BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031C12

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN40426.1|  unknown                                                 361   8e-122   Picea sitchensis
emb|CBI29424.3|  unnamed protein product                                359   2e-121   Vitis vinifera
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     360   3e-121   
gb|AAN33000.1|  alpha-tubulin 4                                         358   5e-121   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          362   1e-120   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     362   2e-120   
gb|ACU18775.1|  unknown                                                 353   2e-120   Glycine max [soybeans]
emb|CBI19330.3|  unnamed protein product                                360   2e-120   Vitis vinifera
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    361   3e-120   
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   359   3e-120   Citrus sinensis [apfelsine]
emb|CBI25125.3|  unnamed protein product                                359   3e-120   Vitis vinifera
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     361   3e-120   
tpg|DAA51110.1|  TPA: alpha-tubulin                                     354   4e-120   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        362   4e-120   Brassica rapa
gb|AHJ80818.1|  Tua1                                                    355   4e-120   Eragrostis tef [tef]
emb|CDY25017.1|  BnaC02g39910D                                          360   5e-120   Brassica napus [oilseed rape]
emb|CBI22190.3|  unnamed protein product                                359   5e-120   Vitis vinifera
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    360   6e-120   Brassica rapa
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    360   7e-120   
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        361   8e-120   Tarenaya hassleriana [spider flower]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             360   9e-120   Populus trichocarpa [western balsam poplar]
gb|ABK92552.1|  unknown                                                 360   9e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   360   1e-119   Populus euphratica
gb|AGG37287.1|  alpha-tubulin 5                                         360   1e-119   Salix arbutifolia
ref|XP_002510010.1|  tubulin alpha chain, putative                      360   1e-119   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           360   1e-119   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         360   1e-119   Pseudotsuga menziesii var. menziesii
gb|ABE66388.1|  alpha-tubulin                                           351   1e-119   Striga asiatica [witchweed]
emb|CDY66630.1|  BnaCnng51680D                                          360   1e-119   Brassica napus [oilseed rape]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                360   1e-119   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                360   1e-119   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          360   1e-119   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                360   1e-119   Pyrus x bretschneideri [bai li]
gb|AID52921.1|  tubulin alpha chain                                     360   1e-119   Carthamus tinctorius
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             360   1e-119   Citrus clementina [clementine]
ref|XP_002522104.1|  tubulin alpha chain, putative                      360   1e-119   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              360   1e-119   Theobroma cacao [chocolate]
gb|AGG37285.1|  alpha-tubulin 3                                         360   1e-119   Salix arbutifolia
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         360   1e-119   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           360   1e-119   Betula pendula [white birch]
ref|NP_171974.1|  tubulin alpha-4 chain                                 360   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             360   1e-119   Capsella rubella
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     359   1e-119   
ref|XP_007042689.1|  Tubulin alpha-2 chain                              360   1e-119   Theobroma cacao [chocolate]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             360   1e-119   Prunus persica
ref|NP_849388.1|  tubulin alpha-6 chain                                 359   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             360   2e-119   Eutrema salsugineum [saltwater cress]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     360   2e-119   Eucalyptus grandis [rose gum]
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               350   2e-119   Erythranthe guttata [common monkey flower]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    358   2e-119   Gossypium raimondii
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                360   2e-119   Elaeis guineensis
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                360   2e-119   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG18997.1|  Tubulin alpha chain                                     360   2e-119   Gossypium arboreum [tree cotton]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   360   2e-119   Fragaria vesca subsp. vesca
gb|ABQ59634.1|  alpha-tubulin 5                                         360   2e-119   Populus tremuloides
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          360   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        359   2e-119   
gb|ABO47736.1|  alpha-tubulin                                           360   2e-119   Gossypium hirsutum [American cotton]
gb|AGG37283.1|  alpha-tubulin 1                                         359   2e-119   Salix arbutifolia
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     359   2e-119   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     359   2e-119   Pyrus x bretschneideri [bai li]
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          359   2e-119   
ref|WP_039310890.1|  hypothetical protein                               360   2e-119   
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    359   2e-119   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             359   2e-119   Citrus clementina [clementine]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              359   3e-119   Camelina sativa [gold-of-pleasure]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                359   3e-119   Populus euphratica
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     359   3e-119   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                359   3e-119   Cucumis sativus [cucumbers]
