ARALYDRAFT_326985             215   1e-63    
ref|XP_005511378.1|  PREDICTED: nucleolar protein 58                    217   1e-63    
ref|XP_005837542.1|  hypothetical protein GUITHDRAFT_66997              216   2e-63    Guillardia theta CCMP2712
ref|XP_002189225.1|  PREDICTED: nucleolar protein 58                    217   2e-63    Taeniopygia guttata
ref|XP_008872332.1|  hypothetical protein H310_08394                    216   2e-63    Aphanomyces invadans
ref|XP_003743589.1|  PREDICTED: nucleolar protein 58                    217   3e-63    Galendromus occidentalis
emb|CBJ32359.1|  conserved unknown protein                              216   4e-63    Ectocarpus siliculosus
ref|XP_002903084.1|  nucleolar protein NOP5                             216   4e-63    Phytophthora infestans T30-4
ref|XP_004367446.1|  matrix attachment region binding protein           216   4e-63    Acanthamoeba castellanii str. Neff
ref|XP_008911207.1|  hypothetical protein PPTG_15671                    214   8e-63    Phytophthora parasitica INRA-310
gb|ETI38018.1|  hypothetical protein F443_16119                         214   8e-63    Phytophthora parasitica P1569
gb|ETL31667.1|  hypothetical protein L916_15560                         214   8e-63    Phytophthora parasitica
gb|ESA16249.1|  hypothetical protein GLOINDRAFT_158776                  213   9e-63    
ref|XP_010493886.1|  PREDICTED: probable nucleolar protein 5-2          202   1e-62    Camelina sativa [gold-of-pleasure]
ref|XP_009530825.1|  hypothetical protein PHYSODRAFT_246404             213   2e-62    Phytophthora sojae
ref|XP_008187145.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    213   3e-62    
ref|XP_003907873.1|  PREDICTED: nucleolar protein 58 isoform X1         210   5e-62    
ref|XP_005574023.1|  PREDICTED: nucleolar protein 58 isoform X4         211   6e-62    
gb|AAH87637.1|  Nol5 protein                                            211   7e-62    Rattus norvegicus [brown rat]
ref|XP_002407966.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...    212   8e-62    Ixodes scapularis [blacklegged tick]
ref|XP_006636806.1|  PREDICTED: nucleolar protein 58-like               213   8e-62    
dbj|BAE21954.1|  unnamed protein product                                211   1e-61    Mus musculus [mouse]
gb|KFH64217.1|  hypothetical protein MVEG_10042                         212   1e-61    Mortierella verticillata NRRL 6337
ref|XP_007190607.1|  PREDICTED: nucleolar protein 58 isoform X6         210   1e-61    Balaenoptera acutorostrata scammoni
ref|XP_001641027.1|  predicted protein                                  211   1e-61    Nematostella vectensis
ref|XP_011308274.1|  PREDICTED: nucleolar protein 58                    213   1e-61    Fopius arisanus
gb|AAC23535.1|  unknown                                                 210   1e-61    Rattus sp. [rats]
dbj|BAJ91724.1|  predicted protein                                      213   2e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAH91951.1|  hypothetical protein                                   210   2e-61    Pongo abelii [orang utan]
ref|XP_003701979.1|  PREDICTED: nucleolar protein 58-like               213   2e-61    Megachile rotundata
ref|XP_005574021.1|  PREDICTED: nucleolar protein 58 isoform X2         210   2e-61    Macaca fascicularis [crab eating macaque]
ref|XP_004701594.1|  PREDICTED: nucleolar protein 58                    211   3e-61    Echinops telfairi [lesser hedgehog tenrec]
dbj|BAE22082.1|  unnamed protein product                                210   3e-61    Mus musculus [mouse]
ref|XP_009236281.1|  PREDICTED: nucleolar protein 58                    210   3e-61    
ref|XP_003483763.1|  PREDICTED: nucleolar protein 58                    211   4e-61    
ref|XP_007520557.1|  PREDICTED: nucleolar protein 58                    211   4e-61    Erinaceus europaeus [common hedgehog]
ref|XP_008556600.1|  PREDICTED: nucleolar protein 58                    212   4e-61    
ref|NP_057018.1|  nucleolar protein 58                                  211   5e-61    Homo sapiens [man]
ref|XP_005070655.1|  PREDICTED: nucleolar protein 58 isoform X2         211   5e-61    
ref|XP_006153110.1|  PREDICTED: nucleolar protein 58-like isoform X1    211   5e-61    Tupaia chinensis
ref|XP_006889153.1|  PREDICTED: nucleolar protein 58                    211   5e-61    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AAH09306.1|  NOP58 protein                                           210   5e-61    Homo sapiens [man]
ref|XP_005858297.1|  PREDICTED: nucleolar protein 58 isoform X1         211   5e-61    Myotis brandtii
gb|EXX52337.1|  Nop58p                                                  213   5e-61    Rhizophagus irregularis DAOM 197198w
ref|XP_004764235.1|  PREDICTED: nucleolar protein 58 isoform X2         211   5e-61    
ref|XP_008144676.1|  PREDICTED: nucleolar protein 58                    211   5e-61    Eptesicus fuscus
ref|XP_005858298.1|  PREDICTED: nucleolar protein 58 isoform X2         210   6e-61    
ref|XP_005397115.1|  PREDICTED: nucleolar protein 58                    210   6e-61    Chinchilla lanigera
ref|XP_004904636.1|  PREDICTED: nucleolar protein 58                    210   6e-61    
ref|XP_004393512.1|  PREDICTED: nucleolar protein 58 isoform 2          210   6e-61    Odobenus rosmarus divergens
ref|XP_006734635.1|  PREDICTED: nucleolar protein 58 isoform X2         210   6e-61    Leptonychotes weddellii
ref|XP_005070654.1|  PREDICTED: nucleolar protein 58 isoform X1         211   6e-61    Mesocricetus auratus [Syrian golden hamster]
ref|XP_005366385.1|  PREDICTED: nucleolar protein 58 isoform X2         210   6e-61    
ref|XP_004764234.1|  PREDICTED: nucleolar protein 58 isoform X1         210   6e-61    Mustela putorius furo [black ferret]
ref|XP_006921426.1|  PREDICTED: nucleolar protein 58 isoform X1         210   6e-61    Pteropus alecto
ref|XP_003820813.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    Pan paniscus [bonobo]
ref|XP_516036.2|  PREDICTED: nucleolar protein 58 isoform X1            210   7e-61    Pan troglodytes
ref|XP_003497458.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    Cricetulus griseus [Chinese hamsters]
ref|NP_001248115.1|  nucleolar protein 58                               210   7e-61    Macaca mulatta [rhesus macaque]
ref|XP_006734634.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    Leptonychotes weddellii
ref|XP_006756294.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    Myotis davidii
ref|XP_004426861.1|  PREDICTED: nucleolar protein 58                    210   7e-61    
ref|XP_007964075.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    
ref|XP_002712586.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    
ref|XP_003406179.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    
ref|XP_004393511.1|  PREDICTED: nucleolar protein 58 isoform 1          210   7e-61    
ref|NP_068522.1|  nucleolar protein 58                                  210   7e-61    
ref|XP_005640604.1|  PREDICTED: nucleolar protein 58 isoform X2         210   7e-61    
ref|XP_005640603.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    
ref|XP_006975091.1|  PREDICTED: nucleolar protein 58 isoform X1         210   7e-61    
ref|XP_003254003.1|  PREDICTED: nucleolar protein 58                    210   7e-61    
ref|XP_003785079.1|  PREDICTED: nucleolar protein 58                    210   7e-61    
ref|XP_008063382.1|  PREDICTED: nucleolar protein 58                    210   8e-61    
ref|XP_007090043.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_006935540.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_008833672.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
dbj|BAC31822.1|  unnamed protein product                                210   8e-61    
ref|XP_011223162.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_005366384.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_008685594.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_002749695.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|NP_061356.2|  nucleolar protein 58                                  210   8e-61    
gb|AAH44394.1|  Nop58 protein                                           209   8e-61    
ref|XP_010614435.1|  PREDICTED: nucleolar protein 58 isoform X1         210   8e-61    
ref|XP_006862038.1|  PREDICTED: nucleolar protein 58                    210   9e-61    
gb|ERE81087.1|  nucleolar protein 58                                    210   9e-61    
ref|XP_004601337.1|  PREDICTED: nucleolar protein 58                    210   1e-60    
ref|XP_004262889.1|  PREDICTED: nucleolar protein 58 isoform 2          209   1e-60    
gb|AAI55195.1|  Nop58 protein                                           210   1e-60    
ref|XP_007469243.1|  PREDICTED: nucleolar protein 58 isoform X2         209   1e-60    
ref|XP_007190602.1|  PREDICTED: nucleolar protein 58 isoform X1         209   1e-60    
ref|NP_001009889.1|  nucleolar protein 58                               209   1e-60    
ref|XP_004262888.1|  PREDICTED: nucleolar protein 58 isoform 1          209   1e-60    
ref|XP_007469242.1|  PREDICTED: nucleolar protein 58 isoform X1         209   2e-60    
ref|XP_005165784.1|  PREDICTED: nucleolar protein 58 isoform X1         209   2e-60    
ref|XP_006205258.1|  PREDICTED: nucleolar protein 58 isoform X3         209   2e-60    
ref|XP_006189993.1|  PREDICTED: nucleolar protein 58 isoform X3         209   2e-60    
ref|XP_006189992.1|  PREDICTED: nucleolar protein 58 isoform X2         209   2e-60    
ref|XP_006205256.1|  PREDICTED: nucleolar protein 58 isoform X1         209   2e-60    
gb|EWM24974.1|  nucleolar protein expressed                             209   2e-60    
ref|XP_006189991.1|  PREDICTED: nucleolar protein 58 isoform X1         209   2e-60    
gb|AAI51885.1|  Nop58 protein                                           209   2e-60    
ref|XP_006205257.1|  PREDICTED: nucleolar protein 58 isoform X2         209   2e-60    
ref|XP_007117841.1|  PREDICTED: nucleolar protein 58 isoform X1         209   2e-60    
ref|XP_005338975.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    209   2e-60    
ref|NP_001179886.1|  nucleolar protein 58                               209   2e-60    
ref|XP_005676439.1|  PREDICTED: nucleolar protein 58 isoform X2         209   2e-60    
ref|XP_007908792.1|  PREDICTED: nucleolar protein 58                    209   2e-60    
ref|XP_005904317.1|  PREDICTED: nucleolar protein 58                    209   3e-60    
ref|XP_004004885.1|  PREDICTED: nucleolar protein 58                    208   3e-60    
ref|XP_002946402.1|  hypothetical protein VOLCADRAFT_102990             208   3e-60    
ref|XP_001601436.1|  PREDICTED: nucleolar protein 58                    209   3e-60    
ref|XP_005202669.1|  PREDICTED: nucleolar protein 58 isoform X1         209   3e-60    
gb|AAI51726.1|  NOP58 protein                                           208   3e-60    
ref|XP_005676438.1|  PREDICTED: nucleolar protein 58 isoform X1         209   3e-60    
ref|XP_005980258.1|  PREDICTED: nucleolar protein 58 isoform X2         208   3e-60    
ref|XP_003966575.1|  PREDICTED: nucleolar protein 58-like               208   4e-60    
ref|XP_011154526.1|  PREDICTED: nucleolar protein 58                    211   4e-60    
ref|XP_004458928.1|  PREDICTED: nucleolar protein 58 isoform 1          208   4e-60    
ref|XP_010141276.1|  PREDICTED: nucleolar protein 58                    207   4e-60    
emb|CAB55989.2|  hypothetical protein                                   206   5e-60    
ref|XP_005980257.1|  PREDICTED: nucleolar protein 58 isoform X1         208   5e-60    
ref|XP_007248939.1|  PREDICTED: nucleolar protein 58-like               208   6e-60    
emb|CCI10534.1|  unnamed protein product                                207   6e-60    
emb|CBK23082.2|  unnamed protein product                                208   6e-60    
ref|XP_011171488.1|  PREDICTED: nucleolar protein 58                    209   2e-59    
ref|XP_006082477.1|  PREDICTED: nucleolar protein 58                    205   8e-59    
ref|XP_008323109.1|  PREDICTED: nucleolar protein 58                    205   1e-58    
gb|KHN70664.1|  Nucleolar protein 58                                    204   1e-58    
gb|ERE81088.1|  nucleolar protein 58                                    204   2e-58    
gb|KFB40543.1|  AGAP002171-PA-like protein                              204   2e-58    
ref|XP_004524214.1|  PREDICTED: nucleolar protein 58-like               202   3e-58    
ref|XP_004929127.1|  PREDICTED: nucleolar protein 58-like isoform X3    202   6e-58    
ref|XP_003766066.1|  PREDICTED: nucleolar protein 58                    204   7e-58    
ref|XP_004929126.1|  PREDICTED: nucleolar protein 58-like isoform X2    202   8e-58    
ref|XP_004929125.1|  PREDICTED: nucleolar protein 58-like isoform X1    202   8e-58    
