BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031C22

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793877.1|  PREDICTED: cyclin-T1-3-like isoform X2             113   4e-26   Nicotiana sylvestris
ref|XP_009793875.1|  PREDICTED: cyclin-T1-3-like isoform X1             113   5e-26   Nicotiana sylvestris
ref|XP_004247372.1|  PREDICTED: cyclin-T1-3                             107   1e-23   Solanum lycopersicum
ref|XP_006359905.1|  PREDICTED: cyclin-T1-4-like isoform X2             100   1e-21   
ref|XP_006359904.1|  PREDICTED: cyclin-T1-4-like isoform X1             100   2e-21   Solanum tuberosum [potatoes]
ref|XP_009588223.1|  PREDICTED: cyclin-T1-3-like isoform X2           94.0    3e-19   Nicotiana tomentosiformis
ref|XP_009588222.1|  PREDICTED: cyclin-T1-3-like isoform X1           94.0    4e-19   Nicotiana tomentosiformis



>ref|XP_009793877.1| PREDICTED: cyclin-T1-3-like isoform X2 [Nicotiana sylvestris]
Length=357

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 88/143 (62%), Gaps = 8/143 (6%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG  R  +GRN  +  +++     YN   ++D   +H    +  +D
Sbjct  1    MALAQTYYSQGGPFRGDSRSFYGRNQISGTHSS----AYN---HYDTVVSHLFSSNGSHD  53

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y Y+ N VKPE EPS KRRKC +S W SS  Y Q  +AC +VP +QP+T  
Sbjct  54   LSRNFSEYSYGYD-NFVKPEAEPSLKRRKCSASGWESSDRYSQATNACKDVPSKQPNTCY  112

Query  564  NMHPRNQSAYDSVTSICNNNSSI  632
            N+  RN  AYD   S CNNNS+I
Sbjct  113  NVPLRNSRAYDDAYSACNNNSAI  135



>ref|XP_009793875.1| PREDICTED: cyclin-T1-3-like isoform X1 [Nicotiana sylvestris]
Length=399

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 88/143 (62%), Gaps = 8/143 (6%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG  R  +GRN  +  +++     YN   ++D   +H    +  +D
Sbjct  1    MALAQTYYSQGGPFRGDSRSFYGRNQISGTHSS----AYN---HYDTVVSHLFSSNGSHD  53

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y Y+ N VKPE EPS KRRKC +S W SS  Y Q  +AC +VP +QP+T  
Sbjct  54   LSRNFSEYSYGYD-NFVKPEAEPSLKRRKCSASGWESSDRYSQATNACKDVPSKQPNTCY  112

Query  564  NMHPRNQSAYDSVTSICNNNSSI  632
            N+  RN  AYD   S CNNNS+I
Sbjct  113  NVPLRNSRAYDDAYSACNNNSAI  135



>ref|XP_004247372.1| PREDICTED: cyclin-T1-3 [Solanum lycopersicum]
Length=397

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 84/142 (59%), Gaps = 7/142 (5%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY ++GGP RG  R  +GRN +     + A N YN         TH  + +  +D
Sbjct  1    MALAQTYFSQGGPFRGDSRSFYGRNQSRGMVHSSAYNNYNTVD------THFFNSNSSHD  54

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y Y+ N +KPE EPS+KRR+C +S W SS  Y Q  +ACN+VP ++ ST  
Sbjct  55   VGRNFSEYSYGYD-NLIKPEAEPSSKRRRCSTSGWESSGRYSQAPYACNDVPSKRQSTCY  113

Query  564  NMHPRNQSAYDSVTSICNNNSS  629
            N+  RN  AYD    + NNNS+
Sbjct  114  NVPLRNSRAYDDAYPVRNNNSA  135



>ref|XP_006359905.1| PREDICTED: cyclin-T1-4-like isoform X2 [Solanum tuberosum]
Length=358

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 78/131 (60%), Gaps = 7/131 (5%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG  R  +GRN +     + A N YN         TH  + +  +D
Sbjct  1    MALAQTYYSQGGPFRGDSRSFYGRNQSRGMVHSSAYNNYNTVD------THLFNSNSSHD  54

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y+Y+ N +KPE EPS+KRRKC +S W S+  Y Q  +AC +VP +Q  T  
Sbjct  55   VGRNFSEYSYSYD-NLIKPEAEPSSKRRKCSTSGWESTGRYSQAPNACKDVPSKQQRTCY  113

Query  564  NMHPRNQSAYD  596
            N+  RN  AYD
Sbjct  114  NVPLRNSRAYD  124



>ref|XP_006359904.1| PREDICTED: cyclin-T1-4-like isoform X1 [Solanum tuberosum]
Length=400

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 78/131 (60%), Gaps = 7/131 (5%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG  R  +GRN +     + A N YN         TH  + +  +D
Sbjct  1    MALAQTYYSQGGPFRGDSRSFYGRNQSRGMVHSSAYNNYNTVD------THLFNSNSSHD  54

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y+Y+ N +KPE EPS+KRRKC +S W S+  Y Q  +AC +VP +Q  T  
Sbjct  55   VGRNFSEYSYSYD-NLIKPEAEPSSKRRKCSTSGWESTGRYSQAPNACKDVPSKQQRTCY  113

Query  564  NMHPRNQSAYD  596
            N+  RN  AYD
Sbjct  114  NVPLRNSRAYD  124



>ref|XP_009588223.1| PREDICTED: cyclin-T1-3-like isoform X2 [Nicotiana tomentosiformis]
Length=362

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 79/131 (60%), Gaps = 9/131 (7%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG     +GR+  +  +++ A N YN      + F+  G     +D
Sbjct  1    MALAQTYYSQGGPFRGDSTSFYGRSQISGKHSS-AYNHYNTV--VSHLFSSNGS----HD  53

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y Y+ N VKPE  PS KRRKC +S W SS  Y Q  ++CN+VP +QPST  
Sbjct  54   LSRNFSEYSYGYD-NFVKPEAGPSLKRRKCSASGWASSGRYSQATNSCNDVPSKQPST-C  111

Query  564  NMHPRNQSAYD  596
            N+  RN  AYD
Sbjct  112  NVPLRNSRAYD  122



>ref|XP_009588222.1| PREDICTED: cyclin-T1-3-like isoform X1 [Nicotiana tomentosiformis]
Length=404

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 79/131 (60%), Gaps = 9/131 (7%)
 Frame = +3

Query  204  MAYSQTYHTKGGPLRGQYRFSHGRNHANNHNATLAPNTYNNTKYFDYSFTHQGDIDHPND  383
            MA +QTY+++GGP RG     +GR+  +  +++ A N YN      + F+  G     +D
Sbjct  1    MALAQTYYSQGGPFRGDSTSFYGRSQISGKHSS-AYNHYNTV--VSHLFSSNGS----HD  53

Query  384  IRKNFMEYGYNYNSNCVKPEVEPSAKRRKCLSSSWGSSASYHQQLHACNNVPPRQPSTHN  563
            + +NF EY Y Y+ N VKPE  PS KRRKC +S W SS  Y Q  ++CN+VP +QPST  
Sbjct  54   LSRNFSEYSYGYD-NFVKPEAGPSLKRRKCSASGWASSGRYSQATNSCNDVPSKQPST-C  111

Query  564  NMHPRNQSAYD  596
            N+  RN  AYD
Sbjct  112  NVPLRNSRAYD  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500