dbj|BAP59012.1|  alpha tubulin                                          359   3e-119   Taxus cuspidata [ichii]
gb|ABO47740.1|  alpha-tubulin                                           359   4e-119   Gossypium hirsutum [American cotton]
ref|XP_010093625.1|  Tubulin alpha chain                                359   4e-119   Morus notabilis
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         358   5e-119   Jatropha curcas
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        359   5e-119   
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                357   5e-119   Erythranthe guttata [common monkey flower]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              358   5e-119   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   358   6e-119   Vitis vinifera
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     358   6e-119   Nicotiana tomentosiformis
gb|AIX10966.1|  tubulin                                                 358   6e-119   Ornithogalum longebracteatum [sea-onion]
ref|XP_010104543.1|  Tubulin alpha chain                                358   6e-119   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     358   6e-119   Sesamum indicum [beniseed]
emb|CAD13176.1|  alpha-tubulin                                          358   6e-119   Nicotiana tabacum [American tobacco]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             358   6e-119   Selaginella moellendorffii
ref|XP_007047652.1|  Tubulin alpha-2 chain                              360   6e-119   
gb|ABB02631.1|  unknown                                                 358   7e-119   Solanum tuberosum [potatoes]
gb|ABK92520.1|  unknown                                                 358   7e-119   Populus trichocarpa [western balsam poplar]
gb|AAO73546.1|  alpha-tubulin                                           358   7e-119   Ceratopteris richardii
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 358   7e-119   Populus trichocarpa [western balsam poplar]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    358   7e-119   Gossypium hirsutum [American cotton]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    358   7e-119   
gb|ABO47739.1|  alpha-tubulin                                           358   8e-119   Gossypium hirsutum [American cotton]
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    358   8e-119   
gb|AAO23139.1|  alpha tubulin                                           358   8e-119   Populus tremuloides
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    358   8e-119   Gossypium hirsutum [American cotton]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     358   8e-119   Nelumbo nucifera [Indian lotus]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     358   8e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                358   8e-119   Solanum tuberosum [potatoes]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              358   8e-119   Solanum lycopersicum
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     358   8e-119   Nicotiana sylvestris
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                358   8e-119   Prunus dulcis [sweet almond]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     358   8e-119   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              357   8e-119   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              358   8e-119   Nicotiana tomentosiformis
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    358   8e-119   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        358   8e-119   Glycine max [soybeans]
gb|KHG20487.1|  Tubulin alpha chain                                     358   8e-119   Gossypium arboreum [tree cotton]
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   358   9e-119   Nicotiana tomentosiformis
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    358   9e-119   Arabis alpina [alpine rockcress]
gb|ABO47737.1|  alpha-tubulin                                           358   9e-119   Gossypium hirsutum [American cotton]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                358   9e-119   Nelumbo nucifera [Indian lotus]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    358   9e-119   Gossypium raimondii
ref|XP_001764722.1|  predicted protein                                  358   9e-119   
gb|AAX21196.1|  putative alpha-tubulin                                  349   1e-118   Solanum betaceum [tamarillo]
gb|ADW66593.1|  alpha tubulin                                           354   1e-118   Hirschfeldia incana [buchanweed]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    358   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                358   1e-118   Phoenix dactylifera
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              358   1e-118   Cucumis sativus [cucumbers]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             358   1e-118   Hordeum vulgare [barley]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              358   1e-118   Oryza brachyantha
dbj|BAC24800.1|  alpha tubulin                                          358   1e-118   Physcomitrella patens
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              358   1e-118   Populus euphratica
gb|ABQ59633.1|  alpha-tubulin 3                                         358   1e-118   Populus tremuloides
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    358   1e-118   Brassica rapa
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   358   1e-118   Brassica rapa
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     358   1e-118   Phoenix dactylifera
ref|NP_193232.1|  tubulin alpha-6 chain                                 358   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        358   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             357   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              357   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             357   1e-118   Prunus persica
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     357   1e-118   Vitis vinifera
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    357   1e-118   
ref|XP_010096739.1|  Tubulin alpha chain                                357   1e-118   
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        356   2e-118   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    356   2e-118   
gb|KHN01709.1|  Tubulin alpha chain                                     357   2e-118   Glycine soja [wild soybean]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    357   2e-118   Glycine max [soybeans]
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     357   2e-118   