ref|XP_010885076.1|  PREDICTED: nucleolar protein 58                    202   9e-58    
ref|NP_001133496.1|  Nucleolar protein 5                                202   1e-57    
gb|AAY34140.1|  Nop58p                                                  197   1e-57    
ref|XP_011484149.1|  PREDICTED: nucleolar protein 58                    198   1e-57    
ref|XP_002052488.1|  GJ17567                                            201   2e-57    
gb|KFP49456.1|  Nucleolar protein 58                                    196   2e-57    
ref|XP_004350742.1|  MAR-binding protein                                202   3e-57    
gb|KFV47252.1|  Nucleolar protein 58                                    197   3e-57    
gb|KDR23571.1|  Nucleolar protein 58                                    201   4e-57    
ref|XP_009962135.1|  PREDICTED: nucleolar protein 58                    198   4e-57    
ref|XP_308017.5|  AGAP002171-PA                                         200   5e-57    
ref|XP_002116484.1|  hypothetical protein TRIADDRAFT_30778              198   5e-57    
ref|XP_003384738.1|  PREDICTED: nucleolar protein 58-like               199   7e-57    
ref|XP_001864867.1|  nucleolar protein NOP5                             200   7e-57    
ref|XP_007071996.1|  PREDICTED: nucleolar protein 58                    199   1e-56    
dbj|BAN20575.1|  hypothetical protein                                   199   1e-56    
gb|KFV18563.1|  Nucleolar protein 58                                    198   2e-56    
gb|KFV52995.1|  Nucleolar protein 58                                    195   2e-56    
ref|XP_005808115.1|  PREDICTED: nucleolar protein 58-like               198   3e-56    
gb|ETN58428.1|  nucleolar protein NOP5                                  198   3e-56    
gb|ENN72260.1|  hypothetical protein YQE_11121                          197   4e-56    
gb|KFO12035.1|  Nucleolar protein 58                                    197   4e-56    
gb|KFR14872.1|  Nucleolar protein 58                                    196   4e-56    
ref|XP_008283621.1|  PREDICTED: nucleolar protein 58 isoform X2         197   4e-56    
ref|XP_008283620.1|  PREDICTED: nucleolar protein 58 isoform X1         197   5e-56    
ref|XP_005484291.1|  PREDICTED: nucleolar protein 58                    197   5e-56    
ref|XP_973420.1|  PREDICTED: nucleolar protein 58                       197   6e-56    
ref|XP_009985382.1|  PREDICTED: nucleolar protein 58                    197   6e-56    
ref|XP_010738555.1|  PREDICTED: nucleolar protein 58                    197   8e-56    
sp|O04656.2|NOP5C_ARATH  RecName: Full=Putative nucleolar protein...    195   8e-56    
gb|EFA85918.1|  MAR-binding protein                                     198   1e-55    
ref|XP_003696631.1|  PREDICTED: nucleolar protein 58-like               199   1e-55    
ref|XP_668690.1|  snoRNA binding domain                                 195   1e-55    
gb|KFQ17268.1|  Nucleolar protein 58                                    196   1e-55    
gb|KGL97403.1|  Nucleolar protein 58                                    196   1e-55    
gb|KFP26270.1|  Nucleolar protein 58                                    196   1e-55    
gb|ETE66100.1|  Nucleolar protein 58                                    196   1e-55    
gb|KFP02491.1|  Nucleolar protein 58                                    194   1e-55    
gb|KFV10796.1|  Nucleolar protein 58                                    196   1e-55    
gb|KFQ12269.1|  Nucleolar protein 58                                    196   1e-55    
gb|KFO75339.1|  Nucleolar protein 58                                    196   2e-55    
gb|KFQ45269.1|  Nucleolar protein 58                                    196   2e-55    
gb|KFQ00730.1|  Nucleolar protein 58                                    196   2e-55    
ref|XP_004570504.1|  PREDICTED: nucleolar protein 58-like isoform X2    196   2e-55    
ref|XP_002430815.1|  Nucleolar protein NOP5, putative                   196   2e-55    
ref|XP_006809619.1|  PREDICTED: nucleolar protein 58-like               196   2e-55    
gb|KFP42804.1|  Nucleolar protein 58                                    196   2e-55    
ref|XP_004570503.1|  PREDICTED: nucleolar protein 58-like isoform X1    196   2e-55    
ref|XP_008423022.1|  PREDICTED: nucleolar protein 58                    196   2e-55    
ref|XP_005097537.1|  PREDICTED: nucleolar protein 58-like               196   2e-55    
ref|XP_005943428.1|  PREDICTED: nucleolar protein 58-like isoform X1    196   2e-55    
ref|XP_005943429.1|  PREDICTED: nucleolar protein 58-like isoform X2    196   2e-55    
ref|XP_005416180.1|  PREDICTED: nucleolar protein 58                    196   2e-55    
gb|KFQ94812.1|  Nucleolar protein 58                                    195   3e-55    
ref|XP_010076307.1|  PREDICTED: nucleolar protein 58                    195   3e-55    
gb|KFP88851.1|  Nucleolar protein 58                                    195   3e-55    
gb|KFZ49164.1|  Nucleolar protein 58                                    195   3e-55    
ref|XP_005237133.1|  PREDICTED: nucleolar protein 58                    196   3e-55    
ref|XP_005016922.1|  PREDICTED: nucleolar protein 58 isoform X2         195   4e-55    
ref|XP_005016921.1|  PREDICTED: nucleolar protein 58 isoform X1         195   4e-55    
gb|KFO59877.1|  Nucleolar protein 58                                    194   4e-55    
ref|XP_008947581.1|  PREDICTED: nucleolar protein 58                    196   4e-55    
ref|XP_005434610.1|  PREDICTED: nucleolar protein 58                    196   5e-55    
ref|XP_005465917.1|  PREDICTED: nucleolar protein 58                    195   5e-55    
ref|XP_004990291.1|  nucleolar protein 5                                194   5e-55    
gb|KFQ40527.1|  Nucleolar protein 58                                    194   5e-55    
ref|XP_008633036.1|  PREDICTED: nucleolar protein 58                    195   5e-55    
gb|EOB03329.1|  Nucleolar protein 5                                     193   5e-55    
gb|KFM11174.1|  Nucleolar protein 58                                    194   5e-55    
gb|KFV64288.1|  Nucleolar protein 58                                    194   5e-55    
gb|KFW61788.1|  Nucleolar protein 58                                    194   5e-55    
ref|XP_006130811.1|  PREDICTED: nucleolar protein 58                    194   6e-55    
gb|KFW02653.1|  Nucleolar protein 58                                    194   6e-55    
gb|KFQ74083.1|  Nucleolar protein 58                                    194   6e-55    
ref|XP_010202697.1|  PREDICTED: nucleolar protein 58                    194   6e-55    
gb|KFU84958.1|  Nucleolar protein 58                                    194   6e-55    
ref|XP_009938133.1|  PREDICTED: nucleolar protein 58                    194   7e-55    
ref|XP_626779.1|  nucleolar protein NOP5/NOP58-like pre-mRNA spli...    193   7e-55    
ref|XP_010120485.1|  PREDICTED: nucleolar protein 58                    194   7e-55    
ref|XP_007565433.1|  PREDICTED: nucleolar protein 58 isoform X2         194   7e-55    
gb|KFW89632.1|  Nucleolar protein 58                                    194   7e-55    
emb|CCA71243.1|  probable NOP58-required for pre-18S rRNA processing    195   7e-55    
ref|XP_002088107.1|  GE18393                                            194   8e-55    
ref|XP_010784446.1|  PREDICTED: nucleolar protein 58 isoform X2         194   8e-55    
ref|XP_010784445.1|  PREDICTED: nucleolar protein 58 isoform X1         194   8e-55    
gb|KFP19825.1|  Nucleolar protein 58                                    194   8e-55    
gb|KFV86118.1|  Nucleolar protein 58                                    194   9e-55    
ref|XP_011432893.1|  PREDICTED: nucleolar protein 58-like               194   9e-55    
gb|KGL80295.1|  Nucleolar protein 58                                    194   1e-54    
tpg|DAA45360.1|  TPA: hypothetical protein ZEAMMB73_906298              182   1e-54    
ref|XP_010217344.1|  PREDICTED: nucleolar protein 58                    194   1e-54    
gb|EJW86153.1|  hypothetical protein WUBG_02934                         192   1e-54    
gb|KFP67783.1|  Nucleolar protein 58                                    193   1e-54    
gb|KFZ53794.1|  Nucleolar protein 58                                    193   1e-54    
ref|XP_009331224.1|  PREDICTED: nucleolar protein 58                    194   1e-54    
ref|XP_010405578.1|  PREDICTED: nucleolar protein 58                    194   2e-54    
gb|KFP74755.1|  Nucleolar protein 58                                    193   2e-54    
ref|XP_009682520.1|  PREDICTED: nucleolar protein 58                    193   2e-54    
ref|XP_781458.2|  PREDICTED: nucleolar protein 58                       193   2e-54    
gb|AES94049.2|  NOP56-like pre RNA processing ribonucleoprotein         182   2e-54    
ref|XP_009912989.1|  PREDICTED: nucleolar protein 58                    192   2e-54    
gb|KFQ66314.1|  Nucleolar protein 58                                    192   2e-54    
gb|EJY83562.1|  Nop multi-domain protein                                191   2e-54    
ref|XP_009867823.1|  PREDICTED: nucleolar protein 58                    192   2e-54    
ref|XP_010150930.1|  PREDICTED: nucleolar protein 58                    192   2e-54    
ref|XP_010005686.1|  PREDICTED: nucleolar protein 58                    194   2e-54    
ref|XP_009558103.1|  PREDICTED: nucleolar protein 58                    192   2e-54    
ref|XP_009489427.1|  PREDICTED: nucleolar protein 58                    192   2e-54    
ref|XP_010161415.1|  PREDICTED: nucleolar protein 58                    193   3e-54    
ref|XP_009894776.1|  PREDICTED: nucleolar protein 58                    192   3e-54    
ref|XP_008494188.1|  PREDICTED: nucleolar protein 58                    194   3e-54    
ref|XP_009067494.1|  PREDICTED: nucleolar protein 58                    192   3e-54    
ref|XP_009704053.1|  PREDICTED: nucleolar protein 58                    192   3e-54    
ref|XP_009460634.1|  PREDICTED: nucleolar protein 58                    194   4e-54    
gb|KFQ83091.1|  Nucleolar protein 58                                    192   4e-54    
ref|XP_008035630.1|  Nop-domain-containing protein                      192   5e-54    
gb|EPQ02705.1|  Nucleolar protein 58                                    192   6e-54    
ref|XP_009282980.1|  PREDICTED: nucleolar protein 58                    193   6e-54    
gb|EHJ76702.1|  hypothetical protein KGM_05763                          192   7e-54    
ref|XP_007364391.1|  Nop-domain-containing protein                      192   8e-54    
ref|XP_009641816.1|  PREDICTED: nucleolar protein 58                    192   9e-54    
ref|XP_009888542.1|  PREDICTED: nucleolar protein 58                    192   1e-53    
ref|XP_011495780.1|  PREDICTED: nucleolar protein 58                    191   2e-53    
ref|XP_009809548.1|  PREDICTED: nucleolar protein 58                    188   2e-53    
ref|NP_198066.1|  NOP56-like pre RNA processing ribonucleoprotein       189   2e-53    
emb|CDW76614.1|  UNKNOWN                                                189   2e-53    
ref|XP_007338313.1|  Nop-domain-containing protein                      192   2e-53    
ref|XP_009019750.1|  hypothetical protein HELRODRAFT_94516              192   2e-53    
emb|CCL99180.1|  predicted protein                                      190   3e-53    
gb|EMD41003.1|  hypothetical protein CERSUDRAFT_71225                   188   3e-53    
ref|XP_002737742.1|  PREDICTED: nucleolar protein 58-like               190   3e-53    
ref|XP_007862590.1|  Nop domain-containing protein                      190   4e-53    
gb|EPT03090.1|  hypothetical protein FOMPIDRAFT_1159146                 190   5e-53    
gb|ELW62707.1|  Nucleolar protein 58                                    189   5e-53    
gb|EFB14929.1|  hypothetical protein PANDA_007776                       187   6e-53    
ref|XP_005601801.1|  PREDICTED: nucleolar protein 58                    189   7e-53    
ref|XP_009267103.1|  Nucleolar protein 58                               189   1e-52    
ref|XP_002671988.1|  predicted protein                                  187   1e-52    
ref|XP_011213731.1|  PREDICTED: nucleolar protein 58                    187   2e-52    
ref|XP_011190691.1|  PREDICTED: nucleolar protein 58                    187   2e-52    
gb|KDQ20622.1|  hypothetical protein BOTBODRAFT_124315                  188   2e-52    
dbj|GAM26411.1|  hypothetical protein SAMD00019534_095860               189   2e-52    
ref|XP_008515601.1|  PREDICTED: nucleolar protein 58 isoform X2         187   3e-52    
ref|XP_007381782.1|  Nop-domain-containing protein                      188   3e-52    
gb|KDQ65010.1|  hypothetical protein JAAARDRAFT_167849                  188   3e-52    
gb|EMS19643.1|  nucleolar protein NOP58                                 187   4e-52    



