BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031E04

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009366775.1|  PREDICTED: CDPK-related kinase 5-like            91.7    8e-18   Pyrus x bretschneideri [bai li]
ref|XP_006338215.1|  PREDICTED: CDPK-related kinase 5-like            90.1    2e-17   Solanum tuberosum [potatoes]
gb|KHG22049.1|  CDPK-related protein kinase                           90.1    3e-17   Gossypium arboreum [tree cotton]
ref|XP_004232048.1|  PREDICTED: CDPK-related kinase 5                 89.7    4e-17   Solanum lycopersicum
gb|KJB48531.1|  hypothetical protein B456_008G074300                  89.0    7e-17   Gossypium raimondii
gb|KJB48534.1|  hypothetical protein B456_008G074300                  89.0    7e-17   Gossypium raimondii
gb|AAZ83348.1|  CDPK-related protein kinase                           88.6    8e-17   Gossypium hirsutum [American cotton]
gb|KJB48530.1|  hypothetical protein B456_008G074300                  88.6    9e-17   Gossypium raimondii
ref|XP_008338287.1|  PREDICTED: CDPK-related kinase 5                 88.2    1e-16   Malus domestica [apple tree]
ref|XP_009366804.1|  PREDICTED: CDPK-related kinase 5-like            87.8    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_010268648.1|  PREDICTED: CDPK-related kinase 5-like isofor...  87.0    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010268657.1|  PREDICTED: CDPK-related kinase 5-like isofor...  86.7    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010550380.1|  PREDICTED: CDPK-related kinase 5 isoform X1      86.7    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_010550381.1|  PREDICTED: CDPK-related kinase 5 isoform X2      86.3    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_010268715.1|  PREDICTED: CDPK-related kinase 5                 86.3    6e-16   Nelumbo nucifera [Indian lotus]
ref|XP_007204593.1|  hypothetical protein PRUPE_ppa003111mg           84.7    2e-15   Prunus persica
ref|XP_010103697.1|  CDPK-related protein kinase                      84.0    3e-15   Morus notabilis
emb|CDP02477.1|  unnamed protein product                              84.0    3e-15   Coffea canephora [robusta coffee]
ref|XP_008241522.1|  PREDICTED: CDPK-related kinase 5                 82.4    1e-14   Prunus mume [ume]
ref|XP_006290767.1|  hypothetical protein CARUB_v10016874mg           82.0    1e-14   
ref|XP_006290766.1|  hypothetical protein CARUB_v10016874mg           82.0    2e-14   Capsella rubella
ref|XP_009758726.1|  PREDICTED: CDPK-related kinase 5-like isofor...  81.3    3e-14   Nicotiana sylvestris
ref|NP_001190048.1|  CDPK-related kinase                              81.3    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306462.1|  CROOKED family protein                           80.1    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011085503.1|  PREDICTED: CDPK-related protein kinase-like      79.7    9e-14   Sesamum indicum [beniseed]
ref|XP_002876036.1|  hypothetical protein ARALYDRAFT_485401           79.3    1e-13   
gb|KDP31899.1|  hypothetical protein JCGZ_12360                       79.0    1e-13   Jatropha curcas
ref|NP_190622.1|  CDPK-related kinase                                 79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006425845.1|  hypothetical protein CICLE_v10025192mg           77.4    1e-13   
gb|AAL30814.1|AF435446_1  calcium/calmodulin-dependent protein ki...  79.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98882.1|  CDPK-related protein kinase                           79.0    2e-13   Gossypium arboreum [tree cotton]
gb|AAL30820.1|AF435452_1  calcium/calmodulin-dependent protein ki...  78.6    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_003624963.1|  Calcium-dependent protein kinase-like protein    78.2    3e-13   Medicago truncatula
ref|XP_004493390.1|  PREDICTED: CDPK-related kinase 7-like            78.2    3e-13   Cicer arietinum [garbanzo]
ref|XP_011007668.1|  PREDICTED: CDPK-related kinase 5-like            77.8    4e-13   Populus euphratica
ref|XP_010112837.1|  Calcium/calmodulin-dependent serine/threonin...  77.8    4e-13   
ref|XP_006425846.1|  hypothetical protein CICLE_v10025192mg           77.0    5e-13   
ref|XP_006829951.1|  hypothetical protein AMTR_s00073p00197610        77.4    5e-13   Amborella trichopoda
ref|XP_006425847.1|  hypothetical protein CICLE_v10025192mg           77.0    5e-13   
ref|XP_008457867.1|  PREDICTED: CDPK-related kinase 5-like            77.4    6e-13   Cucumis melo [Oriental melon]
ref|XP_010558347.1|  PREDICTED: CDPK-related kinase 5-like            77.0    6e-13   Tarenaya hassleriana [spider flower]
ref|XP_004511959.1|  PREDICTED: CDPK-related kinase 5-like            77.0    7e-13   Cicer arietinum [garbanzo]
gb|KDO79302.1|  hypothetical protein CISIN_1g007253mg                 75.9    9e-13   Citrus sinensis [apfelsine]
gb|KDO79301.1|  hypothetical protein CISIN_1g007253mg                 75.9    1e-12   Citrus sinensis [apfelsine]
ref|XP_002310736.1|  hypothetical protein POPTR_0007s11320g           76.3    1e-12   
ref|XP_002463267.1|  hypothetical protein SORBIDRAFT_02g040850        76.3    1e-12   Sorghum bicolor [broomcorn]
ref|XP_004958484.1|  PREDICTED: calcium/calmodulin-dependent seri...  76.3    1e-12   Setaria italica
ref|XP_008668263.1|  PREDICTED: uncharacterized LOC100381527 isof...  76.3    1e-12   Zea mays [maize]
ref|XP_006425849.1|  hypothetical protein CICLE_v10025192mg           76.3    1e-12   Citrus clementina [clementine]
gb|EMS61574.1|  Calcium/calmodulin-dependent serine/threonine-pro...  76.6    1e-12   Triticum urartu
ref|XP_003562581.1|  PREDICTED: calcium/calmodulin-dependent seri...  76.3    1e-12   Brachypodium distachyon [annual false brome]
ref|XP_004984283.1|  PREDICTED: calcium/calmodulin-dependent seri...  76.3    1e-12   Setaria italica
ref|XP_004148051.1|  PREDICTED: CDPK-related protein kinase-like      76.3    1e-12   Cucumis sativus [cucumbers]
gb|EAZ16167.1|  hypothetical protein OsJ_31616                        73.2    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007163947.1|  hypothetical protein PHAVU_L003400g              75.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_003518984.1|  PREDICTED: CDPK-related kinase 7-like isofor...  75.5    2e-12   Glycine max [soybeans]
gb|EYU44373.1|  hypothetical protein MIMGU_mgv1a003006mg              75.5    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_004142011.1|  PREDICTED: CDPK-related protein kinase-like      75.5    2e-12   Cucumis sativus [cucumbers]
ref|XP_010427514.1|  PREDICTED: CDPK-related kinase 7-like isofor...  75.5    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009115721.1|  PREDICTED: CDPK-related kinase 5                 75.5    2e-12   Brassica rapa
emb|CDY52824.1|  BnaAnng11710D                                        75.5    2e-12   Brassica napus [oilseed rape]
ref|XP_010246175.1|  PREDICTED: CDPK-related kinase 1-like            75.5    2e-12   Nelumbo nucifera [Indian lotus]
gb|KDO79300.1|  hypothetical protein CISIN_1g007253mg                 75.5    2e-12   Citrus sinensis [apfelsine]
ref|XP_010271816.1|  PREDICTED: CDPK-related kinase 7-like            75.1    3e-12   Nelumbo nucifera [Indian lotus]
gb|KJB43647.1|  hypothetical protein B456_007G210700                  75.1    3e-12   Gossypium raimondii
ref|XP_002522315.1|  calcium-dependent protein kinase, putative       74.7    3e-12   
ref|XP_011039202.1|  PREDICTED: CDPK-related kinase 5-like            75.1    3e-12   Populus euphratica
ref|NP_001169442.1|  uncharacterized LOC100383313                     75.1    3e-12   Zea mays [maize]
gb|KJB43646.1|  hypothetical protein B456_007G210700                  74.7    3e-12   Gossypium raimondii
ref|XP_010515424.1|  PREDICTED: CDPK-related kinase 5                 74.3    5e-12   Camelina sativa [gold-of-pleasure]
ref|NP_191235.1|  CDPK-related kinase 7                               74.3    5e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC16472.1|  putative calcium/calmodulin-dependent protein ki...  74.3    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008377644.1|  PREDICTED: CDPK-related kinase 7-like isofor...  74.3    5e-12   
ref|XP_008377637.1|  PREDICTED: CDPK-related kinase 7-like isofor...  74.3    5e-12   
ref|XP_010516279.1|  PREDICTED: CDPK-related kinase 7                 74.3    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009371242.1|  PREDICTED: CDPK-related kinase 7-like            74.3    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_010427515.1|  PREDICTED: CDPK-related kinase 7-like isofor...  74.3    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002522159.1|  calcium-dependent protein kinase, putative       73.9    6e-12   
ref|XP_010504583.1|  PREDICTED: CDPK-related kinase 7-like            74.3    6e-12   Camelina sativa [gold-of-pleasure]
ref|NP_001146092.1|  uncharacterized protein LOC100279624             71.2    6e-12   Zea mays [maize]
gb|EEC82532.1|  hypothetical protein OsI_27055                        73.9    6e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006290768.1|  hypothetical protein CARUB_v10016875mg           73.9    7e-12   
ref|XP_006290769.1|  hypothetical protein CARUB_v10016875mg           73.9    7e-12   
dbj|BAK00699.1|  predicted protein                                    73.9    7e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008777902.1|  PREDICTED: calcium/calmodulin-dependent seri...  73.9    8e-12   Phoenix dactylifera
gb|KDO53618.1|  hypothetical protein CISIN_1g0074581mg                70.1    8e-12   Citrus sinensis [apfelsine]
ref|XP_004288057.1|  PREDICTED: CDPK-related kinase 5                 73.6    9e-12   Fragaria vesca subsp. vesca
ref|XP_010542604.1|  PREDICTED: CDPK-related kinase 1                 73.6    9e-12   Tarenaya hassleriana [spider flower]
ref|XP_008798377.1|  PREDICTED: calcium/calmodulin-dependent seri...  73.6    9e-12   Phoenix dactylifera
ref|XP_002262855.3|  PREDICTED: CDPK-related kinase 5                 73.6    9e-12   Vitis vinifera
ref|XP_006836275.1|  hypothetical protein AMTR_s00101p00154790        73.6    9e-12   Amborella trichopoda
gb|KJB35810.1|  hypothetical protein B456_006G129900                  73.2    1e-11   Gossypium raimondii
ref|XP_010503722.1|  PREDICTED: CDPK-related kinase 5-like            73.6    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010907987.1|  PREDICTED: calcium/calmodulin-dependent seri...  73.2    1e-11   Elaeis guineensis
gb|EYU39405.1|  hypothetical protein MIMGU_mgv1a0043832mg             72.4    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_011099192.1|  PREDICTED: CDPK-related kinase 5 isoform X1      73.2    1e-11   Sesamum indicum [beniseed]
emb|CAN74933.1|  hypothetical protein VITISV_044433                   73.2    1e-11   Vitis vinifera
ref|XP_010907988.1|  PREDICTED: calcium/calmodulin-dependent seri...  73.2    1e-11   
ref|XP_007028316.1|  CDPK-related kinase 1                            73.2    1e-11   
gb|KJB35809.1|  hypothetical protein B456_006G129900                  73.2    1e-11   Gossypium raimondii
ref|XP_003535908.1|  PREDICTED: CDPK-related kinase 1-like            72.8    1e-11   Glycine max [soybeans]
ref|XP_008464945.1|  PREDICTED: CDPK-related kinase 7-like isofor...  72.8    1e-11   Cucumis melo [Oriental melon]
ref|XP_008464946.1|  PREDICTED: CDPK-related kinase 1-like isofor...  72.8    1e-11   Cucumis melo [Oriental melon]
ref|XP_004141122.1|  PREDICTED: calcium/calmodulin-dependent seri...  72.8    2e-11   Cucumis sativus [cucumbers]
ref|XP_002467812.1|  hypothetical protein SORBIDRAFT_01g034520        72.8    2e-11   Sorghum bicolor [broomcorn]
ref|NP_001140858.1|  uncharacterized LOC100272934                     72.8    2e-11   Zea mays [maize]
ref|XP_008667154.1|  PREDICTED: uncharacterized LOC100272934 isof...  72.8    2e-11   Zea mays [maize]
emb|CDP06189.1|  unnamed protein product                              72.8    2e-11   Coffea canephora [robusta coffee]
ref|XP_010673049.1|  PREDICTED: CDPK-related kinase 7-like            72.8    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006402951.1|  hypothetical protein EUTSA_v10005861mg           72.4    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_002322616.1|  CDPK-related kinase 1 family protein             72.0    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002879911.1|  hypothetical protein ARALYDRAFT_483182           72.0    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002878106.1|  hypothetical protein ARALYDRAFT_486115           72.0    3e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002282577.1|  PREDICTED: CDPK-related kinase 1                 72.0    3e-11   Vitis vinifera
emb|CBI32784.3|  unnamed protein product                              72.0    3e-11   Vitis vinifera
ref|XP_010028268.1|  PREDICTED: CDPK-related kinase 5                 72.0    3e-11   Eucalyptus grandis [rose gum]
gb|KHG24093.1|  Calcium/calmodulin-dependent serine/threonine-pro...  71.6    4e-11   Gossypium arboreum [tree cotton]
ref|XP_011027259.1|  PREDICTED: CDPK-related kinase 7-like isofor...  71.6    4e-11   Populus euphratica
ref|XP_010909914.1|  PREDICTED: CDPK-related kinase 7-like isofor...  71.6    4e-11   Elaeis guineensis
ref|XP_010909915.1|  PREDICTED: CDPK-related kinase 7-like isofor...  71.6    4e-11   Elaeis guineensis
ref|XP_011000411.1|  PREDICTED: CDPK-related kinase 7-like            71.2    5e-11   Populus euphratica
ref|XP_008240668.1|  PREDICTED: CDPK-related kinase 7                 70.9    7e-11   Prunus mume [ume]
ref|NP_181647.1|  CDPK-related kinase 1                               70.9    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482068.1|  PREDICTED: CDPK-related kinase 7-like            70.9    7e-11   Citrus sinensis [apfelsine]
ref|XP_006411380.1|  hypothetical protein EUTSA_v10016437mg           70.9    7e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006430539.1|  hypothetical protein CICLE_v10011368mg           70.9    7e-11   Citrus clementina [clementine]
ref|XP_006346445.1|  PREDICTED: CDPK-related kinase 5-like            70.9    7e-11   Solanum tuberosum [potatoes]
ref|XP_002308892.2|  CDPK-related kinase 1 family protein             70.5    9e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010228587.1|  PREDICTED: calcium/calmodulin-dependent seri...  70.5    9e-11   
ref|XP_010922072.1|  PREDICTED: calcium/calmodulin-dependent seri...  70.5    9e-11   Elaeis guineensis
ref|XP_010508754.1|  PREDICTED: CDPK-related kinase 1-like            70.5    9e-11   Camelina sativa [gold-of-pleasure]
ref|XP_003516596.1|  PREDICTED: CDPK-related kinase 5-like            70.5    1e-10   Glycine max [soybeans]
ref|XP_003557839.1|  PREDICTED: calcium/calmodulin-dependent seri...  70.5    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_009801386.1|  PREDICTED: CDPK-related kinase 5-like            70.5    1e-10   Nicotiana sylvestris
ref|XP_009618516.1|  PREDICTED: CDPK-related kinase 7-like            69.7    1e-10   Nicotiana tomentosiformis
ref|XP_009420969.1|  PREDICTED: calcium/calmodulin-dependent seri...  69.7    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009761409.1|  PREDICTED: CDPK-related kinase 1-like            69.7    1e-10   Nicotiana sylvestris
gb|KFK34914.1|  hypothetical protein AALP_AA5G210000                  69.7    2e-10   Arabis alpina [alpine rockcress]
ref|XP_007156824.1|  hypothetical protein PHAVU_002G020800g           69.7    2e-10   Phaseolus vulgaris [French bean]
ref|XP_006293901.1|  hypothetical protein CARUB_v10022894mg           69.7    2e-10   Capsella rubella
ref|XP_006362272.1|  PREDICTED: CDPK-related kinase 1-like            69.7    2e-10   Solanum tuberosum [potatoes]
ref|XP_010525467.1|  PREDICTED: CDPK-related kinase 1-like            69.7    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_004249131.1|  PREDICTED: CDPK-related kinase 1                 69.7    2e-10   Solanum lycopersicum
ref|XP_009405856.1|  PREDICTED: calcium/calmodulin-dependent seri...  69.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146101.1|  uncharacterized LOC100279633                     69.3    2e-10   Zea mays [maize]
ref|XP_008658484.1|  PREDICTED: uncharacterized LOC100279633 isof...  69.3    2e-10   Zea mays [maize]
ref|XP_010517599.1|  PREDICTED: CDPK-related kinase 1 isoform X1      69.3    2e-10   
ref|XP_007145486.1|  hypothetical protein PHAVU_007G243100g           69.3    2e-10   Phaseolus vulgaris [French bean]
ref|XP_004230803.1|  PREDICTED: CDPK-related kinase 5                 68.9    3e-10   Solanum lycopersicum
gb|KDP27484.1|  hypothetical protein JCGZ_20019                       68.9    3e-10   Jatropha curcas
ref|XP_008440252.1|  PREDICTED: CDPK-related kinase 5 isoform X1      68.9    3e-10   Cucumis melo [Oriental melon]
ref|XP_008440253.1|  PREDICTED: CDPK-related kinase 5 isoform X2      68.9    3e-10   Cucumis melo [Oriental melon]
ref|XP_003629589.1|  Calcium/calmodulin-dependent protein kinase ...  68.9    3e-10   
ref|XP_007047191.1|  CDPK-related kinase                              68.9    3e-10   Theobroma cacao [chocolate]
ref|XP_009404698.1|  PREDICTED: calcium/calmodulin-dependent seri...  68.9    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS59727.1|  hypothetical protein M569_15078                       68.2    5e-10   Genlisea aurea
ref|XP_009611550.1|  PREDICTED: CDPK-related kinase 5                 68.2    5e-10   Nicotiana tomentosiformis
emb|CDY47375.1|  BnaC04g24880D                                        67.8    7e-10   Brassica napus [oilseed rape]
emb|CDY22505.1|  BnaC03g23150D                                        67.4    9e-10   Brassica napus [oilseed rape]
ref|XP_009139075.1|  PREDICTED: CDPK-related kinase 7-like            67.4    1e-09   Brassica rapa
ref|XP_009393900.1|  PREDICTED: calcium/calmodulin-dependent seri...  67.0    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP18369.1|  unnamed protein product                              63.5    1e-09   Coffea canephora [robusta coffee]
gb|EYU20808.1|  hypothetical protein MIMGU_mgv1a003516mg              67.0    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_009409499.1|  PREDICTED: CDPK-related kinase 5-like            67.0    1e-09   
ref|XP_011079071.1|  PREDICTED: CDPK-related kinase 1-like            66.6    1e-09   Sesamum indicum [beniseed]
ref|XP_011075448.1|  PREDICTED: CDPK-related kinase 1                 66.6    2e-09   Sesamum indicum [beniseed]
gb|EEC75325.1|  hypothetical protein OsI_11701                        66.6    2e-09   Oryza sativa Indica Group [Indian rice]
gb|AAK54157.1|AF368282_1  CaMK1                                       66.6    2e-09   Oryza sativa [red rice]
ref|NP_001050179.1|  Os03g0366200                                     66.6    2e-09   
sp|Q10KY3.1|CAMK1_ORYSJ  RecName: Full=Calcium/calmodulin-depende...  66.6    2e-09   Oryza sativa Japonica Group [Japonica rice]
sp|P53681.1|CRK_DAUCA  RecName: Full=CDPK-related protein kinase;...  66.2    3e-09   Daucus carota [carrots]
gb|KCW47909.1|  hypothetical protein EUGRSUZ_K01647                   65.5    3e-09   Eucalyptus grandis [rose gum]
gb|AET04065.2|  calmodulin-domain kinase CDPK protein                 65.9    3e-09   Medicago truncatula
ref|XP_004509161.1|  PREDICTED: CDPK-related protein kinase-like      65.9    3e-09   Cicer arietinum [garbanzo]
ref|XP_010036359.1|  PREDICTED: CDPK-related kinase 1-like            65.5    4e-09   Eucalyptus grandis [rose gum]
emb|CDX76010.1|  BnaA04g02740D                                        65.5    4e-09   
emb|CDY35427.1|  BnaA03g19330D                                        65.1    5e-09   Brassica napus [oilseed rape]
ref|XP_009133469.1|  PREDICTED: CDPK-related kinase 1                 65.1    5e-09   Brassica rapa
gb|KFK36961.1|  hypothetical protein AALP_AA4G195100                  63.5    2e-08   Arabis alpina [alpine rockcress]
emb|CDX79956.1|  BnaA05g02000D                                        63.2    2e-08   
gb|EPS58889.1|  hypothetical protein M569_15923                       61.6    2e-08   Genlisea aurea
emb|CDY23873.1|  BnaC04g01640D                                        63.2    2e-08   Brassica napus [oilseed rape]
ref|XP_009142724.1|  PREDICTED: CDPK-related kinase 1-like            62.8    3e-08   Brassica rapa
ref|XP_010680435.1|  PREDICTED: CDPK-related kinase 5                 62.8    3e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006360222.1|  PREDICTED: CDPK-related protein kinase-like      62.8    3e-08   Solanum tuberosum [potatoes]
ref|XP_006404024.1|  hypothetical protein EUTSA_v10010211mg           61.6    6e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010916660.1|  PREDICTED: CDPK-related kinase 5                 61.6    7e-08   Elaeis guineensis
ref|XP_007155949.1|  hypothetical protein PHAVU_003G2460000g          61.2    9e-08   Phaseolus vulgaris [French bean]
ref|XP_008795162.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...  61.2    1e-07   Phoenix dactylifera
ref|XP_010426596.1|  PREDICTED: CDPK-related kinase 5-like            60.5    2e-07   Camelina sativa [gold-of-pleasure]
gb|KHN47935.1|  CDPK-related protein kinase                           60.1    2e-07   Glycine soja [wild soybean]
ref|XP_003525704.1|  PREDICTED: CDPK-related kinase 5-like isofor...  60.1    2e-07   Glycine max [soybeans]
emb|CDY65016.1|  BnaCnng45690D                                        60.1    2e-07   Brassica napus [oilseed rape]
gb|EPS69494.1|  hypothetical protein M569_05270                       60.1    3e-07   Genlisea aurea
ref|XP_004233433.1|  PREDICTED: CDPK-related kinase 5-like            59.7    3e-07   Solanum lycopersicum
ref|XP_009389551.1|  PREDICTED: CDPK-related kinase 5-like            59.3    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008669867.1|  PREDICTED: calcium/calmodulin-dependent seri...  58.2    4e-07   Zea mays [maize]
ref|XP_010911684.1|  PREDICTED: CDPK-related kinase 5-like            57.4    4e-07   Elaeis guineensis
gb|EMT32885.1|  hypothetical protein F775_33150                       55.5    7e-07   
ref|XP_008654062.1|  PREDICTED: calcium/calmodulin-dependent seri...  55.1    4e-06   Zea mays [maize]
ref|XP_003611786.1|  CDPK-related protein kinase                      53.9    2e-05   Medicago truncatula
ref|XP_002973513.1|  CDK related protein kinase 5                     53.5    3e-05   Selaginella moellendorffii
gb|EPS59805.1|  hypothetical protein M569_15001                       52.0    4e-05   Genlisea aurea
emb|CDY27114.1|  BnaA08g07520D                                        48.1    2e-04   Brassica napus [oilseed rape]
ref|XP_002975545.1|  CDPK-related protein kinase 3                    50.8    2e-04   Selaginella moellendorffii
ref|XP_003608023.1|  Calcium/calmodulin-dependent protein kinase ...  50.8    2e-04   Medicago truncatula
ref|XP_003528501.1|  PREDICTED: CDPK-related kinase 5-like            50.1    5e-04   Glycine max [soybeans]
ref|XP_003520170.1|  PREDICTED: CDPK-related kinase 5-like            50.1    5e-04   Glycine max [soybeans]
ref|XP_011088749.1|  PREDICTED: CDPK-related protein kinase-like      49.7    6e-04   
gb|ABK25039.1|  unknown                                               49.7    7e-04   Picea sitchensis
ref|XP_004166903.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...  49.3    8e-04   
ref|XP_004140506.1|  PREDICTED: CDPK-related protein kinase-like      49.3    8e-04   Cucumis sativus [cucumbers]
ref|XP_008459758.1|  PREDICTED: CDPK-related kinase 3 isoform X1      49.3    8e-04   Cucumis melo [Oriental melon]



>ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 104/155 (67%), Gaps = 14/155 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDW--RNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGG  327
            MG+CTSKPSL    +  ++D    +   +P P         N  G  + R  +K E E  
Sbjct  1    MGLCTSKPSLNSHTFSPQSDSPPTKESSVPPP---------NAAGNGKNRRDEKAEEENV  51

Query  328  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  507
            +KSPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVLAR
Sbjct  52   KKSPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLAR  110

Query  508  RHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            RHGSVKPN AAIPEG E+EG  GLDKSFGFSKHFG
Sbjct  111  RHGSVKPNEAAIPEGGEAEGVNGLDKSFGFSKHFG  145



>ref|XP_006338215.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=610

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 91/159 (57%), Positives = 108/159 (68%), Gaps = 14/159 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTS+PS    ++ +D  T       +PVK  P+N E+ G  +QQ   KK E + G+K
Sbjct  1    MGACTSRPS----NYSDDSITVAGNRATLPVKATPNNNED-GNSHQQERTKKDEADVGKK  55

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHYLF+KKSP RSPANA S+++  R F R   PP   AKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHYLFSKKSPLRSPANASSNSTPRRFFKRPFPPPSP-AKHIRAVLARRH  114

Query  514  GSVKPNGAAIPEGAESE--------GGLDKSFGFSKHFG  606
            GSVKPN +AIPE  E+E         GLDKSFGFSK+FG
Sbjct  115  GSVKPNESAIPEVNETEVGGGGGGGAGLDKSFGFSKNFG  153



>gb|KHG22049.1| CDPK-related protein kinase [Gossypium arboreum]
Length=617

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 97/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRD--------WRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKK  309
            MG+CTSKPS    D        W ND     N     P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTWNNDIHRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  310  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  489
                 G+KSPFFPFYSPSPA YLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NSNNEGKKSPFFPFYSPSPAQYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  490  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFG  606
            RAVLARRHGSVKPN AAIPEG+E+E       GLDKSFGFSKHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSEAEAAGATGTGLDKSFGFSKHFG  160



>ref|XP_004232048.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=607

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 90/159 (57%), Positives = 108/159 (68%), Gaps = 17/159 (11%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTS+PS    ++  D   +R     +PVK  P+N E+ G  +QQ   KK E + G+K
Sbjct  1    MGACTSRPS----NYAGDSNGNRAT---LPVKSTPNNNED-GNSHQQERTKKDEADVGKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHYLF+KKSP RSPANA ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPLRSPANASTNSTPRRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  514  GSVKPNGAAIPEGAESE--------GGLDKSFGFSKHFG  606
            GSVKPN +AIPE  E+E         GLDKSFGFSK+FG
Sbjct  112  GSVKPNESAIPEVNETEVGGGGGGGAGLDKSFGFSKNFG  150