gb|ACN40181.1|  unknown                                                 357   2e-118   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Vitis vinifera
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              357   2e-118   Fragaria vesca subsp. vesca
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             357   2e-118   Selaginella moellendorffii
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Elaeis guineensis
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         357   2e-118   Jatropha curcas
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Fragaria vesca subsp. vesca
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             357   3e-118   Prunus persica
emb|CAB66336.1|  alpha-tubulin                                          357   3e-118   Betula pendula [white birch]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              357   3e-118   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                357   3e-118   Vitis vinifera
gb|ACU19580.1|  unknown                                                 357   3e-118   Glycine max [soybeans]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    357   3e-118   Glycine max [soybeans]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                357   3e-118   Elaeis guineensis
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   357   3e-118   Malus domestica [apple tree]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          357   3e-118   Malus domestica [apple tree]
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                356   4e-118   Daucus carota [carrots]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        356   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    357   4e-118   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     356   4e-118   Glycine max [soybeans]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                356   4e-118   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              356   4e-118   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                356   4e-118   Cicer arietinum [garbanzo]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             356   5e-118   Phaseolus vulgaris [French bean]
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     356   5e-118   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               356   5e-118   Pisum sativum [garden pea]
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             356   6e-118   Selaginella moellendorffii
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          356   6e-118   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              356   6e-118   Medicago truncatula
gb|ACH68563.1|  alpha-tubulin                                           356   7e-118   Solanum tuberosum [potatoes]
gb|AFV46219.1|  hypothetical protein                                    355   8e-118   Scutellaria baicalensis [Baikal skullcap]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             355   8e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001067613.1|  Os11g0247300                                       355   8e-118   
dbj|BAB19779.1|  alpha tubulin                                          355   9e-118   Nicotiana tabacum [American tobacco]
gb|AGE09583.1|  TUA1-like protein                                       354   9e-118   Eucalyptus cladocalyx
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          355   9e-118   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        355   1e-117   Cucumis melo [Oriental melon]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                355   1e-117   Phoenix dactylifera
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   355   1e-117   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          355   1e-117   Citrus sinensis [apfelsine]
gb|AHZ58482.1|  alpha-tubulin                                           348   1e-117   Syntrichia caninervis
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     355   1e-117   
emb|CDP02221.1|  unnamed protein product                                355   1e-117   Coffea canephora [robusta coffee]
gb|KEH43997.1|  tubulin beta-1 chain                                    355   1e-117   Medicago truncatula
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   355   1e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          355   1e-117   
ref|NP_001289660.1|  tubulin alpha chain-like                           355   1e-117   Eucalyptus grandis [rose gum]
dbj|BAJ06362.1|  alpha-tubulin                                          355   1e-117   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   355   1e-117   Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              355   1e-117   Setaria italica
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    355   1e-117   Gossypium hirsutum [American cotton]
ref|XP_002517492.1|  tubulin alpha chain, putative                      355   1e-117   Ricinus communis
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    355   1e-117   Glycine max [soybeans]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             355   1e-117   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             355   2e-117   Phaseolus vulgaris [French bean]
gb|AHJ80822.1|  Tua1                                                    355   2e-117   Eragrostis tef [tef]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             355   2e-117   Phaseolus vulgaris [French bean]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             354   2e-117   Hordeum vulgare [barley]
gb|ABD92930.1|  alpha tubulin-2A                                        354   2e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              354   2e-117   Glycine max [soybeans]
gb|AHJ80816.1|  Tua1                                                    354   2e-117   Eragrostis tef [tef]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              354   2e-117   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   354   2e-117   Zea mays [maize]
gb|AHJ80817.1|  Tua1                                                    354   2e-117   Eragrostis tef [tef]
ref|NP_001167663.1|  tubulin alpha-3 chain                              354   2e-117   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    354   2e-117   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          354   2e-117   Miscanthus sinensis
gb|AHJ80815.1|  Tua1                                                    354   2e-117   Eragrostis tef [tef]
emb|CAA06619.1|  alpha-tubulin 1                                        354   2e-117   Eleusine indica [crabgrass]
gb|AIX10773.1|  alpha tubulin                                           354   3e-117   Panax notoginseng [san-qi]
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              354   3e-117   Nicotiana sylvestris