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   351 bits (900),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   343 bits (881),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   342 bits (878),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TLAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARK+VKLKAFSKF+NTSEALSAA
Sbjct  1    MLALFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKIVKLKAFSKFDNTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL  QDL+PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDD+DKELNTYAMR
Sbjct  121  LSELISGLAAQDLSPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDIDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008649917.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleolar protein 5-2 
[Zea mays]
Length=329

 Score =   335 bits (859),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDT+I+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTIIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARK+VKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKMVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+TVMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNTVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFK+LDEGKL KVEDLWKEF+T+++ARK+VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKILDEGKLDKVEDLWKEFATSESARKIVKLKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRTHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT++ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTTDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score =   338 bits (868),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+H++ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHSNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL +ADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGIADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008671899.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=425

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TMIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010097360.1| hypothetical protein L484_010238 [Morus notabilis]
 gb|EXB67670.1| hypothetical protein L484_010238 [Morus notabilis]
Length=514

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDLW+EFSTAD+AR+VVKLKAFSKFENTSEAL A 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWREFSTADSARQVVKLKAFSKFENTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGN IKEKLQ++CVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNIIKEKLQVECVHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score =   338 bits (868),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score =   338 bits (867),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGN+IKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNSIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score =   339 bits (869),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEFST+++ARKVVKLKAFSKFENTSEALS A
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALFKVLDEGKL KVEDLWKEF+T+++AR++VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGLALFKVLDEGKLDKVEDLWKEFATSESARQIVKLKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008666415.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=420

 Score =   332 bits (852),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            EMLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  21   EMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  80

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL+IDC+HNS VMELMRGLRN
Sbjct  81   ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRN  140

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  141  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  200

Query  646  RV  651
            RV
Sbjct  201  RV  202



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLD+GKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDQGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCVHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGL+NQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCVHNSVVMELMRGLKNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR LRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRRLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +1

Query  94   R*AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSE  273
            R   EMLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+
Sbjct  85   RAVREMLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSD  144

Query  274  ALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            ALSAATL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR
Sbjct  145  ALSAATLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMR  204

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            GLRNQLTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELN
Sbjct  205  GLRNQLTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELN  264

Query  634  TYAMRV  651
            TYAMRV
Sbjct  265  TYAMRV  270



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF+T D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFATPDSARQVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF++ D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFASPDSARQVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVE----DLWKEFSTADTARKVVKLKAFSKFENTSEA  276
            ML+LFETPAGFALFKVLDEGKLSKVE    DLWKEFST+++ARKVVKLKAFSKFENTSEA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVESGLQDLWKEFSTSESARKVVKLKAFSKFENTSEA  60

Query  277  LSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            LSAATLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG
Sbjct  61   LSAATLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QLTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT
Sbjct  121  VRSQLTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNT  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGK+SKVEDLW+EFS+A++A+KVVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKVSKVEDLWQEFSSAESAKKVVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T LI+SKP KGLRKFLR+HCDG++LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TCLIESKPYKGLRKFLRAHCDGESLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS VEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSSVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKLQIDC+HNS VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLQIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   330 bits (846),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+ AD+ARKVVKLKAFSKFENTS+AL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFANADSARKVVKLKAFSKFENTSKALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DS PSKGLRKFL+SHCDG+TLAVADSKLGNAIK+KL+IDCVHN+ VMELMRGLR+Q
Sbjct  61   TKLLDSAPSKGLRKFLKSHCDGETLAVADSKLGNAIKDKLKIDCVHNNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LT+LI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTDLISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+   SKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+I+CVHN+ +MELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCEGEILAVADSKLGNAIKEKLKIECVHNNAIMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT+AMR
Sbjct  121  LTELITGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTFAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDE KLSK EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEAKLSKAEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCDDDILAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDE K+SK+EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  27   MLLLFETPAGFALFKVLDERKVSKIEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  86

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  87   TLLIDSKPSKGLRKFLRSHCDDDVLAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  146

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  147  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  206

Query  649  V  651
            V
Sbjct  207  V  207



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   327 bits (839),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSNADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNXVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+   SKGLRKFLR+HCDG+ L VADSKLGNAIKEKL+I+CVH++ VMELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCDGEILGVADSKLGNAIKEKLKIECVHSNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF++ADTARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTSADTARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DS  SKGLRKFL+SHCDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRGLR Q
Sbjct  61   TKLLDSTTSKGLRKFLKSHCDGEILAVADSKLGNAIKDKLKIECVHNNAVMELMRGLRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLHAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDC H+S VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCRHDSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLW  FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWTNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCVHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_006838803.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFK+LDEGKL KV+DLWKEF+T D A+K+VKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKLLDEGKLDKVDDLWKEFTTVDNAKKIVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCD + LAVADSKLG+ IK+KLQI+C+HN+ V ELMR LR Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDNEILAVADSKLGSVIKDKLQIECIHNNAVTELMRCLRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIVGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KJB82563.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=416

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KJB45049.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=414

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLS++EDLWKEF+  D+A+KVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETCAGFALFKVLDEGKLSQIEDLWKEFADVDSAKKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLL +SKPSKGLRKFL++HC GDTLAVADSKLG+AIKEKLQIDC+HN+ VMELMRG+R+Q
Sbjct  61   TLLSESKPSKGLRKFLKAHCKGDTLAVADSKLGSAIKEKLQIDCLHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTY MR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYGMR  180