>gb|KJB48531.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
 gb|KJB48532.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
 gb|KJB48533.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=573

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 98/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  309
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  310  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  489
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  490  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFG  606
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFG  160



>gb|KJB48534.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=575

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 98/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  309
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  310  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  489
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  490  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFG  606
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFG  160



>gb|AAZ83348.1| CDPK-related protein kinase [Gossypium hirsutum]
Length=617

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 98/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  309
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  310  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  489
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  490  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFG  606
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFG  160



>gb|KJB48530.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=610

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 98/165 (59%), Gaps = 19/165 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI--------PVPVKDNPDNGENQGGENQQRNIKK  309
            MG+CTSKPS    D  N     RN  I          P+ D  ++ E+QG + ++     
Sbjct  1    MGLCTSKPSPNPSDSTNASINTRNNDIYRKPNSVSASPLPDGVNSKEDQGKQGEEEKESS  60

Query  310  GEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHI  489
                 G+KSPFFPFYSPSPAHYLF+KKSPARS  N+       R F          AKHI
Sbjct  61   NPNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSTNSTPKRFFRRPFPPPSP-----AKHI  115

Query  490  RAVLARRHGSVKPNGAAIPEGAESEG------GLDKSFGFSKHFG  606
            RAVLARRHGSVKPN AAIPEG+++E       GLDKSFGFSKHFG
Sbjct  116  RAVLARRHGSVKPNEAAIPEGSDAEAAGATGTGLDKSFGFSKHFG  160



>ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus domestica]
Length=602

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 101/155 (65%), Gaps = 14/155 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDW--RNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGG  327
            MG+CTSKPSL    +  ++D    +   +P P         N  G    R  +K E E  
Sbjct  1    MGLCTSKPSLNSHTFSPQSDSPPTKESSVPPP---------NAAGNGGNRRDEKAEEENV  51

Query  328  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  507
            +KSPFFPFYSPSPAHY F+KKSPARSP N  S+++  R F R   PP   AKHIRAVLAR
Sbjct  52   KKSPFFPFYSPSPAHYFFSKKSPARSPTNVSSNSTPKRFFKRPFPPPSP-AKHIRAVLAR  110

Query  508  RHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            RHGSVKPN AAIPEG E+E   GLDKSFGFSKHFG
Sbjct  111  RHGSVKPNEAAIPEGGEAEAVTGLDKSFGFSKHFG  145



>ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 99/153 (65%), Gaps = 10/153 (7%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS   R       +       VP+     NGEN  GE       K E E  +K
Sbjct  1    MGLCTSKPSPNSRTHSPQSGSPITKESSVPLPSAAGNGENPSGE-------KAEEENVKK  53

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVLARRH
Sbjct  54   SPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  112

Query  514  GSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            GSVKPN AAIPEG E EG  GLDKSFGFSKH G
Sbjct  113  GSVKPNQAAIPEGGEVEGPTGLDKSFGFSKHIG  145



>ref|XP_010268648.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nelumbo nucifera]
Length=611

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 95/158 (60%), Gaps = 21/158 (13%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQ-GGENQQRNIKK----GEV  318
            MG+C S PS     +   ++         PV++NP   EN   GEN+  N ++     E 
Sbjct  1    MGLCHSTPSPRPNPYSIREEE--------PVQENPRPSENAVNGENEDHNQQQQQQNAEA  52

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  498
            E G+KSPFFPFYSPSPAHY F+KKSPA S  + P            P      AKHIRAV
Sbjct  53   EVGKKSPFFPFYSPSPAHYFFSKKSPAPSSNSTPKRFFKKPFPPPSP------AKHIRAV  106

Query  499  LARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            LARRHGSVKPN AAIPEG ESEG  GLDKSFGFSKHF 
Sbjct  107  LARRHGSVKPNEAAIPEGNESEGIAGLDKSFGFSKHFA  144



>ref|XP_010268657.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nelumbo nucifera]
Length=601

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 95/158 (60%), Gaps = 21/158 (13%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQ-GGENQQRNIKK----GEV  318
            MG+C S PS     +   ++         PV++NP   EN   GEN+  N ++     E 
Sbjct  1    MGLCHSTPSPRPNPYSIREEE--------PVQENPRPSENAVNGENEDHNQQQQQQNAEA  52

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  498
            E G+KSPFFPFYSPSPAHY F+KKSPA S  + P            P      AKHIRAV
Sbjct  53   EVGKKSPFFPFYSPSPAHYFFSKKSPAPSSNSTPKRFFKKPFPPPSP------AKHIRAV  106

Query  499  LARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            LARRHGSVKPN AAIPEG ESEG  GLDKSFGFSKHF 
Sbjct  107  LARRHGSVKPNEAAIPEGNESEGIAGLDKSFGFSKHFA  144



>ref|XP_010550380.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Tarenaya hassleriana]
Length=646

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (72%), Gaps = 9/159 (6%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  318
            MG+CTSK         +D+   RN  +P    VK  P +   GEN   ++Q      G  
Sbjct  1    MGLCTSKSYPSPNSLNSDRNPARNSPVPASDSVKTPPSSSLHGENPSADDQCVENSGGHN  60

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  498
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   S NSTP+RFF+RPFPPPSPAKHIRAV
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPATTASGNSTPKRFFKRPFPPPSPAKHIRAV  119

Query  499  LARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            LARRHGSVKPNGAAIPEG+E++G   GLDKSFGFS++F 
Sbjct  120  LARRHGSVKPNGAAIPEGSEADGGGVGLDKSFGFSRNFS  158



>ref|XP_010550381.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Tarenaya hassleriana]
Length=614

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (72%), Gaps = 9/159 (6%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  318
            MG+CTSK         +D+   RN  +P    VK  P +   GEN   ++Q      G  
Sbjct  1    MGLCTSKSYPSPNSLNSDRNPARNSPVPASDSVKTPPSSSLHGENPSADDQCVENSGGHN  60

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAV  498
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   S NSTP+RFF+RPFPPPSPAKHIRAV
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPATTASGNSTPKRFFKRPFPPPSPAKHIRAV  119

Query  499  LARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            LARRHGSVKPNGAAIPEG+E++G   GLDKSFGFS++F 
Sbjct  120  LARRHGSVKPNGAAIPEGSEADGGGVGLDKSFGFSRNFS  158



>ref|XP_010268715.1| PREDICTED: CDPK-related kinase 5 [Nelumbo nucifera]
Length=609

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 86/166 (52%), Positives = 95/166 (57%), Gaps = 29/166 (17%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGE---NQGGENQQRNIK------  306
            MG+CTSKPS    D    ++  R       V +NP   E   N G EN  +  +      
Sbjct  1    MGLCTSKPS-PRPDLYASREEKR-------VPENPKPSEVSVNGGNENHNQQQQHHHQQQ  52

Query  307  ----KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppps  474
                K E E G+KSPFFPFYSPSPAHYLF+KKSPA S  + P            P     
Sbjct  53   RQQQKAEAEVGKKSPFFPFYSPSPAHYLFSKKSPAPSSNSTPRRFFKKPFPPPSP-----  107

Query  475  pAKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
             AKHIRAVLARRHGSVKPN AAIPEG ESE   GLDKSFGFSKHF 
Sbjct  108  -AKHIRAVLARRHGSVKPNEAAIPEGNESESIAGLDKSFGFSKHFA  152



>ref|XP_007204593.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
 gb|EMJ05792.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
Length=602

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 99/153 (65%), Gaps = 10/153 (7%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS           + +     V   D P NGEN   +       K E E  +K
Sbjct  1    MGICTSKPSPNSHTSSPKSDSPQTKESSVKQPDAPANGENPRDD-------KPEAENVKK  53

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVL RRH
Sbjct  54   SPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFKRPFPPPSP-AKHIRAVLLRRH  112

Query  514  GSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            GSVKPN AAIPEG+E+E   GLDKSFGFSKHFG
Sbjct  113  GSVKPNEAAIPEGSEAEAATGLDKSFGFSKHFG  145



>ref|XP_010103697.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXB96709.1| CDPK-related protein kinase [Morus notabilis]
Length=603

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 104/156 (67%), Gaps = 15/156 (10%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIP---VPVKDNPDNGENQGGENQQRNIKKGEVEG  324
            MG+C SKPS ++    + Q  + N  +P   +PV DN  +           +++  E + 
Sbjct  1    MGLCVSKPS-QNSVLSDPQPANGNDPVPASHIPVSDNAASANG--------DVRSAESQN  51

Query  325  GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLA  504
            G+KSPFF FYSPSPAHYLF KKSPARSPANA S ++  R F R   PP   AKH++AVLA
Sbjct  52   GKKSPFFSFYSPSPAHYLFGKKSPARSPANASSISTPKRFFRRPFPPPSP-AKHLKAVLA  110

Query  505  RRHGSVKPNGAAIPEGAESEGG--LDKSFGFSKHFG  606
            RRHGSVKPN AAIPEG+E E G  LDKSFGFSKHFG
Sbjct  111  RRHGSVKPNEAAIPEGSEGEPGATLDKSFGFSKHFG  146



>emb|CDP02477.1| unnamed protein product [Coffea canephora]
Length=602

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 100/156 (64%), Gaps = 16/156 (10%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKD--NPDNGENQGG-ENQQRNIKKGEVEG  324
            MGVCTSKPS E    ++ +Q       P P KD  NP   ++ GG  + Q+  KK + E 
Sbjct  1    MGVCTSKPSPEPNLHQDSKQN------PTPTKDKNNPAQVKDNGGNSSSQQESKKSDAES  54

Query  325  GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLA  504
             +KSP FPFYSPSPAHYLF+KKSPARS AN+       R F          AKHI+AVLA
Sbjct  55   AKKSPLFPFYSPSPAHYLFSKKSPARSSANSTPRRFFKRPFPPPSP-----AKHIKAVLA  109

Query  505  RRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            +RHGSVKPN A+IPEG ES+    LDKSFGFSKHFG
Sbjct  110  KRHGSVKPNEASIPEGNESDTVAALDKSFGFSKHFG  145



>ref|XP_008241522.1| PREDICTED: CDPK-related kinase 5 [Prunus mume]
Length=602

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 98/153 (64%), Gaps = 10/153 (7%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS           + +     V   D   NGEN   +       K E E  +K
Sbjct  1    MGICTSKPSPNSHTSSPKSDSPQTKESSVKQPDASANGENPRDD-------KPEAENVKK  53

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KKSPARSPAN  S+++  R F R   PP   AKHIRAVL RRH
Sbjct  54   SPFFPFYSPSPAHYFFSKKSPARSPANVSSNSTPKRFFRRPFPPPSP-AKHIRAVLLRRH  112

Query  514  GSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            GSVKPN AAIPEG+E+E   GLDKSFGFSKHFG
Sbjct  113  GSVKPNEAAIPEGSEAEAATGLDKSFGFSKHFG  145



>ref|XP_006290767.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23665.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKP+  +    +DQ   RN  +P      P      GG   +        EG +K
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSTSSVNGGNPVEDQCVVASNEG-KK  55

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAH  F+KK+P RSPA   S NSTP+RFF+RPFPPPSPAKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHSFFSKKTPGRSPATNASGNSTPKRFFKRPFPPPSPAKHIRAVLARRH  115

Query  514  GSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            GSVKPN AAIPEG+E+EG   GLDKSFGFSK F 
Sbjct  116  GSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFA  149



>ref|XP_006290766.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23664.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKP+  +    +DQ   RN  +P      P      GG   +        EG +K
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSTSSVNGGNPVEDQCVVASNEG-KK  55

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAH  F+KK+P RSPA   S NSTP+RFF+RPFPPPSPAKHIRAVLARRH
Sbjct  56   SPFFPFYSPSPAHSFFSKKTPGRSPATNASGNSTPKRFFKRPFPPPSPAKHIRAVLARRH  115

Query  514  GSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            GSVKPN AAIPEG+E+EG   GLDKSFGFSK F 
Sbjct  116  GSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFA  149



>ref|XP_009758726.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009758727.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nicotiana sylvestris]
Length=602

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 96/156 (62%), Gaps = 18/156 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTSKPS    ++  D  T    G   PVK  P N ++          KK E   G+K
Sbjct  1    MGACTSKPS----NFSVDDITVAGDGATFPVKSGPSNDDDVNSHQT----KKDEPSVGKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  514  GSVKPNGAAIPEGAESE------GGLDKSFGFSKHF  603
            G+VKPN +AIPEG ESE       GLDKSFGFSK+F
Sbjct  109  GTVKPNESAIPEGNESEVGDGGGAGLDKSFGFSKNF  144



>ref|NP_001190048.1| CDPK-related kinase [Arabidopsis thaliana]
 gb|AEE78677.1| CDPK-related kinase [Arabidopsis thaliana]
Length=632

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 84/154 (55%), Positives = 102/154 (66%), Gaps = 12/154 (8%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKP+  +    +DQ   RN  +P      P +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVKPSS-SSVNGEDQCVTTTNNE---GKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  514  GSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            GSVKPN +AIPEG+E+EG   GLDKSFGFSK F 
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFA  145



>ref|XP_002306462.1| CROOKED family protein [Populus trichocarpa]
 gb|EEE93458.1| CROOKED family protein [Populus trichocarpa]
Length=607

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 81/154 (53%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS     +       ++  IP      PD        N   N  K  VE  +K
Sbjct  1    MGICTSKPSPNSTLFSPVAIQAKDNSIPTNDTAKPDPA--TASLNDHTN--KTTVEPVKK  56

Query  334  spffpfyspspAHYLFakksparspanapssnstprrff--rrpfpppspAKHIRAVLAR  507
            SP FPFYSPSPAH  F+KKS         ++++        +RPFPPPSPAKHIRAVLAR
Sbjct  57   SPLFPFYSPSPAHRFFSKKSSPARSPARNAASANSTPKRFFKRPFPPPSPAKHIRAVLAR  116