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              354   3e-117   Oryza brachyantha
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                354   3e-117   Eucalyptus grandis [rose gum]
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             354   3e-117   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                354   3e-117   Cucumis sativus [cucumbers]
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             354   3e-117   Selaginella moellendorffii
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              354   3e-117   Nicotiana tomentosiformis
ref|NP_001291325.1|  tubulin alpha chain-like                           354   3e-117   Sesamum indicum [beniseed]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             354   3e-117   Selaginella moellendorffii
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             354   4e-117   Prunus persica
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    353   4e-117   Citrus sinensis [apfelsine]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             353   4e-117   Phaseolus vulgaris [French bean]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                353   4e-117   Triticum aestivum [Canadian hard winter wheat]
gb|ABV55999.1|  alpha-tubulin 7                                         353   6e-117   Populus tremuloides
emb|CAA62917.1|  alfa-tubulin                                           353   6e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     353   6e-117   Populus euphratica
ref|XP_005851144.1|  alpha-tubulin                                      353   7e-117   Chlorella variabilis
gb|AGG37289.1|  alpha-tubulin 7                                         353   7e-117   Salix arbutifolia
gb|KHN42598.1|  Tubulin alpha-2 chain                                   353   7e-117   Glycine soja [wild soybean]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     353   8e-117   Sesamum indicum [beniseed]
dbj|BAJ98211.1|  predicted protein                                      353   8e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABO47742.1|  alpha-tubulin                                           353   9e-117   Gossypium hirsutum [American cotton]
gb|ABG78593.1|  alpha-tubulin                                           353   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        353   1e-116   
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    352   1e-116   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  353   1e-116   Brassica napus [oilseed rape]
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              352   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002508010.1|  alpha tubulin 2                                    352   1e-116   Micromonas commoda
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             352   1e-116   Anemia phyllitidis
ref|NP_001051132.1|  Os03g0726100                                       352   1e-116   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                352   1e-116   Nelumbo nucifera [Indian lotus]
gb|ABP65320.1|  alpha tubulin                                           352   1e-116   Capsicum annuum
ref|XP_005651460.1|  tubulin alpha chain                                352   2e-116   Coccomyxa subellipsoidea C-169
ref|XP_007032501.1|  Tubulin alpha-2 chain                              352   2e-116   
gb|AAB84298.1|  tubulin                                                 352   2e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             352   2e-116   Citrus clementina [clementine]
ref|XP_005643073.1|  tubulin alpha chain                                352   2e-116   Coccomyxa subellipsoidea C-169
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              352   3e-116   Oryza brachyantha
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   352   3e-116   Nelumbo nucifera [Indian lotus]
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             352   3e-116   Selaginella moellendorffii
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             352   3e-116   Selaginella moellendorffii
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              351   4e-116   Selaginella moellendorffii
emb|CDO97305.1|  unnamed protein product                                351   5e-116   Coffea canephora [robusta coffee]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                351   6e-116   Solanum lycopersicum
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                350   7e-116   Nicotiana tomentosiformis
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                350   9e-116   Tetrahymena pyriformis
ref|XP_001777081.1|  predicted protein                                  350   9e-116   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           350   9e-116   Stentor coeruleus
gb|AIA82437.1|  alpha-tubulin-like protein 06                           347   1e-115   Stentor coeruleus
ref|XP_001782790.1|  predicted protein                                  350   1e-115   
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              350   2e-115   Solanum lycopersicum
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             350   2e-115   Selaginella moellendorffii
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    350   2e-115   Tetrahymena thermophila SB210
gb|AHJ80823.1|  Tua1                                                    350   2e-115   Eragrostis tef [tef]
ref|XP_003058621.1|  alpha tubulin                                      349   2e-115   Micromonas pusilla CCMP1545
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             349   2e-115   Selaginella moellendorffii
emb|CAA62916.1|  alpha-tubulin                                          349   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              349   3e-115   Solanum tuberosum [potatoes]
gb|ACY05960.1|  alpha-tubulin                                           347   3e-115   Haematococcus lacustris
ref|XP_010099392.1|  Tubulin alpha chain                                350   3e-115   
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   349   3e-115   Ichthyophthirius multifiliis
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                348   4e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   348   5e-115   Monoraphidium neglectum
gb|KIZ03400.1|  Tubulin alpha chain                                     348   8e-115   Monoraphidium neglectum
gb|ACK76232.1|  alpha-tubulin                                           347   1e-114   Dimocarpus longan [longan]
gb|AIA82435.1|  alpha-tubulin-like protein 03                           347   1e-114   Stentor coeruleus