>gb|EPS70798.1| hypothetical protein M569_03961, partial [Genlisea aurea]
Length=392

 Score =   315 bits (806),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFST +++R+VVKLKAFSKFENT+EAL+AA
Sbjct  4    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSTPESSRQVVKLKAFSKFENTAEALTAA  63

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLI+SKPSKGLRKFLRSHC+G+ L VADSKLG++IKEKLQI+CVHN+ V ELMRG+R+Q
Sbjct  64   TLLIESKPSKGLRKFLRSHCEGEILGVADSKLGSSIKEKLQIECVHNNVVSELMRGIRSQ  123

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL +QDLAPMSLGLSHSLSRYKLKF+PDK+DTMI+Q I+LLDDLDKELN Y MR
Sbjct  124  LTELISGLALQDLAPMSLGLSHSLSRYKLKFTPDKIDTMIIQGIALLDDLDKELNIYVMR  183

Query  649  V  651
            V
Sbjct  184  V  184



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156444.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFA+FKVLDEGKLSKVEDL  EF+TAD ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFAIFKVLDEGKLSKVEDLSNEFATADAARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR+HCD +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDGKASKGLRKFLRAHCDNETLGVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_004139212.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156443.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
Length=566

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  100  AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEAL  279
            A  MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL
Sbjct  20   AVNMLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEAL  79

Query  280  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
             A TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGL
Sbjct  80   EATTLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGL  139

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQL ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTY
Sbjct  140  RNQLNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTY  199

Query  640  AMRV  651
            AMRV
Sbjct  200  AMRV  203



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_008650437.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=451

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 5/181 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPA F LFKVLD     KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPARFTLFKVLD-----KVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  55

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  56   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  115

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAMR
Sbjct  116  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAMR  175

Query  649  V  651
            V
Sbjct  176  V  176



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_007030689.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
 gb|EOY11191.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
Length=388

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  118  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  297
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  298  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  477
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  478  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRI  178



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE PAGFALFKVLDEGKL+ VEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFEIPAGFALFKVLDEGKLNNVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNTYVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score =   315 bits (808),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            +
Sbjct  181  I  181



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score =   315 bits (807),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNGVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGEMLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score =   313 bits (802),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+V+DLWKEFS+AD ARKVVKLK F KFEN SEA  AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLWKEFSSADAARKVVKLKGFQKFENISEATEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            +LLID K SKGLRKFLR+HCD +TLAVAD+KLG  IKEKL+IDCVH++ VME+MRG+R Q
Sbjct  61   SLLIDGKASKGLRKFLRAHCDNETLAVADTKLGTIIKEKLKIDCVHSNAVMEIMRGIRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+V+DL  +FSTAD ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLSLDFSTADAARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + LID K SKGLRKFLR+HCD + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   SCLIDGKTSKGLRKFLRAHCDDEILAVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  118  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  297
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  298  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  477
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  478  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRI  178



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQD+APMSLGLSHSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLSHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>tpg|DAA47456.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=309

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 12/182 (7%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  646  RV  651
            RV
Sbjct  262  RV  263



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL  EF TAD+ARKVVKLKAF+KF+NTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGNEFLTADSARKVVKLKAFNKFDNTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNAIKEKLKIDCVHNTAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL  +F TAD+ARKVVKLKAF+KFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGTDFLTADSARKVVKLKAFNKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+I+CVHNS VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNVIKEKLKIECVHNSAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSL+RYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLADQDLAPMSLGLSHSLARYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQD+APMSLGL HSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLPHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   307 bits (787),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF+  D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNRPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>tpg|DAA47457.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=469

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 12/182 (7%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  646  RV  651
            RV
Sbjct  262  RV  263



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEG+LS VEDL KEF++ D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGRLSNVEDLGKEFASPDSARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|AFW84118.1| hypothetical protein ZEAMMB73_870642 [Zea mays]
Length=586

 Score =   300 bits (768),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 171/186 (92%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL ETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  8    LLVLLETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  67

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGL KFL+ HC G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  68   TLIIDSKPSKGLHKFLQKHCQGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  127

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK-----VDTMIVQAISLLDDLDKELN  633
            LTELITG G QDL PMSLGLSHSLSRYKLKFSP+K     VDTMI+QAI LLDDLDK+LN
Sbjct  128  LTELITGFGAQDLGPMSLGLSHSLSRYKLKFSPEKACLISVDTMIIQAIGLLDDLDKDLN  187

Query  634  TYAMRV  651
            T+AMRV
Sbjct  188  TFAMRV  193



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADSARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVLDEGKLSKVEDL + FS+ADTARKVVKLKAFSKFENTSEAL +A
Sbjct  1    MLLLFETAAGFALFKVLDEGKLSKVEDLQQSFSSADTARKVVKLKAFSKFENTSEALKSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
             LLID K SK LRKFL  HC  +TL VAD+KL + IKEKLQIDCVHN  VMELMRG+R Q
Sbjct  61   NLLIDGKASKDLRKFLSVHCQNETLGVADTKLASIIKEKLQIDCVHNVGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADAARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS  EDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNAEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELLSGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCQGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS VEDL   FS+A +ARK+VKL+AF KF+NTSEAL A 
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSNVEDLGNLFSSAASARKMVKLQAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGEALAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPGGFAIFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C  +TLAVADSKLGN IKEKL IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLVEGTPSKGLRKFLKANCKDETLAVADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGEQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  649  V  651
            V
Sbjct  182  V  182



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 155/180 (86%), Gaps = 17/180 (9%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF             
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAF-------------  47

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
                ++KP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  48   ----NNKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  103

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKE N YAMR
Sbjct  104  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKEFNIYAMR  163



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  649  V  651
            V
Sbjct  182  V  182



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 156/181 (86%), Gaps = 14/181 (8%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE              VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVE--------------VVKLKAFSKFENTSEALEAA  46

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR+HC+ + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  47   TLLIDGKASKGLRKFLRAHCEDEMLAVADSKLGNMIKEKLKIDCVHNNAVMELMRGVRNQ  106

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTM+VQAI LLDDLDKELNTYAMR
Sbjct  107  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMVVQAIGLLDDLDKELNTYAMR  166

Query  649  V  651
            V
Sbjct  167  V  167



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VL ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIVLVETPAGFALFKVKDEGKLANLEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M++L ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIILVETPAGFALFKVKDEGKLANIEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADAARKMVKLKAFDKFENTTDALNAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + L+DSK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVDSKLPKGLRKFLKKQCQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+L ETPAGFA+FK+ DEGKL+ +EDL KEF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLILVETPAGFAVFKLKDEGKLANIEDLAKEFETAESARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG  D+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDHDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADLARKMVKLKAFEKFENTTDALNAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + L++SK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVESKLPKGLRKFLKKECQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M +LFETP GFA+FKVLDEGKLS VED+  EF TA +ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MHILFETPGGFAIFKVLDEGKLSNVEDIGNEFLTAKSARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG +DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDKDLAPMSLGLSHSLARYKLKFSTDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 160/197 (81%), Gaps = 16/197 (8%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IK+KL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGSPSKGLRKFLKANCQGETLAVADSKLGNVIKDKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK----------------VDTMIVQAI  600
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DK                VDTMI+QAI
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSVDKGYLTSVPTSYVGLFYLVDTMIIQAI  180

Query  601  SLLDDLDKELNTYAMRV  651
             LLDDLDKELNTYAMRV
Sbjct  181  GLLDDLDKELNTYAMRV  197



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 161/184 (88%), Gaps = 3/184 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVL-DEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEAL  279
            ML+LFE P GF LFKVL D+GK +K E  D+ KEF T ++ARKVVKLKAFSKFEN SEAL
Sbjct  1    MLLLFENPGGFMLFKVLKDDGKFTKAEAHDIAKEFETGESARKVVKLKAFSKFENMSEAL  60

Query  280  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
             AAT+LIDSKP+K LRKFL+ HC+G+ L VADSKLGN IKEKL+I+CVH++ VMELMRG+
Sbjct  61   EAATMLIDSKPTKDLRKFLKKHCEGEILGVADSKLGNIIKEKLKIECVHDNAVMELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+QL +++TGL +QD+APMSLGLSHSLSRYKLKFS DKVDTM++QAI LLDDLDKELNTY
Sbjct  121  RSQLNDVVTGLQLQDMAPMSLGLSHSLSRYKLKFSADKVDTMVIQAIGLLDDLDKELNTY  180

Query  640  AMRV  651
            AMRV
Sbjct  181  AMRV  184



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +M++L ETPAGF LFKV D GKLS VEDL KEF T D+ARK+VKL AF KF+NTSEAL A
Sbjct  35   KMILLVETPAGFGLFKVKDVGKLSNVEDLGKEFDTPDSARKMVKLLAFDKFDNTSEALEA  94

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
               L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+I+CVHN+ VMEL+RG+R+
Sbjct  95   VAKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIECVHNNAVMELLRGVRS  154

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q TELI+GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  155  QFTELISGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  214

Query  646  RV  651
            RV
Sbjct  215  RV  216



>gb|KDO50620.1| hypothetical protein CISIN_1g0088522mg, partial [Citrus sinensis]
Length=155

 Score =   268 bits (685),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK  573
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DK
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADK  155



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +ML LFETP GFALFKVL EGKLS VEDL  EF TA++ARK+V+LKAF KF+NTS+AL A
Sbjct  20   KMLALFETPGGFALFKVLKEGKLSNVEDLGNEFLTAESARKMVQLKAFDKFDNTSDALEA  79

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
               L +   SK LRKFL+S+CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+
Sbjct  80   VAKLREGTASKSLRKFLKSNCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRS  139

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q TELI+GLG  DLAPMSLGLSHSL+RY LKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  140  QFTELISGLGDNDLAPMSLGLSHSLARYTLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  199

Query  646  RV  651
            RV
Sbjct  200  RV  201



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK SKGL+KFL++ C G TLA+ADSKLG  I EKL+I C+HN+ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQTLAIADSKLGRIITEKLEISCIHNNGVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK SKGL+KFL++ C G  LA+ADSKLG  I EKL+I C+H++ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQILAIADSKLGRIITEKLEISCIHSNGVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_005850162.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
 gb|EFN58060.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
Length=1332

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  109   MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
             ML+LFE+ AGFALFKVLDEGKL + E  D+W +F T + A+KVVKLKAFSKFENT+EAL 
Sbjct  918   MLLLFESSAGFALFKVLDEGKLREAETKDVWSDFETPEAAKKVVKLKAFSKFENTTEALQ  977