Query  508  RHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFG  606
            RHGSVKPN AAIPEG+E+ G GLDKSFGFSKHFG
Sbjct  117  RHGSVKPNEAAIPEGSETGGEGLDKSFGFSKHFG  150



>ref|XP_011085503.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=613

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 19/162 (12%)
 Frame = +1

Query  154  MGVCTSKP--SLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGE--------NQQRNI  303
            MGVCTSKP  S EH ++ + ++   +V +P   +DNP   +  GG          +++N 
Sbjct  1    MGVCTSKPRPSSEH-NFHSSEEIKPSV-VPGQDEDNPVGLKTNGGNARDSGNLGEKKKNE  58

Query  304  KKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAK  483
            +  EV  G+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AK
Sbjct  59   ENHEV--GKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSGTPRRFFKKPFPPPSP---AK  113

Query  484  HIRAVLARRHGSVKPNGAAIPEGAE--SEGGLDKSFGFSKHF  603
            HI+AVLARRHGSVKPN AAIPEG E   + GLDKSFGFSK+F
Sbjct  114  HIKAVLARRHGSVKPNEAAIPEGKEVAEKTGLDKSFGFSKNF  155



>ref|XP_002876036.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52295.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 101/156 (65%), Gaps = 20/156 (13%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVP--VKDNPDNGENQGGENQQRNIKKGEVEGG  327
            MG+CTSKP+  +    +DQ   RN  +P    VK +  N +     N +          G
Sbjct  1    MGLCTSKPNSPN----SDQIPARNSPLPASESVKPSSSNEDQCVTTNNE----------G  46

Query  328  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLAR  507
            +KSPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLAR
Sbjct  47   KKSPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLAR  105

Query  508  RHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            RHGSVKPN AAIPEG+E+EG   GLDKSFGFSK F 
Sbjct  106  RHGSVKPNSAAIPEGSEAEGGGVGLDKSFGFSKSFA  141



>gb|KDP31899.1| hypothetical protein JCGZ_12360 [Jatropha curcas]
Length=630

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN AAIPEG+E+E  GLDKSFGFSKHFG
Sbjct  130  AKHIRAVLARRHGSVKPNEAAIPEGSEAEVAGLDKSFGFSKHFG  173



>ref|NP_190622.1| CDPK-related kinase [Arabidopsis thaliana]
 sp|Q9SCS2.1|CAMK5_ARATH RecName: Full=CDPK-related kinase 5; Short=AtCRK5; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 1 [Arabidopsis 
thaliana]
 emb|CAB62482.1| CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE78676.1| CDPK-related kinase [Arabidopsis thaliana]
Length=601

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 101/154 (66%), Gaps = 12/154 (8%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKP+  +    +DQ   RN  +P        +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVK-PSSSSVNGEDQCVTTTNNE---GKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  514  GSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            GSVKPN +AIPEG+E+EG   GLDKSFGFSK F 
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFA  145



>ref|XP_006425845.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006425848.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39085.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39088.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=333

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKDNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>gb|AAL30814.1|AF435446_1 calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
 emb|CAA70572.1| CDPK-related protein kinase [Arabidopsis thaliana]
Length=601

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 101/154 (66%), Gaps = 12/154 (8%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKP+  +    +DQ   RN  +P        +  +  GE+Q       E   G+K
Sbjct  1    MGLCTSKPNSSN----SDQTPARNSPLPASESVK-PSSSSVNGEDQCVTTTNNE---GKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KK+PARSPA   ++++  R F R   PP   AKHIRAVLARRH
Sbjct  53   SPFFPFYSPSPAHYFFSKKTPARSPATNSTNSTPKRFFKRPFPPPSP-AKHIRAVLARRH  111

Query  514  GSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            GSVKPN +AIPEG+E+EG   GLDKSFGFSK F 
Sbjct  112  GSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFA  145



>gb|KHF98882.1| CDPK-related protein kinase [Gossypium arboreum]
Length=626

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 101/174 (58%), Gaps = 28/174 (16%)
 Frame = +1

Query  154  MGVCTSKPSLEHR---DWRNDQQTDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  303
            MG+CTSKPS       D RN     RN  I      VP    PD  NG +    +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHKSNSVPASPLPDVVNGNHNHNLDQAKGT  60

Query  304  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  471
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  472  spAKHIRAVLARRHGSVKPNGAAIPEGAESEGG---------LDKSFGFSKHFG  606
              AKHIRAVLARRHGSVKPN +AIPEG+E++G          LDKSFGFSKHFG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATVAVLDKSFGFSKHFG  169



>gb|AAL30820.1|AF435452_1 calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana 
tabacum]
Length=602

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 98/156 (63%), Gaps = 18/156 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTSKPS    ++  D  T    G   PVK  P N ++    +Q +N    E   G+K
Sbjct  1    MGACTSKPS----NFSVDDITVAGDGAIFPVKSGPSNDDDVNS-HQTKN---DEPSVGKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  514  GSVKPNGAAIPEGAESE------GGLDKSFGFSKHF  603
            G+VKPN +AIPEG ESE       GLDKSFGFSK+F
Sbjct  109  GTVKPNESAIPEGNESEVGDGGGAGLDKSFGFSKNF  144



>ref|XP_003624963.1| Calcium-dependent protein kinase-like protein [Medicago truncatula]
 gb|ABD33022.1| Protein kinase; Calcium-binding EF-hand [Medicago truncatula]
 gb|AES81181.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=595

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG+E E GLDKSFGFSKHF
Sbjct  96   AKHIRALLARRHGSVKPNEATIPEGSECEVGLDKSFGFSKHF  137



>ref|XP_004493390.1| PREDICTED: CDPK-related kinase 7-like [Cicer arietinum]
Length=593

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG+E E GLDKSFGFSKHF
Sbjct  94   AKHIRALLARRHGSVKPNEATIPEGSECEVGLDKSFGFSKHF  135



>ref|XP_011007668.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=607

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 88/154 (57%), Gaps = 7/154 (5%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS             ++  IP      PD       ++     KK  VE  +K
Sbjct  1    MGICTSKPSPNSTLSSPVAIQAKDNSIPTNETAKPDPTTASLNDHT----KKTTVEPVKK  56

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfppp--spAKHIRAVLAR  507
            SP FPFYSPSPAH  F+KK          ++++          P P  SPAKHIRAVLAR
Sbjct  57   SPLFPFYSPSPAHRFFSKKPSPARSPARNAASANSTPKRFFKRPFPPPSPAKHIRAVLAR  116

Query  508  RHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFG  606
            RHGSVKPN AAIPEG+E+ G GLDKSFGFSKHFG
Sbjct  117  RHGSVKPNEAAIPEGSEAGGEGLDKSFGFSKHFG  150



>ref|XP_010112837.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Morus notabilis]
 gb|EXC34960.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Morus notabilis]
Length=618

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGS+KPN A+IPEG+E + GLDK+FGFSKHFG
Sbjct  82   AKHIRALLARRHGSIKPNEASIPEGSECDVGLDKNFGFSKHFG  124



>ref|XP_006425846.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39086.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=429

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKDNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>ref|XP_006829951.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
 gb|ERM97367.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
Length=606

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN AAIPEG E+E  LDKSFGFSKHF 
Sbjct  106  AKHIRAVLARRHGSVKPNEAAIPEGREAEVTLDKSFGFSKHFS  148



>ref|XP_006425847.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 gb|ESR39087.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=455

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKDNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>ref|XP_008457867.1| PREDICTED: CDPK-related kinase 5-like [Cucumis melo]
Length=622

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 84/168 (50%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRN---------------VGIPVPVKDNPDNGENQGGEN  288
            MG+C SKPS  + D   ++   R                +G   P+  + +NG + G + 
Sbjct  1    MGLCNSKPS-PNSDLFAEKSGSRTPNEGSNSTQPNSVTAMGGASPLPPSSENGRD-GRKT  58

Query  289  QQRNIKKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpp  468
              R  +  E++  +KSPFFPFYSPSPAHYLF+KKSPARSPANA ++++  R F +   PP
Sbjct  59   GNRRSESHEMDNVKKSPFFPFYSPSPAHYLFSKKSPARSPANASANSTPKRFFRKPFPPP  118

Query  469  pspAKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
               AKHIRAVLARRHGSVKPN  +IPEG+E+EG  GLDK+FGFSKH G
Sbjct  119  SP-AKHIRAVLARRHGSVKPNEVSIPEGSEAEGVTGLDKNFGFSKHLG  165



>ref|XP_010558347.1| PREDICTED: CDPK-related kinase 5-like [Tarenaya hassleriana]
Length=615

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 114/159 (72%), Gaps = 9/159 (6%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVP--VKDNPDN---GENQGGENQQRNIKKGEV  318
            MG+CTSK         +D+   RN  +P    VK  P +   GEN  G++Q      G  
Sbjct  1    MGLCTSKSHPSPNSPNSDRNPYRNSPLPASDSVKTPPSSSLHGENPSGDDQCVENGGGRN  60

Query  319  EGGRKspffpfyspspAHYLFakksparspanapss-nstprrffrrpfpppspAKHIRA  495
            EG +KSPFFPFYSPSPAHY F+KK+PARSPA   +S NSTP+RFF+RPFPPPSPAKHIRA
Sbjct  61   EG-KKSPFFPFYSPSPAHYFFSKKTPARSPAKNAASGNSTPKRFFKRPFPPPSPAKHIRA  119

Query  496  VLARRHGSVKPNGAAIPEGAE--SEGGLDKSFGFSKHFG  606
            VLARRHGSVKPNGAAIPEG+E  S  GLDK+FGFSK+F 
Sbjct  120  VLARRHGSVKPNGAAIPEGSEAGSGVGLDKNFGFSKNFS  158



>ref|XP_004511959.1| PREDICTED: CDPK-related kinase 5-like [Cicer arietinum]
Length=587

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 87/153 (57%), Gaps = 24/153 (16%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS       N   + R     +P    P++  +Q   N        E E G +
Sbjct  1    MGLCTSKPS------SNPTHSSRKFNTELP---QPNSVTSQPLTNSVNGQNPNETENGNR  51

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAH  F+K SPAR     P    +P             AKHIR++LARRH
Sbjct  52   SPFFPFYSPSPAHNFFSKMSPARKFFKKPFPPPSP-------------AKHIRSLLARRH  98

Query  514  GSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            GSVKPN A+IPEGAE+E    LDK+FGFSKHFG
Sbjct  99   GSVKPNEASIPEGAEAEPVAALDKNFGFSKHFG  131



>gb|KDO79302.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=429

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKGNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>gb|KDO79301.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=455

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKGNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>ref|XP_002310736.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
 gb|EEE91186.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
Length=606

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 83/159 (52%), Gaps = 18/159 (11%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI-----PVPVKDNPDNGENQGGENQQRNIKKGEV  318
            MG+CTSKPS        +      + I      +P KD P         N Q N    E 
Sbjct  1    MGICTSKPS-------PNSTLSSPIAIQANDNSIPTKDTPRPDPRTPNVNDQNNSTGLE-  52

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp--spAKHIR  492
                K   F F+SPSPAHY F+KKS         ++++          P P  SPAKHIR
Sbjct  53   --SVKKSPFNFFSPSPAHYFFSKKSSPARSPARNAASANSTPKRLFKRPFPPPSPAKHIR  110

Query  493  AVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN A IPEG E+E  GL KSFGFSKHFG
Sbjct  111  AVLARRHGSVKPNEATIPEGGEAEAAGLVKSFGFSKHFG  149



>ref|XP_002463267.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
 gb|EER99788.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
Length=593

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF
Sbjct  95   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHF  136



>ref|XP_004958484.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=592

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHF  135



>ref|XP_008668263.1| PREDICTED: uncharacterized LOC100381527 isoform X1 [Zea mays]
 tpg|DAA41584.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA41585.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
Length=592

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHF  135



>ref|XP_006425849.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006466639.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
 gb|ESR39089.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=611

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKDNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>gb|EMS61574.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Triticum urartu]
Length=903

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  481  KHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            +HIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF
Sbjct  21   RHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHF  61



>ref|XP_003562581.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Brachypodium distachyon]
Length=596

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDKSFGFSKHF
Sbjct  98   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKSFGFSKHF  139



>ref|XP_004984283.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=588

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEGAE + GLDKSFG+SKHF 
Sbjct  90   AKHIRALLARRHGSVKPNEASIPEGAEPDLGLDKSFGYSKHFA  132



>ref|XP_004148051.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN62050.1| hypothetical protein Csa_2G292800 [Cucumis sativus]
Length=621

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 21/168 (13%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRN---------------VGIPVPVKDNPDNGENQGGEN  288
            MG+C SKPS  + D   ++   R                +G   P+  + +NG +  G  
Sbjct  1    MGLCNSKPS-PNSDLFAEKSGSRTPNEGSNSTQPNSVTAMGGASPLPPSSENGRD--GRA  57

Query  289  QQRNIKKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpp  468
              R  +  E++  +KSPFFPFYSPSPAHYLF+KKSPARSPANA ++++  R F +   PP
Sbjct  58   GNRRNESHEMDNVKKSPFFPFYSPSPAHYLFSKKSPARSPANASANSTPKRFFRKPFPPP  117

Query  469  pspAKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
               AKHIRAVLARRHGSVKPN  +IPEG E+EG  GLDK+FGFSKH G
Sbjct  118  SP-AKHIRAVLARRHGSVKPNEVSIPEGTEAEGVTGLDKNFGFSKHLG  164



>gb|EAZ16167.1| hypothetical protein OsJ_31616 [Oryza sativa Japonica Group]
Length=212

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF
Sbjct  97   AKHIRALLARRHGSVKPNEAPIPEGGETEVGLDKGFGFSKHF  138



>ref|XP_007163947.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
 gb|ESW35941.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
Length=580