Query  283   AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
             AA  L+DSK SKGL+KFL+ H +GDTLAV D+KLGN IKEKL I+C+++S VMEL RG+R
Sbjct  978   AAASLVDSKISKGLKKFLKKHAEGDTLAVLDAKLGNVIKEKLGINCLYSSGVMELTRGIR  1037

Query  463   NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
             NQLT L+ GL  QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYA
Sbjct  1038  NQLTNLVGGLSAQDLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYA  1097

Query  643   MRV  651
             MRV
Sbjct  1098  MRV  1100



>ref|XP_005650009.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25465.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=554

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 153/182 (84%), Gaps = 1/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVL E K+ + EDLW++F T D A+KVVKLKAFSKFE+T +AL+AA
Sbjct  1    MLLLFETAAGFALFKVLQENKIQETEDLWQDFQTLDAAQKVVKLKAFSKFESTIDALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L DSK SK L+KFL+ + DG TL VAD+KLG+ IKEKL I C++++ V EL RG+R+Q
Sbjct  61   TALGDSKLSKDLKKFLKKNADGKTLGVADAKLGSIIKEKLGIPCIYSNGVQELTRGVRSQ  120

Query  469  LTELITGL-GVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            +  LI+GL G QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  IEGLISGLAGGQDLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  646  RV  651
            RV
Sbjct  181  RV  182



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +1

Query  226  KVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEK  405
            KVV LKAFSKFENT+EAL AAT L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEK
Sbjct  4    KVVSLKAFSKFENTAEALEAATKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEK  63

Query  406  LQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTM  585
            L+IDC+HN++VMEL+RG+R QLTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTM
Sbjct  64   LKIDCIHNTSVMELLRGVRTQLTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTM  123

Query  586  IVQAISLLDDLDKELNTYAMRV  651
            IVQAI LLDDLDKELNTYAMR+
Sbjct  124  IVQAIGLLDDLDKELNTYAMRI  145



>gb|KIY95194.1| putative nucleolar protein NOP5-2 [Monoraphidium neglectum]
Length=313

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFET AG+ALFKV+ EGKL K EDL+K+F T D A+KVVKLKAFSKF+NT+EAL+AA
Sbjct  1    MLFLFETAAGYALFKVVKEGKLEKSEDLYKDFETLDAAQKVVKLKAFSKFQNTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK  KGL+KFL+ +  G+TLAV D+KLG+ IK+KL I CV++  V EL RG+R Q
Sbjct  61   TALVDSKLDKGLKKFLKKNATGETLAVLDAKLGSLIKDKLDIPCVYSGAVQELARGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSGLISGLAGADLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>gb|AAZ31075.2| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  649  V  651
            V
Sbjct  182  V  182



>gb|ACA96503.1| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  649  V  651
            V
Sbjct  182  V  182



>emb|CEF96991.1| NOSIC [Ostreococcus tauri]
Length=476

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV DE KL  VE L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEKKLGDVEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKSLKKFLTKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_002507734.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
 gb|ACO68992.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
Length=471

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG+ALFKV DEG L  VE   K FS+++ A+ +V L AFSKF+NTS+AL+A 
Sbjct  1    MLLLFETPAGYALFKVKDEGILENVE---KAFSSSEKAQNIVSLAAFSKFDNTSDALAAT  57

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              ++DSK  K L+KFL+ H  G+TLA+AD+KLG  IK+KL I C+ NS +MELMRG+R Q
Sbjct  58   AAMVDSKIGKDLKKFLKKHAIGETLALADAKLGGLIKDKLGISCISNSGIMELMRGVRRQ  117

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            + ELI GL   D+APM+LGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  118  VNELIGGLTDADVAPMALGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  177

Query  649  V  651
            V
Sbjct  178  V  178



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  187  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  366
            DL   FS+ ++ARK+VKLKAF KF+NTS+AL A   L++  PSKGLRKFL+++C G+TLA
Sbjct  17   DLGNVFSSPESARKMVKLKAFDKFDNTSDALEAVAKLVEGTPSKGLRKFLKANCKGETLA  76

Query  367  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  546
            VADSKLGN IKEKL IDCVHN+ VMEL+RG+R+QL+ELITGLG QDLAPMSLGLSHSL+R
Sbjct  77   VADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQLSELITGLGEQDLAPMSLGLSHSLAR  136

Query  547  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            YKLKFS DKVDTMI+QAI LLDDLDKELNTYAMRV
Sbjct  137  YKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMRV  171



>ref|XP_009496003.1| hypothetical protein H696_03867 [Fonticula alba]
 gb|KCV69438.1| hypothetical protein H696_03867 [Fonticula alba]
Length=447

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+ALF V +E KL+  + +WKEF TAD A K+VKL+AF KF+NT+EALSAA
Sbjct  1    MLVLFETSAGYALFSVKNESKLADTDSIWKEFETADKANKLVKLQAFGKFQNTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L+D+K  K L+ FL+S        D LAVAD+KLG  IKEKL I C HN  + ELMRG
Sbjct  61   TALLDNKVPKELKNFLKSEVLKKNLTDELAVADAKLGGVIKEKLGIACKHNDAINELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+Q + L++GL  ++L  M LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT
Sbjct  121  IRSQFSSLMSGLPEEELVAMQLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  180

Query  637  YAMRV  651
            YAMR+
Sbjct  181  YAMRI  185



>gb|AAY34142.1| Nop58p [Physarum polycephalum]
Length=474

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 151/185 (82%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKL + +D+WKEF T   A K+V LK+FSKF+NT++AL++A
Sbjct  1    MLVLFETAAGFALFKVLDEGKLKQTDDIWKEFETPSKAGKMVSLKSFSKFDNTADALASA  60

Query  289  TLLIDSKPSKGLRKFL-RSHCDG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++SK SK L+KFL ++  D    +TLAVAD  LG+AIK+KL I CV+++ V EL+RG
Sbjct  61   TALVESKVSKDLKKFLTKNIVDAGAKETLAVADKLLGSAIKDKLNIKCVYDTAVQELIRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R QL+ L+ G+   D+  M+LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDD+DKELN 
Sbjct  121  IRQQLSNLVAGMTESDVTTMALGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDMDKELNI  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>ref|XP_001416562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=474

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV  E KL   E L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKAEKKLQDAEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKNLKKFLSKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>ref|XP_007512606.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17206.1| predicted protein [Bathycoccus prasinos]
Length=482

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV DE KL  ++ L K FS+A++A+KVV +KAF KFENT++AL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEDKLKDIDALAKSFSSAESAKKVVSMKAFGKFENTTDALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              +++SK  K L+ FL+ H   +TLA+ADSKLG AIKEKL I+CV+++ VMELMRG+R+Q
Sbjct  61   ATMVESKVGKSLKTFLKKHVKDETLAIADSKLGVAIKEKLGIECVYSNNVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   D+APM+LGLSHSLSRYKLKFSP+KVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNELIGGLTDADIAPMALGLSHSLSRYKLKFSPEKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CAJ82550.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=482

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K LR   +    + LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_006681446.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77866.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
Length=518

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFK+LD+GK+S  +D+++ F T+  A K VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLFETPAGYALFKLLDDGKMSAPDDIYQSFETSQAANKTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K SK L+ FL     G    DTLAV DSKLG AI +KL I  V ++ V EL RG
Sbjct  61   TALVEGKISKNLKSFLSKEIAGKDLSDTLAVGDSKLGAAIAKKLNIKVVSDNAVNELFRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QL+ LITGL   D+  M LGLSHSLSRYKLKFSPDKVDTMI+QAI+LLDDLDKELNT
Sbjct  121  IRSQLSSLITGLAESDMNAMVLGLSHSLSRYKLKFSPDKVDTMIIQAIALLDDLDKELNT  180

Query  637  YAMRV  651
            YAMR 
Sbjct  181  YAMRA  185



>ref|NP_989298.1| NOP58 ribonucleoprotein [Xenopus (Silurana) tropicalis]
 gb|AAH64169.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=533

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K LR   +    + LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|AAH77204.1| MGC78950 protein [Xenopus laevis]
Length=533

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|NP_001086628.1| NOP58 ribonucleoprotein [Xenopus laevis]
 gb|AAI22513.1| MGC78950 protein [Xenopus laevis]
Length=534

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|AAI30064.1| LOC398558 protein [Xenopus laevis]
 gb|AAI60690.1| LOC398558 protein [Xenopus laevis]
Length=488

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|AAH44082.1| LOC398558 protein, partial [Xenopus laevis]
Length=489

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|KHN07217.1| Putative nucleolar protein 5-2, partial [Glycine soja]
Length=190

 Score =   225 bits (573),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 125/155 (81%), Gaps = 14/155 (9%)
 Frame = +1

Query  187  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  366
            DLWK FS  DTAR+VVKLKAFSKFENT EAL AATLLID K SKGLRKFLR +C+ +TL 
Sbjct  1    DLWKNFSCVDTARQVVKLKAFSKFENTLEALEAATLLIDGKASKGLRKFLRVYCENETLG  60

Query  367  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  546
                          +IDC+HN+ +M LMRG+RNQLTELI+GL VQD+APMSLGLSHSLSR
Sbjct  61   --------------KIDCIHNNAIMNLMRGVRNQLTELISGLPVQDMAPMSLGLSHSLSR  106

Query  547  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            YKLKF+ +KVDTMIVQAI LLDDL KELNTYAMRV
Sbjct  107  YKLKFTREKVDTMIVQAIDLLDDLGKELNTYAMRV  141



>gb|AAI06292.1| LOC398558 protein, partial [Xenopus laevis]
Length=526

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR   +    + LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005995462.1| PREDICTED: nucleolar protein 58 isoform X1 [Latimeria chalumnae]
Length=531

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SKGL+K L+   +    + LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005995463.1| PREDICTED: nucleolar protein 58 isoform X2 [Latimeria chalumnae]
Length=530

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SKGL+K L+   +    + LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005777664.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
 gb|EOD25235.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
Length=368

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  637  YAMRV  651
            YAMR+
Sbjct  181  YAMRL  185



>emb|CDH51673.1| loc398558 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=497

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  634  TYAMRV  651
            TY+MRV
Sbjct  181  TYSMRV  186



>gb|KDD76960.1| putative snoRNA binding domain-containing protein [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKL--SKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
            +LVLFE+PAG ALFKVL EGKL  ++ ED+W  F T + A+KVVKLKAFS+FE+T+EAL 
Sbjct  2    VLVLFESPAGLALFKVLKEGKLKEAETEDVWSNFETLEAAQKVVKLKAFSRFESTAEALQ  61

Query  283  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            +A  L++SK SKGL+K L+ H  G+TLAV D+KLG+ IKEKL I CV ++ V EL RG+R
Sbjct  62   SAASLVESKVSKGLKKLLKKHAAGETLAVLDAKLGSVIKEKLDIPCVFSAGVGELSRGIR  121

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL   +L PMSLGL+HSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTYA
Sbjct  122  HQMEGLLGGLSSAELRPMSLGLAHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYA  181

Query  643  MRV  651
            MRV
Sbjct  182  MRV  184



>ref|XP_005771074.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
 gb|EOD18645.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
Length=390

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  637  YAMRV  651
            YAMR+
Sbjct  181  YAMRL  185



>emb|CDS04923.1| hypothetical protein LRAMOSA07453 [Absidia idahoensis var. thermophila]
Length=496

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  634  TYAMRV  651
            TY+MRV
Sbjct  181  TYSMRV  186



>ref|XP_002166198.2| PREDICTED: nucleolar protein 58-like, partial [Hydra vulgaris]
Length=358

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KLS+V+DL+K+F T + A K+VKLK F KFE+T+EALSA 
Sbjct  1    MLVLFETPAGYAIFKLLDEKKLSQVDDLFKDFETPELASKIVKLKHFKKFEDTTEALSAV  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SK L+K ++   S    + LAVAD+K+GN IK+K  I+CV ++ V ELMRG+
Sbjct  61   TASIEGKMSKSLKKIMKKVASKEMHEELAVADAKIGNLIKDKFDINCVCSTAVNELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITG+  ++   MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMNGLITGITDKEFTAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>tpg|DAA42144.1| TPA: hypothetical protein ZEAMMB73_016967 [Zea mays]
Length=343

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  292  LLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQL  471
            ++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQL
Sbjct  1    MIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQL  60

Query  472  TELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            TELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMRV
Sbjct  61   TELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMRV  120



>ref|XP_003611091.1| SAR DNA-binding protein-1 [Medicago truncatula]
Length=191

 Score =   221 bits (564),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +1

Query  115  VLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATL  294
            VLFETPAGFALFK+LDEGKLS+ +DLW+EFS+AD ARKVVKL AFSKFE  SEA   A  
Sbjct  30   VLFETPAGFALFKLLDEGKLSQFQDLWEEFSSADAARKVVKLIAFSKFETISEATEEARF  89

Query  295  LIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKL--QIDCVHNSTVMELMRGLRNQ  468
            LID K SKGLRKFLR HCD +TL V D+KLG  IKEKL  +I C HN+ VMELMRG+R Q
Sbjct  90   LIDGKASKGLRKFLRPHCDNETLCVTDAKLGCIIKEKLGPKIKCFHNNAVMELMRGIRYQ  149

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIV  591
            LTEL+T L VQD+ PM LGLS SLS YKLK S DKV  +++
Sbjct  150  LTELVTDLAVQDMPPMRLGLSGSLSIYKLKHSADKVYILLI  190



>ref|XP_001690352.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP05611.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=508

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVL E KL + EDL  +F+T + A+KVVKLKAFSKFENT+EAL+AA
Sbjct  1    MLLLFETAAGFALFKVLKEKKLEEAEDLASDFATLEAAQKVVKLKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGD-TLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            T L+DSK SKGL+KFL+ H D D  LA+ D KLG+ ++EKL ++ + ++ V+EL RG+R+
Sbjct  61   TALVDSKLSKGLKKFLKKHVDEDEKLALLDKKLGSIVQEKLGLNVLWSNQVLELSRGIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLT LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  QLTGLISGLAGADLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  646  RV  651
            RV
Sbjct  181  RV  182



>ref|XP_011399356.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
 gb|KFM26424.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
Length=496

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
            +L+LFE+ AGFALFKVLDEGKL + E  D+W  F T D A+KVVKLKAFSKFENT++AL 
Sbjct  2    VLLLFESAAGFALFKVLDEGKLKEAETQDVWSSFETLDAAKKVVKLKAFSKFENTADALQ  61

Query  283  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            AA  L+DSK SK L+KFL+ H   DTLAV D+KLGN IKEKL+I CV+++ V EL RG+R
Sbjct  62   AAASLVDSKVSKSLKKFLKKHAGSDTLAVLDAKLGNVIKEKLEIPCVYSTGVSELTRGVR  121

Query  463  NQLTELITGLGVQ-DLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            NQL  L+ GLG + DL PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTY
Sbjct  122  NQLGGLLAGLGHEADLRPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTY  181

Query  640  AMRV  651
            AMRV
Sbjct  182  AMRV  185



>ref|XP_007501981.1| PREDICTED: nucleolar protein 58 isoform X4 [Monodelphis domestica]
Length=533

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_007501980.1| PREDICTED: nucleolar protein 58 isoform X3 [Monodelphis domestica]
Length=534

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_007501979.1| PREDICTED: nucleolar protein 58 isoform X2 [Monodelphis domestica]
Length=535

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_003230376.2| PREDICTED: nucleolar protein 58-like [Anolis carolinensis]
Length=539

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK  +K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNFKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_006567771.1| PREDICTED: nucleolar protein 58-like [Apis mellifera]
Length=578

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MR  648
            MR
Sbjct  181  MR  182



>ref|XP_001371978.1| PREDICTED: nucleolar protein 58 isoform X1 [Monodelphis domestica]
Length=540

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_006618628.1| PREDICTED: nucleolar protein 58-like [Apis dorsata]
Length=578

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MR  648
            MR
Sbjct  181  MR  182



>ref|XP_003056558.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
 gb|EEH59934.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
Length=469

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFK+ DE  +   E +    +T + A+ +V LKAFSKF+NT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKIKDERNIDDAEAIENALNTTEGAKNLVSLKAFSKFDNTAEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL+ + +G+ LAVAD+KLG  IKEKL I C++++ VMELMRG+R+Q
Sbjct  61   ASLVDSKLGKDLKKFLKKNAEGEILAVADAKLGGHIKEKLGIACIYSANVMELMRGVRHQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +LI GL   D+APMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNDLIGGLDDIDVAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  649  V  651
            V
Sbjct  181  V  181



>emb|CEI90787.1| Putative NOSIC domain-containing protein [Rhizopus microsporus]
Length=197

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>ref|XP_003491528.1| PREDICTED: nucleolar protein 58-like [Bombus impatiens]
Length=588

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDEDKLTEVENLYHDFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MR  648
            MR
Sbjct  181  MR  182



>ref|XP_002598583.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
 gb|EEN54595.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
Length=517

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 147/186 (79%), Gaps = 9/186 (5%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+L+E KL + E+L+K+F T + A K+VKLK F KF++T+EALSAA
Sbjct  1    MLVLFETPAGYAIFKLLNEKKLQETEELFKDFETPEKASKIVKLKHFQKFDDTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLR------SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  450
            T  ++ K SK ++K L+      +H   + LAVAD+KLGNAIK+KL + CVHN+ + ELM
Sbjct  61   TAAVEGKMSKTMKKMLKKIVAKEAH---EELAVADAKLGNAIKDKLDLQCVHNTAIAELM  117

Query  451  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  630
            R +++Q+  LITGL  +++A M+LGL+H LSRYKLKFSPDKVDTMI+QAI LLDDLDKEL
Sbjct  118  RCIKSQVNNLITGLPNKEMAAMALGLAHGLSRYKLKFSPDKVDTMIIQAICLLDDLDKEL  177

Query  631  NTYAMR  648
            N Y MR
Sbjct  178  NNYIMR  183



>gb|EIE91295.1| hypothetical protein RO3G_16006 [Rhizopus delemar RA 99-880]
Length=493

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELYRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>ref|XP_001750802.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84401.1| predicted protein [Monosiga brevicollis MX1]
Length=492

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 142/185 (77%), Gaps = 5/185 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFKV    KLS+  DL   F+T D A + VKLK F KFE+T EAL+AA
Sbjct  1    MLVLFETPAGYALFKVKKGVKLSEA-DLADVFATPDAANEAVKLKGFHKFEDTVEALTAA  59

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L + K SKGL+ FL+ +       DTLAV ++KLG  IKEKL I CV++S V ELMRG
Sbjct  60   TALTEGKLSKGLKSFLKDNIISKEVQDTLAVPEAKLGTVIKEKLGIQCVYDSGVQELMRG  119

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QL+ +I+GL   DL  M+LGL+HSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNT
Sbjct  120  IRSQLSAVISGLRESDLTAMTLGLAHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNT  179

Query  637  YAMRV  651
            Y MRV
Sbjct  180  YTMRV  184



>gb|EFX84998.1| hypothetical protein DAPPUDRAFT_300779 [Daphnia pulex]
Length=515

 Score =   225 bits (574),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL + ++L+++F T + A KVVKLK F KF +T+EALSA 
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLQQTDNLFQDFQTPEGASKVVKLKHFKKFTDTTEALSAT  60

Query  289  TLLIDSKPSKGLRKFLRS---HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SK LRK L+S       + LAVAD+KLG+AIKEKLQI+C+ NS + ELMR +
Sbjct  61   TAAIEGKLSKTLRKTLKSLFAEEAHEALAVADAKLGSAIKEKLQINCLSNSAIQELMRCI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q   L+ GL  Q++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+SLLDDLDKELN Y
Sbjct  121  RSQADSLMGGLPKQEMMAMALGLAHSLSRYKLKFSPDKIDTMIVQAVSLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  VMR  183



>emb|CEP14638.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 144/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K ++++KEF + D A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPDEIYKEFESVDKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L ++D KLG+++ +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLESEISEKEMKKEKLVISDPKLGSSVNKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRV  651
            TYAMRV
Sbjct  181  TYAMRV  186



>gb|EIE85756.1| hypothetical protein RO3G_10466 [Rhizopus delemar RA 99-880]
Length=467

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL++     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQAEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELCRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>ref|XP_008618047.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
 gb|EQC28399.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
Length=492

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  ++ LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMSSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>gb|KDO24106.1| hypothetical protein SPRG_10894 [Saprolegnia parasitica CBS 223.65]
Length=492

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>ref|XP_009054674.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
 gb|ESO94640.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
Length=471

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+L E KL K E+L+ +F + +TA KVVKLK F KF + +EALSAA
Sbjct  1    MLVLFETAAGYAVFKLLSEKKLQKAENLFNDFESPETASKVVKLKHFQKFGDMTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  ++ K SK L+K ++     D    LAV+D+KLGN IKEK Q+ CV NS++ ELMR +
Sbjct  61   TAAVEGKMSKTLKKVMKKLVAADAQEELAVSDAKLGNIIKEKYQLPCVSNSSIQELMRCI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++  MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQVDSLITGLPQKEIMAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRV  651
             MR 
Sbjct  181  TMRA  184