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDKSFGFS HF
Sbjct  81   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKSFGFSNHF  122



>ref|XP_003518984.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Glycine max]
 gb|KHN27043.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Glycine soja]
Length=583

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN AAIPEG+E E GLDKSFGF+K F 
Sbjct  84   AKHIRALLARRHGSVKPNEAAIPEGSECEVGLDKSFGFAKQFS  126



>gb|EYU44373.1| hypothetical protein MIMGU_mgv1a003006mg [Erythranthe guttata]
Length=616

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 100/161 (62%), Gaps = 14/161 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGEN---------QGGENQQRNIK  306
            MG+CTSKP    +   +     +  G+ +  K+N  + EN           G  +++   
Sbjct  1    MGICTSKPKSSPKPNFHSSDEIKPAGVRIQDKENTVSSENGNNNDGNATSSGNFEEKKRS  60

Query  307  KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKH  486
            +G  EGG+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AKH
Sbjct  61   EGNHEGGKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSGTPRRFFKRPFPPPSP---AKH  117

Query  487  IRAVLARRHGSVKPNGAAIPEGAE-SEG-GLDKSFGFSKHF  603
            I+AVLARRHGSVKPN AAIPEG E S+G GLD+SFGFSK F
Sbjct  118  IKAVLARRHGSVKPNEAAIPEGKEVSDGAGLDRSFGFSKKF  158



>ref|XP_004142011.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_004167564.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN48509.1| hypothetical protein Csa_6G490240 [Cucumis sativus]
Length=604

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 101/160 (63%), Gaps = 23/160 (14%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPV------PVKDN---PDNGENQGGENQQRNIK  306
            MG+C SKPS           +   V +P       P++ +   PD G N+  E ++ +  
Sbjct  1    MGLCVSKPS-----------STTVVAVPAIQDALPPLETSLPSPDAG-NRTTETREGDKT  48

Query  307  KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKH  486
              ++E  +KSP+FP ++PSPAHYLF+KKSP RSPAN  S+++  R F +   PP   AKH
Sbjct  49   PFDLEVAKKSPYFPLFTPSPAHYLFSKKSPLRSPANVSSNSTPKRFFKKPFPPPSP-AKH  107

Query  487  IRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHF  603
            I AVLARRHGSVKPN A+IPEG   EG GLDKSFGFSKHF
Sbjct  108  IMAVLARRHGSVKPNEASIPEGNVIEGPGLDKSFGFSKHF  147



>ref|XP_010427514.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Camelina sativa]
Length=611

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  85   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFA  127



>ref|XP_009115721.1| PREDICTED: CDPK-related kinase 5 [Brassica rapa]
Length=594

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN AAIPEG E+EG GLDKSFGFSK F 
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGGEAEGVGLDKSFGFSKSFA  138



>emb|CDY52824.1| BnaAnng11710D [Brassica napus]
Length=594

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN AAIPEG E+EG GLDKSFGFSK F 
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGGEAEGVGLDKSFGFSKSFA  138



>ref|XP_010246175.1| PREDICTED: CDPK-related kinase 1-like [Nelumbo nucifera]
Length=576

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHG+VKPN A IPEG+E E GLDKSFGFSKHF
Sbjct  78   AKHIKALLARRHGAVKPNEATIPEGSECEVGLDKSFGFSKHF  119



>gb|KDO79300.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=611

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 15/160 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNV-----GIPVPVKDNPDNGENQGGENQQRNIKKGE-  315
            MG+C SKPS      ++D   ++N      G P+P   +P N E+Q   N+  N+K  + 
Sbjct  1    MGLCNSKPSSNSSSPKSDLIRNKNTPVPANGTPIPAP-SPLNAESQSNNNRT-NVKGNDD  58

Query  316  -VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIR  492
             V  G+KSPFFPFYSPSPAHY F+KKS     +   + N   +R F  P P    AKHI+
Sbjct  59   AVIEGKKSPFFPFYSPSPAHYFFSKKSSPARSSANSTPNRFFKRPFPPPSP----AKHIK  114

Query  493  AVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN AAIPEG+E E   GL+KSFGFSKHF 
Sbjct  115  AVLARRHGSVKPNEAAIPEGSEPEPAAGLNKSFGFSKHFA  154



>ref|XP_010271816.1| PREDICTED: CDPK-related kinase 7-like [Nelumbo nucifera]
Length=576

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A IPEG+E E GLDK+FGFSKHF
Sbjct  78   AKHIKALLARRHGSVKPNEATIPEGSECEVGLDKNFGFSKHF  119



>gb|KJB43647.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=591

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 99/174 (57%), Gaps = 28/174 (16%)
 Frame = +1

Query  154  MGVCTSKPSLEHR---DWRNDQQTDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  303
            MG+CTSKPS       D RN     RN  I      VP    PD  NG      +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHNSNSVPASPLPDVVNGNRNHNLDQAKGT  60

Query  304  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  471
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  472  spAKHIRAVLARRHGSVKPNGAAIPEGAE---------SEGGLDKSFGFSKHFG  606
              AKHIRAVLARRHGSVKPN +AIPEG+E         +  GLDKSFGFSKHFG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATGAGLDKSFGFSKHFG  169



>ref|XP_002522315.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF39999.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=467

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAE---SEGGLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN AAIPEG+E      GLDKSFGFSKHFG
Sbjct  128  AKHIRAVLARRHGSVKPNEAAIPEGSEGADMATGLDKSFGFSKHFG  173



>ref|XP_011039202.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=606

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 83/159 (52%), Gaps = 18/159 (11%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI-----PVPVKDNPDNGENQGGENQQRNIKKGEV  318
            MG+CTSKPS        +      + I      +P KD P         N Q N    E 
Sbjct  1    MGICTSKPS-------PNSTLSSPIAIQAKDNSIPTKDTPRPDPRTPNVNDQNNSTGLE-  52

Query  319  EGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp--spAKHIR  492
                K   F FYSPSPAHY F+KKS         ++++          P P  SPAKHIR
Sbjct  53   --SVKKSPFNFYSPSPAHYFFSKKSSPARSPARNATSANSTPKRLFKRPFPPPSPAKHIR  110

Query  493  AVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHFG  606
            AVLARRHGSVKPN A IPEG E+E  G+ KSFGFSKHFG
Sbjct  111  AVLARRHGSVKPNEATIPEGGEAEAAGVVKSFGFSKHFG  149



>ref|NP_001169442.1| uncharacterized LOC100383313 [Zea mays]
 gb|ACN33785.1| unknown [Zea mays]
 tpg|DAA63857.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN  +IPEG E E GLDKSFGFSKHF
Sbjct  94   AKHIRALLARRHGSVKPNEVSIPEGGEPELGLDKSFGFSKHF  135



>gb|KJB43646.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=626

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 99/174 (57%), Gaps = 28/174 (16%)
 Frame = +1

Query  154  MGVCTSKPSLEHR---DWRNDQQTDRNVGI-----PVPVKDNPD--NGENQGGENQQRNI  303
            MG+CTSKPS       D RN     RN  I      VP    PD  NG      +Q +  
Sbjct  1    MGLCTSKPSPNPSFPPDSRNTPIHPRNKDIHHNSNSVPASPLPDVVNGNRNHNLDQAKGT  60

Query  304  KKGEVEG----GRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp  471
            ++ E       G+KSPFFPFYSPSPAHYLF+KKSPARS AN+       + F        
Sbjct  61   EEKESSNSNNEGKKSPFFPFYSPSPAHYLFSKKSPARSSANSTPKRFFRKPFPPPSP---  117

Query  472  spAKHIRAVLARRHGSVKPNGAAIPEGAE---------SEGGLDKSFGFSKHFG  606
              AKHIRAVLARRHGSVKPN +AIPEG+E         +  GLDKSFGFSKHFG
Sbjct  118  --AKHIRAVLARRHGSVKPNESAIPEGSEADGDGAAGATGAGLDKSFGFSKHFG  169



>ref|XP_010515424.1| PREDICTED: CDPK-related kinase 5 [Camelina sativa]
Length=606

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN +AIPEG+E+EG   GLDKSFGFSK F 
Sbjct  105  AKHIRAVLARRHGSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFA  150



>ref|NP_191235.1| CDPK-related kinase 7 [Arabidopsis thaliana]
 sp|Q9LET1.1|CAMK7_ARATH RecName: Full=CDPK-related kinase 7; Short=AtCRK7; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK7 [Arabidopsis 
thaliana]
 emb|CAC00739.1| calcium-dependent protein kinase-like [Arabidopsis thaliana]
 gb|AEE79562.1| CDPK-related kinase 7 [Arabidopsis thaliana]
Length=577

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFA  121



>dbj|BAC16472.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
 dbj|BAD31271.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
Length=594

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF
Sbjct  96   AKHIRALLARRHGSVKPNEAPIPEGGETEVGLDKGFGFSKHF  137



>ref|XP_008377644.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Malus domestica]
Length=577

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDK+FGFSK FG
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKNFGFSKQFG  122



>ref|XP_008377637.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Malus domestica]
Length=578

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDK+FGFSK FG
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKNFGFSKQFG  122



>ref|XP_010516279.1| PREDICTED: CDPK-related kinase 7 [Camelina sativa]
Length=582

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  83   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFA  125



>ref|XP_009371242.1| PREDICTED: CDPK-related kinase 7-like [Pyrus x bretschneideri]
Length=577

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG+E E  LDKSFGFSK F
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVALDKSFGFSKQF  121



>ref|XP_010427515.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Camelina sativa]
Length=584

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  85   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFA  127



>ref|XP_002522159.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40200.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=512

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG ES+ GLDK+FG+SKHF
Sbjct  81   AKHIRALLARRHGSVKPNEASIPEGNESDIGLDKNFGYSKHF  122



>ref|XP_010504583.1| PREDICTED: CDPK-related kinase 7-like [Camelina sativa]
Length=582

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  83   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFA  125



>ref|NP_001146092.1| uncharacterized protein LOC100279624 [Zea mays]
 gb|ACL53208.1| unknown [Zea mays]
 tpg|DAA45496.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=213

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF 
Sbjct  88   AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFA  130



>gb|EEC82532.1| hypothetical protein OsI_27055 [Oryza sativa Indica Group]
Length=591

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG E+E GLDK FGFSKHF
Sbjct  93   AKHIRALLARRHGSVKPNEAPIPEGGEAEVGLDKGFGFSKHF  134



>ref|XP_006290768.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23666.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=568

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFS  122



>ref|XP_006290769.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23667.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=604

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSECEVGLDKKFGFSKQFS  122



>dbj|BAK00699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E E GLDK FGFSKHF
Sbjct  97   AKHIRALLARRHGSVKPNEASIPEGGEPELGLDKGFGFSKHF  138



>ref|XP_008777902.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQF  120



>gb|KDO53618.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
 gb|KDO53619.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
 gb|KDO53620.1| hypothetical protein CISIN_1g0074581mg, partial [Citrus sinensis]
Length=158

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQF  119



>ref|XP_004288057.1| PREDICTED: CDPK-related kinase 5 [Fragaria vesca subsp. vesca]
Length=614

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 83/159 (52%), Positives = 101/159 (64%), Gaps = 12/159 (8%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGE------  315
            MG+CTSKP+  H    +  Q+D  VG     ++N  + + +   N+    +K        
Sbjct  1    MGLCTSKPAFPHST-TSSPQSDSQVGKDPAKENNSSSADVENPRNEHNGEEKLGGGEEET  59

Query  316  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRA  495
            V   +KSPFFPFYSPSPAHY F+ K          S+ STP RFF+RPFPPPSPAKHIRA
Sbjct  60   VIAVKKSPFFPFYSPSPAHY-FSSKKSPARSPANASAKSTPNRFFKRPFPPPSPAKHIRA  118

Query  496  VLARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHF  603
            +LARRHG+VKPN  AIPEG+E EG   GLDKSFGFSKH 
Sbjct  119  LLARRHGTVKPN-EAIPEGSEVEGGLTGLDKSFGFSKHL  156



>ref|XP_010542604.1| PREDICTED: CDPK-related kinase 1 [Tarenaya hassleriana]
Length=575

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGS+KPN A+IPEG+E E GLDK+FGFSK F 
Sbjct  77   AKHIRALLARRHGSIKPNEASIPEGSECEIGLDKNFGFSKQFA  119



>ref|XP_008798377.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQF  120



>ref|XP_002262855.3| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
Length=602

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEG---AESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGSVKPN AAIPEG   AE   GLDKSFGFSKHFG
Sbjct  101  AKHIRAALARRHGSVKPNEAAIPEGNEAAEGVAGLDKSFGFSKHFG  146



>ref|XP_006836275.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
 gb|ERM99128.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
Length=580

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN AAIPEG E E GLDK+FGFSKHF
Sbjct  78   AKHIKALLARRHGSVKPNEAAIPEGNEGELGLDKNFGFSKHF  119



>gb|KJB35810.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=479

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+++LARRHGS+KPN A+IPEG+E E GL+KSFGFSKHF
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGSECEVGLNKSFGFSKHF  119



>ref|XP_010503722.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=606

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG---GLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN +AIPEG+E+EG   GLDKSFGFSK F 
Sbjct  105  AKHIRALLARRHGSVKPNSSAIPEGSEAEGGGVGLDKSFGFSKSFA  150



>ref|XP_010907987.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X1 [Elaeis guineensis]
Length=577

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQF  120



>gb|EYU39405.1| hypothetical protein MIMGU_mgv1a0043832mg, partial [Erythranthe 
guttata]
Length=371

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 95/154 (62%), Gaps = 12/154 (8%)
 Frame = +1

Query  154  MGVCTSKP-SLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGR  330
            MGVCTSKP + +  D+ +  +    V      K+NP    N G EN ++N      + G+
Sbjct  1    MGVCTSKPKTSQELDFNSSGEIKPEVNSIDDGKENPAQSAN-GAENAKKND-----DVGK  54