>dbj|GAN04212.1| nop-domain-containing protein [Mucor ambiguus]
Length=499

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 144/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRV  651
            TYAMRV
Sbjct  181  TYAMRV  186



>ref|XP_008113176.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Anolis 
carolinensis]
Length=424

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|EPB89396.1| hypothetical protein HMPREF1544_03765 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=501

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 144/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRV  651
            TYAMRV
Sbjct  181  TYAMRV  186



>ref|XP_011064344.1| PREDICTED: nucleolar protein 58-like [Acromyrmex echinatior]
 gb|EGI59331.1| Nucleolar protein 58 [Acromyrmex echinatior]
Length=644

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL++ EDL K+F T + A +++KL  F KFE+T+EAL AA
Sbjct  1    MLVLFETSAGYAIFKVLNENKLAQSEDLHKDFETPEAASRLLKLTYFHKFEDTTEALCAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC--DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T L++SK SK L+K LR+ C    + LAVAD+KLG AIK+KLQ+ CV N+ V ELMR +R
Sbjct  61   TALVNSKLSKSLKKTLRNCCIEAHEQLAVADAKLGCAIKDKLQLSCVSNTAVQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +QL  LI+G+  ++   M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLISGVTEKERTAMTLGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  643  MRV  651
            MR 
Sbjct  181  MRA  183



>emb|CEI87149.1| Putative U3 snoRNP protein Nop58 [Rhizopus microsporus]
Length=377

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>ref|XP_011341650.1| PREDICTED: nucleolar protein 58 [Cerapachys biroi]
 gb|EZA52528.1| Nucleolar protein [Cerapachys biroi]
Length=667

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 144/183 (79%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A KVVKLK F KFE+T+EAL+A+
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKSENLYLDFKTVEGANKVVKLKYFHKFEDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T +I+ K SK L+K L+S C    + LAVAD+KLGN+IK KLQ+ CV N+ + ELMR +R
Sbjct  61   TAIIEGKLSKSLKKTLKSCCSDLHEQLAVADAKLGNSIKNKLQVPCVSNTAIHELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q   L+T +  +D+  M+LGL+HSLSRYKLKFSPDKVD M++QA+ LLD+LDK+LN Y 
Sbjct  121  SQAESLVTEVNSKDMTAMALGLAHSLSRYKLKFSPDKVDIMVIQAVCLLDELDKQLNNYM  180

Query  643  MRV  651
            M+ 
Sbjct  181  MKT  183



>ref|XP_006897028.1| PREDICTED: nucleolar protein 58-like [Elephantulus edwardii]
Length=211

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALVEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQIDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_011267939.1| PREDICTED: nucleolar protein 58 [Camponotus floridanus]
 gb|EFN60271.1| Nucleolar protein 5 [Camponotus floridanus]
Length=675

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+K+F T + A K+VKL+ F KFE+ +EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTKSENLYKDFETPEDASKIVKLEHFHKFEDITEALAAT  60

Query  289  TLLIDSKPSKGLRKFLR-SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            T L+++K  K L+K LR S  D   LAVAD +LG+AIK+KL + CV N+ + ELMR +RN
Sbjct  61   TALVENKVPKSLKKALRQSPIDHQKLAVADLRLGHAIKDKLDVSCVSNNAIQELMRCIRN  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q+  LIT +  ++++ M+LGL+HSLSRYKLKFSPDK+DTM++QA+ LLDD+DKELN Y M
Sbjct  121  QMDSLITDVTKKEMSAMALGLAHSLSRYKLKFSPDKIDTMVIQAVCLLDDIDKELNNYIM  180

Query  646  RV  651
            R 
Sbjct  181  RA  182



>emb|CEG70655.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>emb|CEI96131.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMR  648
            AMR
Sbjct  181  AMR  183



>ref|XP_007422082.1| PREDICTED: nucleolar protein 58 [Python bivittatus]
Length=538

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL ++++LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEIDNLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKIGKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLISGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_009086324.1| PREDICTED: nucleolar protein 58 [Serinus canaria]
Length=527

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>emb|CCA22673.1| nucleolar protein NOP5 putative [Albugo laibachii Nc14]
Length=497

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+KVE + K+F T D A +++KLK F  F++T++A++A 
Sbjct  1    MLVLFETAAGHALFKVQDESKLAKVETITKQFETIDQANQLIKLKGFHAFKDTTQAVAAV  60

Query  289  TLLIDSKPSKGLRKFLRSH-CDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
               +D+K  KGLRKFL+ +  DG  + LAV+D  LG+ IKEKL I CV+++ V ELMRG+
Sbjct  61   ADTLDAKIGKGLRKFLKKNISDGIKEKLAVSDKALGSMIKEKLGIPCVYDACVFELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R  +  LITGL ++DL  M+LGLSHSLSRYKLKFS DKVDTMI+QAI LLD+LDKE+N Y
Sbjct  121  RTHMNSLITGLEIEDLKSMTLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDELDKEINAY  180

Query  640  AMRV  651
            +MRV
Sbjct  181  SMRV  184



>ref|XP_006273562.1| PREDICTED: nucleolar protein 58 [Alligator mississippiensis]
Length=525

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005519952.1| PREDICTED: nucleolar protein 58 [Pseudopodoces humilis]
Length=527

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|EMC81163.1| Nucleolar protein 58, partial [Columba livia]
Length=468

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005049217.1| PREDICTED: nucleolar protein 58 [Ficedula albicollis]
Length=527

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_006017720.1| PREDICTED: nucleolar protein 58 [Alligator sinensis]
Length=525

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETGAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_010563240.1| PREDICTED: nucleolar protein 58 isoform X2 [Haliaeetus leucocephalus]
Length=485

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_010711773.1| PREDICTED: nucleolar protein 58 [Meleagris gallopavo]
Length=528

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_421942.1| PREDICTED: nucleolar protein 58 [Gallus gallus]
Length=527

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>gb|EGW06124.1| Nucleolar protein 58 [Cricetulus griseus]
Length=219

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_004378293.1| PREDICTED: nucleolar protein 58 [Trichechus manatus latirostris]
Length=533

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (77%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFLR-----SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L++ L+     +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKRVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_010563232.1| PREDICTED: nucleolar protein 58 isoform X1 [Haliaeetus leucocephalus]
Length=527

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_009836884.1| hypothetical protein H257_11594 [Aphanomyces astaci]
 gb|ETV73458.1| hypothetical protein H257_11594 [Aphanomyces astaci]
Length=510

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+TAD A   VKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLTNVDDIHKHFATADKANSFVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKSMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>emb|CAG04989.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=184

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 143/185 (77%), Gaps = 9/185 (5%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ L KEF T + A KVVKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQQVDSLHKEFETPEKANKVVKLKHFEKFQDTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLR------SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  450
            T L++ K  K L+K L+      +H   + LA++D KLG  IKEKL + C+H+ TV ELM
Sbjct  61   TALVEGKLGKSLKKVLKKIVAKEAH---EQLAISDVKLGGVIKEKLDLSCIHSPTVCELM  117

Query  451  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  630
            R +R+Q+  LITGL  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL
Sbjct  118  RCIRSQVESLITGLPSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  177

Query  631  NTYAM  645
            N Y M
Sbjct  178  NNYIM  182



>ref|XP_005306283.1| PREDICTED: nucleolar protein 58 isoform X1 [Chrysemys picta bellii]
Length=526

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETAAGYAVFKVLDEKKLQEVDSLWREFETPEKANKIVKLKHFEKFQDTTEALAAC  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005144700.1| PREDICTED: nucleolar protein 58 [Melopsittacus undulatus]
Length=528

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_002874404.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50663.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 132/182 (73%), Gaps = 26/182 (14%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  GFALFKVLDEGKLS VEDL  EFS+A++AR+                    
Sbjct  1    MLVLFETSGGFALFKVLDEGKLSNVEDLGDEFSSAESARR--------------------  40

Query  289  TLLIDSKPSKGLRKFLRSHC-DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
                    SKGLRKFL+++C DG+TLAVADS +GN I EKL + CVHN+ VMEL+RG+R+
Sbjct  41   -----GTSSKGLRKFLKNNCGDGETLAVADSNIGNIITEKLDVQCVHNNAVMELLRGVRS  95

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTEL++GL   DLAPMSL LSH L+RYKLK + DKV+TMI+Q I LLDDLDKE NTYAM
Sbjct  96   QLTELLSGLDDNDLAPMSLELSHILARYKLKITSDKVETMIIQVIGLLDDLDKERNTYAM  155

Query  646  RV  651
            RV
Sbjct  156  RV  157



>ref|XP_005511378.1| PREDICTED: nucleolar protein 58 [Columba livia]
Length=527

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_005837542.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
 gb|EKX50562.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
Length=501

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ETPAG+ALFKV DE KL  V+D+ + F+  D A K +KLKAF KFE+TSEAL AA
Sbjct  1    MLVLYETPAGYALFKVTDEKKLKDVDDIQEVFADPDKASKAMKLKAFQKFEDTSEALVAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T +++S  SKGL+KFL  +       + LAV ++KLG  IKEKL++ C+++  V+E+MRG
Sbjct  61   TAMLESSLSKGLKKFLEKNIVKKGLNEELAVYETKLGKVIKEKLEVPCIYDDKVLEIMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  L  L+ G   QDL  M LGL+HSL R+KLKFSPDKVDTM+VQAI LLD+LDKELNT
Sbjct  121  VRANLEVLLGGTTEQDLKTMRLGLAHSLGRHKLKFSPDKVDTMVVQAIGLLDELDKELNT  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>ref|XP_002189225.1| PREDICTED: nucleolar protein 58 [Taeniopygia guttata]
Length=527

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LI GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQVEGLIAGLPSREMAAMRLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>ref|XP_008872332.1| hypothetical protein H310_08394 [Aphanomyces invadans]
 gb|ETV98904.1| hypothetical protein H310_08394 [Aphanomyces invadans]
Length=494

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K+F+TAD A   +KLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKQFATADKANSFLKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>ref|XP_003743589.1| PREDICTED: nucleolar protein 58 [Metaseiulus occidentalis]
Length=545

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE+PAGFA+FKVLDE K+ K E+L+KEF  A  A K++KLK F KFE+ ++ALSAA
Sbjct  1    MLVLFESPAGFAVFKVLDEKKIQKSENLFKEFEDASDASKILKLKHFQKFEDMTQALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T  I+ K +K L+K L+     +TLAVAD+KLGN IKEK+ I CV NS++ ELMR +R+Q
Sbjct  61   TGAIEGKLTKPLKKILKKLEATETLAVADAKLGNIIKEKMDISCVANSSIQELMRCIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
               LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKELN Y MR
Sbjct  121  QEALITGLSQKEVTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKELNNYVMR  180