Query  331  KspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARR  510
            KSPFFPFYSPSPAHY F+KKSPARSPA    +     +    P  P   AKHIRAVLARR
Sbjct  55   KSPFFPFYSPSPAHYFFSKKSPARSPAPTSGTPRRFFKRPFPPPSP---AKHIRAVLARR  111

Query  511  HGSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            HGSVKPN AAIPEG E     GLDKSFGF+K+  
Sbjct  112  HGSVKPNEAAIPEGKEVADGNGLDKSFGFTKNLS  145



>ref|XP_011099192.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Sesamum indicum]
Length=611

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 84/161 (52%), Positives = 98/161 (61%), Gaps = 19/161 (12%)
 Frame = +1

Query  154  MGVCTSKP--------SLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGG-ENQQRNIK  306
            MG+CTSKP        S E ++     Q   N    VP  +N  N ++ G  + + RN +
Sbjct  1    MGICTSKPRPFPEPNLSDECKNAAVSAQDQENA---VPAGNNDVNAKSSGNLDEKNRNEE  57

Query  307  KGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKH  486
            K    GG+KSPFFPFYSPSPAHYLF+KKSPARSPA    +     +    P  P   AKH
Sbjct  58   KSG--GGKKSPFFPFYSPSPAHYLFSKKSPARSPAPGSVTPRRFFKRPFPPPSP---AKH  112

Query  487  IRAVLARRHGSVKPNGAAIPEGAE-SEG-GLDKSFGFSKHF  603
            I+AVLARRHGSVKPN AAIPEG E SE   LDKSFGF K F
Sbjct  113  IKAVLARRHGSVKPNEAAIPEGKEVSEALSLDKSFGFPKKF  153



>emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera]
Length=606

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEG---AESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGSVKPN AAIPEG   AE   GLDKSFGFSKHFG
Sbjct  101  AKHIRAALARRHGSVKPNEAAIPEGNEAAEGVAGLDKSFGFSKHFG  146



>ref|XP_010907988.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X2 [Elaeis guineensis]
Length=556

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGFSK F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFSKQF  120



>ref|XP_007028316.1| CDPK-related kinase 1 [Theobroma cacao]
 gb|EOY08818.1| CDPK-related kinase 1 [Theobroma cacao]
Length=576

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGS+KPN A+IPEG E + GLDK+FGFSKHF
Sbjct  78   AKHIRALLARRHGSIKPNEASIPEGNECDIGLDKNFGFSKHF  119



>gb|KJB35809.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=576

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+++LARRHGS+KPN A+IPEG+E E GL+KSFGFSKHF
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGSECEVGLNKSFGFSKHF  119



>ref|XP_003535908.1| PREDICTED: CDPK-related kinase 1-like [Glycine max]
Length=583

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPE +E E GLDKSFGF+K F 
Sbjct  84   AKHIRALLARRHGSVKPNEASIPEASECELGLDKSFGFAKQFS  126



>ref|XP_008464945.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Cucumis melo]
Length=600

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF 
Sbjct  74   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFA  116



>ref|XP_008464946.1| PREDICTED: CDPK-related kinase 1-like isoform X2 [Cucumis melo]
Length=572

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF 
Sbjct  74   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFA  116



>ref|XP_004141122.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Cucumis sativus]
 ref|XP_004158329.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Cucumis sativus]
 gb|KGN59723.1| hypothetical protein Csa_3G840980 [Cucumis sativus]
Length=573

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FG+SKHF 
Sbjct  75   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGYSKHFA  117



>ref|XP_002467812.1| hypothetical protein SORBIDRAFT_01g034520 [Sorghum bicolor]
 gb|EER94810.1| hypothetical protein SORBIDRAFT_01g034520 [Sorghum bicolor]
Length=592

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF 
Sbjct  94   AKHIRALLARRHGSVKPNEASIPEGGEPDLGLDKSFGYSRHFA  136



>ref|NP_001140858.1| uncharacterized LOC100272934 [Zea mays]
 gb|ACF84827.1| unknown [Zea mays]
 tpg|DAA45495.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=586

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF 
Sbjct  88   AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFA  130



>ref|XP_008667154.1| PREDICTED: uncharacterized LOC100272934 isoform X1 [Zea mays]
Length=658

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDKSFG+S+HF 
Sbjct  160  AKHIRALLARRHGSVKPNEASIPEGGELDLGLDKSFGYSRHFA  202



>emb|CDP06189.1| unnamed protein product [Coffea canephora]
Length=577

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG+E E GLD+SFGF+K+F
Sbjct  79   AKHIRALLARRHGSVKPNEATIPEGSECEIGLDRSFGFAKNF  120



>ref|XP_010673049.1| PREDICTED: CDPK-related kinase 7-like [Beta vulgaris subsp. vulgaris]
Length=578

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E + GLDK+FGFSK F 
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECDIGLDKNFGFSKQFA  121



>ref|XP_006402951.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
 gb|ESQ44404.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
Length=576

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGS+KPN A+IPEG+E + GLDK FGFSK F 
Sbjct  78   AKHIRALLARRHGSIKPNEASIPEGSECDVGLDKKFGFSKQFA  120



>ref|XP_002322616.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEF04377.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=578

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG+ES+  LDK+FGFSK F
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGSESDIALDKNFGFSKQF  121



>ref|XP_002879911.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56170.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GSVKPN  +IPEG E E GLDKSFGFSK F 
Sbjct  79   AKHIRAFLARRYGSVKPNAVSIPEGKECEIGLDKSFGFSKQFA  121



>ref|XP_002878106.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54365.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHG VKPN A+IPEG+E E GLDK FGFSK F 
Sbjct  79   AKHIRALLARRHGFVKPNEASIPEGSECEVGLDKKFGFSKQFA  121



>ref|XP_002282577.1| PREDICTED: CDPK-related kinase 1 [Vitis vinifera]
Length=575

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG E E GLDK+FGFSK F
Sbjct  78   AKHIRALLARRHGSVKPNEATIPEGNECEVGLDKNFGFSKQF  119



>emb|CBI32784.3| unnamed protein product [Vitis vinifera]
Length=593

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A IPEG E E GLDK+FGFSK F
Sbjct  96   AKHIRALLARRHGSVKPNEATIPEGNECEVGLDKNFGFSKQF  137



>ref|XP_010028268.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
 gb|KCW54983.1| hypothetical protein EUGRSUZ_I00953 [Eucalyptus grandis]
Length=621

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 100/166 (60%), Gaps = 16/166 (10%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGI------PVPVKDNPDNGENQGGENQQRNIKKGE  315
            MG+CTSKP+    D  +     R + +      P   + NPD+G   GG+   R  K+  
Sbjct  1    MGLCTSKPT-SQLDLSSPAPGQRGIAVANGGAGPAEERRNPDSGSVNGGDPGNRVPKEEA  59

Query  316  VEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrrpfppp----spAK  483
               GRKSPFFPFYSPSPAHY F+KKSPA       ++N++     +R F  P    SPAK
Sbjct  60   GGDGRKSPFFPFYSPSPAHYFFSKKSPAGRSPANGNANASANSTPKRFFKRPFPPPSPAK  119

Query  484  HIRAVLARRHGSVKPNGAAIPEGAESEG-----GLDKSFGFSKHFG  606
            HI+A LA R G+VK N AAIPEG+E+EG     GLDKSFGFSK+FG
Sbjct  120  HIKAALALRRGTVKQNEAAIPEGSEAEGEGRVTGLDKSFGFSKNFG  165



>gb|KHG24093.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Gossypium arboreum]
Length=576

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+++LARRHGS+KPN A+IPEG E E GL+KSFGFSKHF
Sbjct  78   AKHIKSLLARRHGSIKPNEASIPEGNECEVGLNKSFGFSKHF  119



>ref|XP_011027259.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Populus euphratica]
Length=562

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E++ GLDK+FGFSK F
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNETDIGLDKNFGFSKQF  121



>ref|XP_010909914.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Elaeis guineensis]
Length=601

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGF K F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFLKQF  120



>ref|XP_010909915.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Elaeis guineensis]
Length=577

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDKSFGF K F
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKSFGFLKQF  120



>ref|XP_011000411.1| PREDICTED: CDPK-related kinase 7-like [Populus euphratica]
Length=578

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E++ GLDK+FGFSK F
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNETDIGLDKNFGFSKQF  121



>ref|XP_008240668.1| PREDICTED: CDPK-related kinase 7 [Prunus mume]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG+E +  LDK+FGFSK F
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGSECDVALDKNFGFSKQF  120



>ref|NP_181647.1| CDPK-related kinase 1 [Arabidopsis thaliana]
 sp|O80673.1|CAMK1_ARATH RecName: Full=CDPK-related kinase 1; Short=AtCRK1; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 3; AltName: 
Full=Calmodulin-binding protein kinase 3; Short=AtCBK3; Short=CaM-binding 
protein kinase 3 [Arabidopsis thaliana]
 gb|AAD38058.1|AF153351_1 CDPK-related kinase 1 [Arabidopsis thaliana]
 gb|AAL30816.1|AF435448_1 calcium/calmodulin-dependent protein kinase CaMK3 [Arabidopsis 
thaliana]
 gb|AAD12016.1| CPDK-related protein kinase [Arabidopsis thaliana]
 gb|AEC09936.1| CDPK-related kinase 1 [Arabidopsis thaliana]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GSVKPN  +IPEG E E GLDKSFGFSK F 
Sbjct  78   AKHIRAFLARRYGSVKPNEVSIPEGKECEIGLDKSFGFSKQFA  120



>ref|XP_006482068.1| PREDICTED: CDPK-related kinase 7-like [Citrus sinensis]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQF  119



>ref|XP_006411380.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
 gb|ESQ52833.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR GS KPN A+IPEG E E GLDKSFGFSKHF 
Sbjct  78   AKHIRAFLARRSGSTKPNEASIPEGKEFEIGLDKSFGFSKHFA  120



>ref|XP_006430539.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43779.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=576

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIR++LARRHGSVKPN A+IPEG ES+ GLDK+FGFSK F
Sbjct  78   AKHIRSLLARRHGSVKPNEASIPEGNESDIGLDKNFGFSKQF  119



>ref|XP_006346445.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=588

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHFG  606
            AKHI+A+L RRHGSVKPN AAIPEG E+EG  LDKSFGFSK F 
Sbjct  88   AKHIKALLLRRHGSVKPNAAAIPEGEETEGANLDKSFGFSKQFA  131



>ref|XP_002308892.2| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEE92415.2| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=562

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG E + GLDK+FGFSK F 
Sbjct  80   AKHIRALLARRHGSVKPNEASIPEGNEIDIGLDKNFGFSKQFA  122



>ref|XP_010228587.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1 isoform X1 [Brachypodium distachyon]
Length=597

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E    LDKSFGFS+H  
Sbjct  94   AKHIRALLARRHGSVKPNAASIPEGSEPGVALDKSFGFSRHLS  136



>ref|XP_010922072.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Elaeis guineensis]
Length=576

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGS KPN A IPEG E+E GLDKSFGFSK F
Sbjct  78   AKHIKALLARRHGSAKPNEATIPEGNEAELGLDKSFGFSKQF  119



>ref|XP_010508754.1| PREDICTED: CDPK-related kinase 1-like [Camelina sativa]
Length=577

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS+KPN  +IPEG E E GLDKSFGFSK F 
Sbjct  79   AKHIRAFLARRYGSIKPNEVSIPEGKECEIGLDKSFGFSKQFA  121



>ref|XP_003516596.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=585

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHI+A LARRHGSVKPN AAIPE AE+  GLDK+FGFSKHFG
Sbjct  89   AKHIKAALARRHGSVKPNEAAIPE-AEAVAGLDKNFGFSKHFG  130



>ref|XP_003557839.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1 isoform X2 [Brachypodium distachyon]
Length=592

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPEG+E    LDKSFGFS+H  
Sbjct  94   AKHIRALLARRHGSVKPNAASIPEGSEPGVALDKSFGFSRHLS  136



>ref|XP_009801386.1| PREDICTED: CDPK-related kinase 5-like [Nicotiana sylvestris]
Length=590

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHF  603
            AKHI+A+L RRHGSVKPN AAIPEG E+EG  LDKSFGFSK F
Sbjct  90   AKHIKALLLRRHGSVKPNAAAIPEGEETEGANLDKSFGFSKQF  132



>ref|XP_009618516.1| PREDICTED: CDPK-related kinase 7-like [Nicotiana tomentosiformis]
Length=577

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK+FG+SK+F
Sbjct  79   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKNFGYSKNF  120



>ref|XP_009420969.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=576

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDK+FGFSK  
Sbjct  78   AKHIKALLARRHGSVKPNEASIPEGSEVEVGLDKNFGFSKQL  119



>ref|XP_009761409.1| PREDICTED: CDPK-related kinase 1-like [Nicotiana sylvestris]
Length=577

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK+FG+SK+F
Sbjct  79   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKNFGYSKNF  120



>gb|KFK34914.1| hypothetical protein AALP_AA5G210000 [Arabis alpina]
Length=582

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA LARR+GSVKPN A+IPEG+E + GLDK FGFSK F
Sbjct  84   AKHIRAFLARRYGSVKPNEASIPEGSECDVGLDKKFGFSKQF  125



>ref|XP_007156824.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
 gb|ESW28818.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
Length=589

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGSVKPN AAIPE AE+  GLDK+FGFSKH G
Sbjct  93   AKHIRAALARRHGSVKPNEAAIPE-AEAVAGLDKNFGFSKHLG  134



>ref|XP_006293901.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
 gb|EOA26799.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
Length=576

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS+KPN A+IPEG E E GLDK FGFSK F 
Sbjct  78   AKHIRAFLARRYGSIKPNEASIPEGKECEIGLDKRFGFSKQFA  120



>ref|XP_006362272.1| PREDICTED: CDPK-related kinase 1-like [Solanum tuberosum]
Length=574

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK FG+SK+F
Sbjct  76   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKIFGYSKNF  117



>ref|XP_010525467.1| PREDICTED: CDPK-related kinase 1-like [Tarenaya hassleriana]
Length=573

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHFG  606
            AKHIRA+LARRHGS++PN A+IPEG+E E  GLDK+FGFSK FG
Sbjct  74   AKHIRALLARRHGSIRPNEASIPEGSECEEIGLDKNFGFSKQFG  117



>ref|XP_004249131.1| PREDICTED: CDPK-related kinase 1 [Solanum lycopersicum]
Length=574

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGS+KPN A IPEG+E + GLDK FG+SK+F
Sbjct  76   AKHIRALLARRHGSIKPNEATIPEGSECDIGLDKIFGYSKNF  117



>ref|XP_009405856.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=573

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GL+K+FGFSK F
Sbjct  75   AKHIKALLARRHGSVKPNEASIPEGSEVELGLNKNFGFSKQF  116



>ref|NP_001146101.1| uncharacterized LOC100279633 [Zea mays]
 gb|ACL53229.1| unknown [Zea mays]
 gb|AFW88296.1| putative protein kinase superfamily protein [Zea mays]
Length=595

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+I EG E + GLDKSFG+S+HF 
Sbjct  91   AKHIRALLARRHGSVKPNEASISEGGEPDLGLDKSFGYSRHFA  133



>ref|XP_008658484.1| PREDICTED: uncharacterized LOC100279633 isoform X1 [Zea mays]
Length=598

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+I EG E + GLDKSFG+S+HF 
Sbjct  91   AKHIRALLARRHGSVKPNEASISEGGEPDLGLDKSFGYSRHFA  133



>ref|XP_010517599.1| PREDICTED: CDPK-related kinase 1 isoform X1 [Camelina sativa]
 ref|XP_010517600.1| PREDICTED: CDPK-related kinase 1 isoform X2 [Camelina sativa]
Length=571

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKH+RA LARR+GS+KPN  +IPEG E E GLDKSFGFSK F 
Sbjct  73   AKHLRAFLARRYGSIKPNEVSIPEGKECEIGLDKSFGFSKQFA  115



>ref|XP_007145486.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
 gb|ESW17480.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
Length=577

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARR GSVKPN A+IPEG+E E GLDK FGF+K+F 
Sbjct  78   AKHIRALLARRQGSVKPNEASIPEGSECEIGLDKRFGFAKNFS  120



>ref|XP_004230803.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=588

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHF  603
            AKHI+A+L RRHGSVKPN A+IPEG E+EG  LDKSFGFSK F
Sbjct  88   AKHIKALLLRRHGSVKPNAASIPEGEETEGANLDKSFGFSKQF  130



>gb|KDP27484.1| hypothetical protein JCGZ_20019 [Jatropha curcas]
Length=577

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN A+IPEG E +  LDK+FGFSK F
Sbjct  79   AKHIRALLARRHGSVKPNEASIPEGNECDIALDKNFGFSKQF  120



>ref|XP_008440252.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Cucumis melo]
Length=605

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEG-AESEGGLDKSFGFSKHF  603
            AKHI AVLARRHGSVKPN A+IPEG    E GLDKSFGFSKHF
Sbjct  105  AKHIMAVLARRHGSVKPNEASIPEGNVIEEPGLDKSFGFSKHF  147



>ref|XP_008440253.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Cucumis melo]
Length=604

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEG-AESEGGLDKSFGFSKHF  603
            AKHI AVLARRHGSVKPN A+IPEG    E GLDKSFGFSKHF
Sbjct  105  AKHIMAVLARRHGSVKPNEASIPEGNVIEEPGLDKSFGFSKHF  147



>ref|XP_003629589.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
Length=607

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAA-IPEGAESE--GGLDKSFGFSKHFG  606
            AKHIR++LARRHGSVKPNGAA I EG+E E    LDK+FGFSKHFG
Sbjct  77   AKHIRSLLARRHGSVKPNGAASISEGSEGESVAPLDKNFGFSKHFG  122



>ref|XP_007047191.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX91348.1| CDPK-related kinase [Theobroma cacao]
Length=630

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 96/179 (54%), Gaps = 34/179 (19%)
 Frame = +1

Query  154  MGVCTSKPSLE-----HRDWRNDQQTDRNVGI-----PVPVKDNPD--NG-------ENQ  276
            MG+CTSKPS         D RN     RN  I      +P    PD  NG       E+Q
Sbjct  1    MGLCTSKPSPNPSFPPKSDSRNTPIHPRNNDIHRKSNSIPASPLPDAVNGNQNRNPTEDQ  60

Query  277  GGENQQRNIKKGEVEGGRKspffpfyspspAHYLFakksparspanapssnstprrffrr  456
            G +++++       EG +KSPFFPFYSPSPA YLF+KKSPARS A +       R F   
Sbjct  61   GKDDEEKGNSNSNNEG-KKSPFFPFYSPSPASYLFSKKSPARSSATSTPKRFFRRPFPPP  119

Query  457  pfpppspAKHIRAVLARRHGSVKPNGAAIP---------EGAESEGGLDKSFGFSKHFG  606
                   AKHIRAVLARRHGSVKPN AAIP                GLDKSFGFSKHFG
Sbjct  120  SP-----AKHIRAVLARRHGSVKPNEAAIPEGSEAEAAAAAGAGGTGLDKSFGFSKHFG  173



>ref|XP_009404698.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=575

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A IPEG+E E GLDK+FGFSK  
Sbjct  78   AKHIKALLARRHGSVKPNEAPIPEGSEVEVGLDKNFGFSKQL  119



>gb|EPS59727.1| hypothetical protein M569_15078, partial [Genlisea aurea]
Length=568

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLDKSFGFSKHF  603
            AKHI+A+LARRHGS+KPNGA+IPEG+E E  GLDK+FGF K+F
Sbjct  78   AKHIKALLARRHGSIKPNGASIPEGSECEVIGLDKNFGFCKNF  120



>ref|XP_009611550.1| PREDICTED: CDPK-related kinase 5 [Nicotiana tomentosiformis]
Length=602

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 94/157 (60%), Gaps = 18/157 (11%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTSKPS    ++  D  T       +PVK  P+N ++          KK E   G+K
Sbjct  1    MGACTSKPS----NFSGDNITVAGDVATLPVKSGPNNEDDVNSHQT----KKDEPNVGKK  52

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHYLF+KKSPA + ++  +     +R F  P P    AKHIR++LARRH
Sbjct  53   SPFFPFYSPSPAHYLFSKKSPATNASSNSTPMRFFKRPFPPPSP----AKHIRSLLARRH  108

Query  514  GSVKPNGAAIP------EGAESEGGLDKSFGFSKHFG  606
            G+VKPN +AIP       G     GLDKSFGFSK+FG
Sbjct  109  GTVKPNESAIPEGSESEVGGGGGAGLDKSFGFSKNFG  145



>emb|CDY47375.1| BnaC04g24880D [Brassica napus]
Length=574

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS  KP+ A+IPEG+E E GLDK+FGFSK FG
Sbjct  75   AKHIRAFLARRHGSSTKPDQASIPEGSECEVGLDKAFGFSKQFG  118



>emb|CDY22505.1| BnaC03g23150D [Brassica napus]
Length=568

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS  KPNG  IPEG E E GLDKSFGFSKHF 
Sbjct  69   AKHIRAFLARRNGSTNKPNGVTIPEGKEFEIGLDKSFGFSKHFA  112



>ref|XP_009139075.1| PREDICTED: CDPK-related kinase 7-like [Brassica rapa]
Length=575

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS  KP+ A+IPEG+E E GLDK+FGFSK FG
Sbjct  76   AKHIRAFLARRHGSSAKPDRASIPEGSECEVGLDKAFGFSKQFG  119



>ref|XP_009393900.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=577

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A+IPEG+E E GLDK+FGF K  
Sbjct  79   AKHIKALLARRHGSVKPNEASIPEGSEVELGLDKNFGFLKQI  120



>emb|CDP18369.1| unnamed protein product [Coffea canephora]
Length=140

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 75/153 (49%), Gaps = 41/153 (27%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+CTSKPS E    ++ +Q       P+P KD          +N    +K         
Sbjct  1    MGICTSKPSPEPNLHQDSKQN------PIPTKD----------KNNPAQVK---------  35

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
                       AHYL  KKSPARS  N+ S     R F          AKH +AVLA+RH
Sbjct  36   ---------DKAHYLICKKSPARSSVNSTSKRFFKRPFPPPSP-----AKHNKAVLAKRH  81

Query  514  GSVKPNGAAIPEGAESE--GGLDKSFGFSKHFG  606
            G VKPN A+I EG ESE    LDK+FGFSKHFG
Sbjct  82   GFVKPNEASISEGNESEMVAALDKNFGFSKHFG  114



>gb|EYU20808.1| hypothetical protein MIMGU_mgv1a003516mg [Erythranthe guttata]
Length=580

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F
Sbjct  81   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNF  123



>ref|XP_009409499.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 4/46 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG----GLDKSFGFSKHF  603
            AKHIRA+LARRHGSVKPN AAIPE    EG    GLDKSFGFSK F
Sbjct  101  AKHIRALLARRHGSVKPNEAAIPEDEGEEGRAVAGLDKSFGFSKGF  146



>ref|XP_011079071.1| PREDICTED: CDPK-related kinase 1-like [Sesamum indicum]
Length=579

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F
Sbjct  80   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNF  122



>ref|XP_011075448.1| PREDICTED: CDPK-related kinase 1 [Sesamum indicum]
Length=579

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHF  603
            AKHI+A+LARRHGSVKPN A IPEG+E E  GLDK+FGFSK+F
Sbjct  80   AKHIKALLARRHGSVKPNEATIPEGSECEIIGLDKNFGFSKNF  122



>gb|EEC75325.1| hypothetical protein OsI_11701 [Oryza sativa Indica Group]
Length=596

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF 
Sbjct  98   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFA  140



>gb|AAK54157.1|AF368282_1 CaMK1 [Oryza sativa]
Length=597

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF 
Sbjct  99   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFA  141



>ref|NP_001050179.1| Os03g0366200 [Oryza sativa Japonica Group]
 dbj|BAF12093.1| Os03g0366200 [Oryza sativa Japonica Group]
Length=597

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF 
Sbjct  99   AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFA  141



>sp|Q10KY3.1|CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent serine/threonine-protein 
kinase 1; AltName: Full=Calcium/calmodulin-binding serine/threonine-protein 
kinase; Short=CaM-binding protein kinase; 
AltName: Full=OsCBK [Oryza sativa Japonica Group]
 gb|ABF96128.1| CDPK-related protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
Length=600

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVKPN A+IPE  E    LDK FGFS+HF 
Sbjct  102  AKHIRALLARRHGSVKPNEASIPESGEPGVALDKGFGFSRHFA  144



>sp|P53681.1|CRK_DAUCA RecName: Full=CDPK-related protein kinase; AltName: Full=PK421 
[Daucus carota]
 emb|CAA58750.1| CDPK-related protein kinase [Daucus carota]
Length=602

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 94/153 (61%), Gaps = 10/153 (7%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG+C SKPS E  D  N   +       +P +DN    ++     Q  N        G+K
Sbjct  1    MGICVSKPSPE-PDLHNHHTSIPVNDTSLPPQDNSIPPKDIAIPAQDNN-----KPPGKK  54

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPF PFYSPSPAH+LF+KKSPA     A SSNSTP+R F  P P P  AKHI+A  ARRH
Sbjct  55   SPFLPFYSPSPAHFLFSKKSPAVGSPAAGSSNSTPKRLFPFPPPSP--AKHIKAAWARRH  112

Query  514  GSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            GSVKPN AAIPE  E +G  GLDKSFGFSK FG
Sbjct  113  GSVKPNEAAIPENNEVDGGAGLDKSFGFSKKFG  145



>gb|KCW47909.1| hypothetical protein EUGRSUZ_K01647 [Eucalyptus grandis]
Length=437

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A LA+R+G+VKPN  AIPEG E E GLDK+FGFSK F
Sbjct  102  AKHIKAFLAKRYGAVKPNEVAIPEGGECEIGLDKNFGFSKQF  143



>gb|AET04065.2| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=581

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAA-IPEGAESE--GGLDKSFGFSKHFG  606
            AKHIR++LARRHGSVKPNGAA I EG+E E    LDK+FGFSKHFG
Sbjct  77   AKHIRSLLARRHGSVKPNGAASISEGSEGESVAPLDKNFGFSKHFG  122



>ref|XP_004509161.1| PREDICTED: CDPK-related protein kinase-like [Cicer arietinum]
Length=582

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPN-GAAIPEGAESE--GGLDKSFGFSKHFG  606
            AKHIR++LARRHGSVKPN GA+I EG+E+E    LDK+FGFSKHFG
Sbjct  78   AKHIRSLLARRHGSVKPNIGASISEGSEAETVAPLDKNFGFSKHFG  123



>ref|XP_010036359.1| PREDICTED: CDPK-related kinase 1-like [Eucalyptus grandis]
 gb|KCW47910.1| hypothetical protein EUGRSUZ_K01647 [Eucalyptus grandis]
Length=600

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A LA+R+G+VKPN  AIPEG E E GLDK+FGFSK F
Sbjct  102  AKHIKAFLAKRYGAVKPNEVAIPEGGECEIGLDKNFGFSKQF  143



>emb|CDX76010.1| BnaA04g02740D [Brassica napus]
Length=570

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGS-VKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS  KP+ A+IPEG+E E  LDK+FGFSK FG
Sbjct  71   AKHIRAFLARRHGSSAKPDRASIPEGSECEARLDKAFGFSKQFG  114



>emb|CDY35427.1| BnaA03g19330D [Brassica napus]
Length=567

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS  KPN  +IPEG E E GLDKSFGFSKHF 
Sbjct  68   AKHIRAFLARRNGSTNKPNEVSIPEGKEFEIGLDKSFGFSKHFA  111