>emb|CBJ32359.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFK+ +E  L   + ++ EFST + A + VKLKAF  F +T++A++A+
Sbjct  1    MLVLFETPAGYALFKMTNESILKDADGIYDEFSTPEKAAESVKLKAFMTFADTADAVAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T +IDSK  K L+KFL  +       D LAV+DSKL NAIK+KL I CV++S VMELMRG
Sbjct  61   TEMIDSKMGKSLKKFLTKNIVKKELKDKLAVSDSKLANAIKDKLSIKCVNDSGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R QL  L+T +G  +L  M LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRGQLDGLLTSVGDDNLKAMRLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            YAMRV
Sbjct  181  YAMRV  185



>ref|XP_002903084.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
 gb|EEY55508.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
Length=519

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  24   MLVLFETAAGHALFKVQDEAKLANADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  83

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +       D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  84   TDMVDGKMGKTLKKFLKKNVVDVGLKDKLAVSDKALGSLIKEKLSIACVNDSAVNEVMRG  143

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  144  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  203

Query  637  YAMRV  651
            Y+MRV
Sbjct  204  YSMRV  208



>ref|XP_004367446.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20421.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
Length=525

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFKV +EGKL +  ++ K+F+T + A+KVV LKAF KF NT+EAL+A 
Sbjct  1    MLVLFETPAGYALFKVHNEGKLQEA-NIAKDFATLEGAQKVVSLKAFQKFGNTTEALAAT  59

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK  K L+KFL+    G+ L V+D KL   IK+K+ + C+HNS V EL+RG+R Q
Sbjct  60   TAIVESKLGKDLKKFLKKQAKGEQLGVSDPKLAGIIKDKIGVQCLHNSMVNELLRGIRLQ  119

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            +T+LITGLG  +L+ M LGLSHSL RYKLKFSPDKVD MI+QAI+LLDDLDKE NTYAMR
Sbjct  120  MTDLITGLGEGELSNMVLGLSHSLCRYKLKFSPDKVDHMIIQAIALLDDLDKESNTYAMR  179

Query  649  V  651
            V
Sbjct  180  V  180



>ref|XP_008911207.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
 gb|ETN03434.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
Length=496

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>gb|ETI38018.1| hypothetical protein F443_16119 [Phytophthora parasitica P1569]
 gb|ETK78232.1| hypothetical protein L915_15665 [Phytophthora parasitica]
 gb|ETM38080.1| hypothetical protein L914_15515 [Phytophthora parasitica]
 gb|ETO66787.1| hypothetical protein F444_16104 [Phytophthora parasitica P1976]
 gb|ETP07908.1| hypothetical protein F441_15948 [Phytophthora parasitica CJ01A1]
 gb|ETP35975.1| hypothetical protein F442_15972 [Phytophthora parasitica P10297]
Length=496

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>gb|ETL31667.1| hypothetical protein L916_15560 [Phytophthora parasitica]
 gb|ETL84897.1| hypothetical protein L917_15383 [Phytophthora parasitica]
Length=496

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>gb|ESA16249.1| hypothetical protein GLOINDRAFT_158776 [Rhizophagus irregularis 
DAOM 181602]
Length=430

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+ALF+VL EGKL + ++LWK+F T + A+K VKL  F KFEN SEA+++ 
Sbjct  1    MLVLFETAAGYALFEVLKEGKLREPDELWKDFETPEAAKKTVKLVDFQKFENMSEAVASV  60

Query  289  TLLIDSKPSKGLRKFLRS-----HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            + L++ K SK L+KFL+          + LAV + K+G  I +K  I  + N TV+EL R
Sbjct  61   SDLLEGKLSKDLKKFLKESFEKIEVSSEKLAVMEPKIGATISKKFGIQVISNETVVELYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G++ QL  LITG+   D++ MSLGLSHSLSR+KLKFSPDKVD MI+QAI LLDDLDKELN
Sbjct  121  GIKQQLDSLITGIKSDDISQMSLGLSHSLSRHKLKFSPDKVDNMIIQAIGLLDDLDKELN  180

Query  634  TYAMRV  651
            TYAMRV
Sbjct  181  TYAMRV  186



>ref|XP_010493886.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=129

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  208  TADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLG  387
            TA++ARK+VKLKAF KF+NTSEAL A   L+   PSKGLRKFL+++CDG+TLAVADS LG
Sbjct  2    TAESARKMVKLKAFDKFDNTSEALEAVAKLLKGTPSKGLRKFLKANCDGETLAVADSMLG  61

Query  388  NAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSP  567
            N IKEKL+IDCVHN+ VMEL+RG+R+QLTELI+GLG  DLAPMSLGLSHSL+RYKLKFS 
Sbjct  62   NIIKEKLKIDCVHNNAVMELLRGVRSQLTELISGLGDNDLAPMSLGLSHSLARYKLKFSS  121

Query  568  DKVDTMIV  591
            DKVDTMI+
Sbjct  122  DKVDTMII  129



>ref|XP_009530825.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
 gb|EGZ13396.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
Length=489

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+  +D++K F+T + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKLANADDVFKHFATPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IK+KL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKDKLSISCVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRV  651
            Y+MRV
Sbjct  181  YSMRV  185



>ref|XP_008187145.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Acyrthosiphon 
pisum]
Length=487

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATSKIIKLKHFQKFDDTTEALASA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  646  R  648
            R
Sbjct  181  R  181



>ref|XP_003907873.1| PREDICTED: nucleolar protein 58 isoform X1 [Papio anubis]
Length=423

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_005574023.1| PREDICTED: nucleolar protein 58 isoform X4 [Macaca fascicularis]
Length=431

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>gb|AAH87637.1| Nol5 protein [Rattus norvegicus]
Length=444

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_002407966.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
 gb|EEC12380.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
Length=515

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 145/186 (78%), Gaps = 9/186 (5%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE+PAG+A+FKVLDE KL + ++L+K+F T D A +VVKLK F KFE+ ++AL+AA
Sbjct  1    MLVLFESPAGYAIFKVLDEKKLQQTDNLFKDFETPDKASRVVKLKHFEKFEDMTQALAAA  60

Query  289  TLLIDSKPSKGLRKFL------RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  450
            T  I+ K SK L+K L       +H   ++LAVAD+KLGN IK+K  I CV NS++ ELM
Sbjct  61   TSAIEGKMSKTLKKVLKKVVAKEAH---ESLAVADAKLGNVIKDKFDISCVANSSIQELM  117

Query  451  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  630
            R +R+Q+  LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKEL
Sbjct  118  RCIRSQVDGLITGLPRKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKEL  177

Query  631  NTYAMR  648
            N Y MR
Sbjct  178  NNYIMR  183



>ref|XP_006636806.1| PREDICTED: nucleolar protein 58-like [Lepisosteus oculatus]
Length=527

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDKLWEEFQTPERANKIVKLKHFEKFQDTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K L+   +    + LA++D+KLG  IK+KL + CVH+  V ELMRG+
Sbjct  61   TALVEGKIGKSLKKVLKRVVAKEAHEQLAISDAKLGGVIKDKLNLSCVHSPAVAELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPPREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  IMR  183



>dbj|BAE21954.1| unnamed protein product [Mus musculus]
Length=455

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>gb|KFH64217.1| hypothetical protein MVEG_10042 [Mortierella verticillata NRRL 
6337]
Length=507

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 144/186 (77%), Gaps = 5/186 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+L+E+PAG+ALF +LD+GKL K + +WK+F T + A K VKL+AFSKFENT++ALSA 
Sbjct  1    MLILYESPAGYALFNLLDDGKLEKPDSIWKDFETPEQANKTVKLRAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K SK L++FL S         ++L V D+KLG AI +KL +  + +ST ++L R
Sbjct  61   TALVEGKLSKNLKEFLSSEISEKEMKKESLIVGDAKLGGAIAKKLNMKVISDSTTLDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R QL  L++GL   DL+ M LGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRTQLDSLLSGLSSSDLSAMVLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRV  651
            TYAMRV
Sbjct  181  TYAMRV  186



>ref|XP_007190607.1| PREDICTED: nucleolar protein 58 isoform X6 [Balaenoptera acutorostrata 
scammoni]
Length=432

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPLVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_001641027.1| predicted protein [Nematostella vectensis]
 gb|EDO48964.1| predicted protein [Nematostella vectensis]
Length=514

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL  V+DL+K+F + D A KVVKLK F KFE+T+EAL+AA
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLKNVDDLYKDFESPDAASKVVKLKHFHKFEDTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SKGL+K L+     D    LAV+D+KLGN IKEKL ++CV ++ V ELMRG+
Sbjct  61   TAAIEGKMSKGLKKLLKKVVAKDAHEQLAVSDAKLGNIIKEKLSVNCVASTAVHELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMNNLITGLQDREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMR  648
             MR
Sbjct  181  VMR  183



>ref|XP_011308274.1| PREDICTED: nucleolar protein 58 [Fopius arisanus]
Length=568

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A K++KLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKTENLYHDFETPEAASKLLKLKHFEKFADTTEALAAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLCKSLKKMLKKHCSEVQEQLAVADAKLGNAIKDKLSLSCVSNTSIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +QL  L+ GL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRV  651
            MR 
Sbjct  181  MRC  183



>gb|AAC23535.1| unknown, partial [Rattus sp.]
Length=461

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>dbj|BAJ91724.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATTKIIKLKHFQKFDDTTEALASA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  646  R  648
            R
Sbjct  181  R  181



>emb|CAH91951.1| hypothetical protein [Pongo abelii]
Length=472

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_003701979.1| PREDICTED: nucleolar protein 58-like [Megachile rotundata]
Length=589

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A ++VKLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDEQKLAEVENLYHDFETPEAASQIVKLKHFEKFADTTEALAAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCSELQEQLAVADTKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MR  648
            MR
Sbjct  181  MR  182



>ref|XP_005574021.1| PREDICTED: nucleolar protein 58 isoform X2 [Macaca fascicularis]
Length=471

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 8/185 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMR  648
             Y MR
Sbjct  178  NYIMR  182



>ref|XP_004701594.1| PREDICTED: nucleolar protein 58 [Echinops telfairi]
Length=530

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+QL  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQLDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRV  651
             Y MR 
Sbjct  178  NYIMRC  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250