>ref|XP_009133469.1| PREDICTED: CDPK-related kinase 1 [Brassica rapa]
Length=567

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSV-KPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS  KPN  +IPEG E E GLDKSFGFSKHF 
Sbjct  68   AKHIRAFLARRNGSTNKPNEVSIPEGKEFEIGLDKSFGFSKHFA  111



>gb|KFK36961.1| hypothetical protein AALP_AA4G195100 [Arabis alpina]
Length=579

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARR+GS K N  +IPEG E E GLDKSFGFSK FG
Sbjct  81   AKHIRAFLARRNGSNKRNEVSIPEGKECEIGLDKSFGFSKQFG  123



>emb|CDX79956.1| BnaA05g02000D [Brassica napus]
Length=577

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVK--PNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF 
Sbjct  77   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFA  121



>gb|EPS58889.1| hypothetical protein M569_15923, partial [Genlisea aurea]
Length=251

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE--GGLDKSFGFSKHF  603
            AKHI +VLARRHG+VKPN AAIPE  E      LDKSFGFSK F
Sbjct  46   AKHIMSVLARRHGTVKPNEAAIPEAKEVSEAASLDKSFGFSKKF  89



>emb|CDY23873.1| BnaC04g01640D [Brassica napus]
Length=578

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVK--PNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF 
Sbjct  78   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFA  122



>ref|XP_009142724.1| PREDICTED: CDPK-related kinase 1-like [Brassica rapa]
Length=577

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVK--PNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA LARRHGS    P+  +IPEG E E GLDKSFGFSKHF 
Sbjct  77   AKHIRAFLARRHGSSAKPPSEVSIPEGEEFEIGLDKSFGFSKHFA  121



>ref|XP_010680435.1| PREDICTED: CDPK-related kinase 5 [Beta vulgaris subsp. vulgaris]
Length=598

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 7/50 (14%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGA-AIPEGAESEG------GLDKSFGFSKHFG  606
            AKHI+AVLARR G+VKPN A +IPEG+ES        GLDK FGFSKHFG
Sbjct  92   AKHIKAVLARRQGTVKPNVAGSIPEGSESSSGGVNGVGLDKRFGFSKHFG  141



>ref|XP_006360222.1| PREDICTED: CDPK-related protein kinase-like [Solanum tuberosum]
Length=590

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTSKPS E     ND        IP    +  ++ EN+  E           E G+K
Sbjct  1    MGGCTSKPSPEPNYSNNDLYAPDGTAIPAKANNEDNSLENKSKEG---------AEVGKK  51

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KKSPA S          P             AKHIRAVLARRH
Sbjct  52   SPFFPFYSPSPAHYFFSKKSPANSTPRRFFKRPFPPPSP---------AKHIRAVLARRH  102

Query  514  GSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            GSVKPN        E  GGLDKSFGFSK+FG
Sbjct  103  GSVKPNAIPEGNELEGGGGLDKSFGFSKNFG  133



>ref|XP_006404024.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
 gb|ESQ45477.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
Length=614

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG  570
            AKHIRAVLARRHGSVKPN AAIPEG+E+EGG
Sbjct  113  AKHIRAVLARRHGSVKPNSAAIPEGSEAEGG  143



>ref|XP_010916660.1| PREDICTED: CDPK-related kinase 5 [Elaeis guineensis]
Length=609

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIP----EGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARRHGSVKPN  AIP    E   +  GLDK+FGF K F
Sbjct  106  AKHIRAVLARRHGSVKPNETAIPEEDGEAGRAVAGLDKNFGFEKGF  151



>ref|XP_007155949.1| hypothetical protein PHAVU_003G2460000g, partial [Phaseolus vulgaris]
 gb|ESW27943.1| hypothetical protein PHAVU_003G2460000g, partial [Phaseolus vulgaris]
Length=474

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARRHGSVKPN A IPE  +    LDK+FGFSK F
Sbjct  79   AKHIRAVLARRHGSVKPNEATIPE--DEVVALDKNFGFSKQF  118



>ref|XP_008795162.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related kinase 5-like [Phoenix 
dactylifera]
Length=609

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG----GLDKSFGFSKHF  603
            AKHIRAVLARRHGSVKPN  AIPE     G    GLDK+FGF K F
Sbjct  106  AKHIRAVLARRHGSVKPNETAIPEEDGEAGRAVTGLDKNFGFEKGF  151



>ref|XP_010426596.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=607

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 81/158 (51%), Positives = 96/158 (61%), Gaps = 14/158 (9%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGE--NQQRNIKKGEVEGG  327
            MG+CTSKP+  +    +DQ   RN  +P      P +    GG     Q  +   E   G
Sbjct  1    MGLCTSKPNSPN----SDQTPARNSPLPASESVKPSSSSVNGGNPVEDQSVVPSNE---G  53

Query  328  RKspffpfyspspAHYLFakksparspanapssnstprrffrrpf-pppspAKHIRAVLA  504
            +KSPFFPFYSPSPAH  F+KK+PARSPA   SS ++  + F +   PPPSPAKHIRAVLA
Sbjct  54   KKSPFFPFYSPSPAHSFFSKKTPARSPATNASSGNSTPKRFFKRPFPPPSPAKHIRAVLA  113

Query  505  RRHGSVKPNGAAIP----EGAESEGGLDKSFGFSKHFG  606
            RRHGSVKPN +AIP           GLDKSFGFSK F 
Sbjct  114  RRHGSVKPNSSAIPEGSEAEGGGGVGLDKSFGFSKSFA  151



>gb|KHN47935.1| CDPK-related protein kinase [Glycine soja]
Length=579

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARRHGSVKPN A IPE  +    LDK+FGFSK F
Sbjct  83   AKHIRAVLARRHGSVKPNEATIPE--DEVVTLDKNFGFSKQF  122



>ref|XP_003525704.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Glycine max]
Length=578

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARRHGSVKPN A IPE  +    LDK+FGFSK F
Sbjct  82   AKHIRAVLARRHGSVKPNEATIPE--DEVVTLDKNFGFSKQF  121



>emb|CDY65016.1| BnaCnng45690D [Brassica napus]
Length=594

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (3%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG-GLD  576
            AKHIRAVLARRHGSVKPN AAIPEG+E+EG GLD
Sbjct  95   AKHIRAVLARRHGSVKPNSAAIPEGSEAEGVGLD  128



>gb|EPS69494.1| hypothetical protein M569_05270 [Genlisea aurea]
Length=657

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESE-GGLDKSFGFSKHF  603
            AKHI+AVLARRHGSVKPN +++P+  + +  GLDKSFGF+K+F
Sbjct  97   AKHIKAVLARRHGSVKPNESSLPDNNKLDAAGLDKSFGFAKNF  139



>ref|XP_004233433.1| PREDICTED: CDPK-related kinase 5-like [Solanum lycopersicum]
Length=591

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 86/150 (57%), Gaps = 17/150 (11%)
 Frame = +1

Query  154  MGVCTSKPSLEHRDWRNDQQTDRNVGIPVPVKDNPDNGENQGGENQQRNIKKGEVEGGRK  333
            MG CTSKPS E     ND       G  +P KDN          N + +  K   E G+K
Sbjct  1    MGGCTSKPSPEPNYSNNDLYAPD--GTAIPAKDN----------NSEDSKSKEGAEVGKK  48

Query  334  spffpfyspspAHYLFakksparspanapssnstprrffrrpfpppspAKHIRAVLARRH  513
            SPFFPFYSPSPAHY F+KKSPARSP+N+       R F          AKHIRAVLARRH
Sbjct  49   SPFFPFYSPSPAHYFFSKKSPARSPSNSTPRRFFKRPFPPPSP-----AKHIRAVLARRH  103

Query  514  GSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            GSVKPN        E  GGLDKSFGFSK+F
Sbjct  104  GSVKPNAIPEGNELEGGGGLDKSFGFSKNF  133



>ref|XP_009389551.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIP----EGAESEGGLDKSFGFSKHFG  606
            AKHIRAVLARR GSVKPN AAIP    E   +  GLDK+FGFSK F 
Sbjct  101  AKHIRAVLARRLGSVKPNEAAIPADDREERRAASGLDKNFGFSKGFA  147



>ref|XP_008669867.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Zea mays]
Length=246

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 4/43 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LARRHGSVK    +I EG E + GLDKSFG+S+HF 
Sbjct  91   AKHIRALLARRHGSVK----SISEGGEPDLGLDKSFGYSRHFA  129



>ref|XP_010911684.1| PREDICTED: CDPK-related kinase 5-like, partial [Elaeis guineensis]
Length=194

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIP----EGAESEGGLDKSFGFSKHFG  606
            AKHIRAVLARRHGSVKPN A IP    EG  S  GLDK+F F K F 
Sbjct  107  AKHIRAVLARRHGSVKPNEAVIPEEEGEGGRSVAGLDKNFRFEKGFA  153



>gb|EMT32885.1| hypothetical protein F775_33150 [Aegilops tauschii]
Length=127

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  481  KHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            KHIRA++ R HG  KPN A+IPEG E + G+DK F F KHF
Sbjct  24   KHIRALMGRGHGPAKPNEASIPEGGEPKLGMDKGFSFCKHF  64



>ref|XP_008654062.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Zea mays]
Length=215

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 4/43 (9%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKHIRA+LAR HGSVK    +I EG E + GLDKSFG+S+HF 
Sbjct  91   AKHIRALLARSHGSVK----SISEGGEPDLGLDKSFGYSRHFA  129



>ref|XP_003611786.1| CDPK-related protein kinase [Medicago truncatula]
 gb|AES94744.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=587

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 5/45 (11%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEG--GLDKSFGFSKHFG  606
            AKHIR++LARR GSV+    +IPEG E E    LDK+FGFSKHFG
Sbjct  90   AKHIRSLLARRRGSVE---VSIPEGGEEETVVALDKNFGFSKHFG  131



>ref|XP_002973513.1| CDK related protein kinase 5 [Selaginella moellendorffii]
 gb|EFJ25173.1| CDK related protein kinase 5 [Selaginella moellendorffii]
Length=579

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A LA+RHG+ KP   +IPEG++ E  LDK+FG+ K+F
Sbjct  83   AKHIQAALAKRHGTAKPKEGSIPEGSDVEKPLDKNFGYGKNF  124



>gb|EPS59805.1| hypothetical protein M569_15001, partial [Genlisea aurea]
Length=195

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGG-LDKSFGFSKHF  603
            AKHI+A LARRHGSVKPN AA     ++EG  LDK FGF+K+F
Sbjct  67   AKHIKAALARRHGSVKPNEAAGESKNQAEGANLDKRFGFAKNF  109



>emb|CDY27114.1| BnaA08g07520D [Brassica napus]
Length=86

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 6/48 (13%)
 Frame = +1

Query  481  KHIRAVLARRHGSVKPNGAAIPEGAESEGG---LDKSFG--FSK-HFG  606
            KHIR+ L+RRHG VK N A IPE +++EGG   LD SFG  F + HFG
Sbjct  20   KHIRSALSRRHGFVKQNSAMIPEYSKAEGGGVVLDTSFGDEFGRDHFG  67



>ref|XP_002975545.1| CDPK-related protein kinase 3 [Selaginella moellendorffii]
 gb|EFJ23174.1| CDPK-related protein kinase 3 [Selaginella moellendorffii]
Length=579

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHF  603
            AKHI+A LA+RHG+ KP   +IPEG++ E  LDK+F + K+F
Sbjct  83   AKHIQAALAKRHGTAKPKEGSIPEGSDVEKPLDKNFVYGKNF  124



>ref|XP_003608023.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
 gb|AES90220.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=592

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 30/44 (68%), Gaps = 3/44 (7%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFG  606
            AKHIRAVLARR G  K   AAIPE G E  G LDK FGFSK F 
Sbjct  93   AKHIRAVLARRQG--KKEAAAIPEEGEEGAGDLDKRFGFSKDFA  134



>ref|XP_003528501.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIP-EGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARR G      AAIP EG E    LDK FGFSK F
Sbjct  98   AKHIRAVLARRQGKKASATAAIPEEGEEGAADLDKRFGFSKEF  140



>ref|XP_003520170.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIP-EGAESEGGLDKSFGFSKHF  603
            AKHIRAVLARR G      AAIP EG E    LDK FGFSK F
Sbjct  98   AKHIRAVLARRQGKKASATAAIPEEGEEGAADLDKRFGFSKEF  140



>ref|XP_011088749.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=559

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPEGAESEGGLDKSFGFSKHFG  606
            AKH++AVL R H +VKP+  AI EG E E  LDKSFGFS  FG
Sbjct  60   AKHLKAVLLRTHAAVKPSAGAIKEGEEEEPELDKSFGFSNKFG  102



>gb|ABK25039.1| unknown [Picea sitchensis]
Length=589

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPE-GAESEGGLDKSFGFSKHFG  606
            AKHI+A LA+R G+ KP    IPE G E+E  LDKSFG+SK+F 
Sbjct  93   AKHIKASLAKRQGAPKPKDGPIPEDGVENERPLDKSFGYSKNFA  136



>ref|XP_004166903.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related protein kinase-like 
[Cucumis sativus]
Length=609

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFG  606
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFG  155



>ref|XP_004140506.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN46527.1| hypothetical protein Csa_6G106790 [Cucumis sativus]
Length=609

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFG  606
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFG  155



>ref|XP_008459758.1| PREDICTED: CDPK-related kinase 3 isoform X1 [Cucumis melo]
Length=609

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +1

Query  478  AKHIRAVLARRHGSVKPNGAAIPE--GAESEGGLDKSFGFSKHFG  606
            AKHI+A LA+R G  KP    IPE  GAE E  LDKSFG+ K+FG
Sbjct  111  AKHIKASLAKRFGYTKPKEGPIPEERGAEPEQLLDKSFGYGKNFG  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800