gb|AAX63396.1|  alpha-tubulin                                           347   1e-114   Haematococcus lacustris
emb|CDP00974.1|  unnamed protein product                                347   1e-114   Coffea canephora [robusta coffee]
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             347   1e-114   Chlamydomonas reinhardtii
gb|AEW46684.1|  beta-tubulin                                            347   1e-114   Ulva linza
emb|CDW82295.1|  alpha tubulin                                          347   2e-114   Stylonychia lemnae
ref|XP_001691876.1|  alpha tubulin 1                                    347   2e-114   
ref|XP_002951007.1|  alpha tubulin                                      347   2e-114   
emb|CAA67848.1|  alpha-tubulin                                          347   2e-114   
ref|XP_001460309.1|  hypothetical protein                               346   2e-114   
ref|XP_001454509.1|  hypothetical protein                               347   2e-114   
emb|CAI38956.1|  alpha_tubulin,putative                                 347   2e-114   
gb|ACH70610.1|  alpha tubulin                                           347   2e-114   
gb|AAB86649.1|  alpha-tubulin                                           347   3e-114   
gb|EJY81124.1|  Alpha tubulin,putative                                  346   3e-114   
dbj|BAJ97454.1|  predicted protein                                      343   4e-114   
ref|XP_001770881.1|  predicted protein                                  346   4e-114   
dbj|BAJ06364.1|  alpha-tubulin                                          346   6e-114   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              346   6e-114   
gb|ABC59068.2|  alpha tubulin 1                                         345   6e-114   
gb|ETL46656.1|  tubulin alpha chain                                     336   9e-114   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   345   1e-113   
gb|ETL46639.1|  tubulin alpha chain                                     336   1e-113   
emb|CBI16534.3|  unnamed protein product                                344   1e-113   
gb|ETK93242.1|  tubulin alpha chain                                     335   1e-113   
gb|ABD92937.1|  alpha tubulin-4A                                        345   1e-113   
gb|ABD92936.1|  alpha tubulin-4D                                        345   1e-113   
ref|XP_001455356.1|  hypothetical protein                               344   2e-113   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                345   2e-113   
emb|CDP12358.1|  unnamed protein product                                344   2e-113   
gb|AAB08791.1|  alpha tubulin                                           344   2e-113   
ref|XP_008606530.1|  tubulin alpha                                      339   2e-113   
gb|KJB83376.1|  hypothetical protein B456_013G244600                    338   2e-113   
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        343   2e-113   
gb|AAB86648.1|  alpha-tubulin                                           344   3e-113   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          344   3e-113   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          344   3e-113   
ref|NP_001105440.1|  tubulin alpha-3 chain                              343   4e-113   
sp|P07304.2|TBA1_STYLE  RecName: Full=Tubulin alpha-1 chain             343   5e-113   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                343   5e-113   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   343   7e-113   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           344   7e-113   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              343   7e-113   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              343   8e-113   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    339   9e-113   
gb|AEF79970.1|  alpha-tubulin protein                                   343   9e-113   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   342   1e-112   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   342   1e-112   
ref|XP_002904194.1|  alpha-tubulin                                      342   1e-112   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     342   1e-112   
gb|ETL99793.1|  tubulin alpha chain                                     338   1e-112   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  334   1e-112   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             342   2e-112   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  335   2e-112   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             335   2e-112   
dbj|BAE01779.1|  unnamed protein product                                334   2e-112   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        342   2e-112   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              341   3e-112   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              341   3e-112   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      334   3e-112   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             336   3e-112   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             341   3e-112   
gb|AAT09064.1|  alpha tubulin 2                                         341   3e-112   
gb|AAW57312.1|  alpha-tubulin                                           337   3e-112   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              341   3e-112   
emb|CDY42294.1|  BnaC02g09000D                                          341   3e-112   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      333   3e-112   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   341   3e-112   
ref|NP_197478.1|  tubulin alpha-3                                       341   3e-112   
emb|CDY44941.1|  BnaA02g04460D                                          341   4e-112   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              341   4e-112   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             341   4e-112   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             333   4e-112   
gb|AAW30623.1|  unknown                                                 332   5e-112   
gb|AAT09063.1|  alpha tubulin 1                                         341   5e-112   
emb|CDX88875.1|  BnaA03g07740D                                          340   5e-112   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              340   5e-112   
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             333   6e-112   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   340   6e-112   
emb|CCC46467.1|  putative alpha tubulin, fragment                       334   6e-112   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   340   6e-112   
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        340   6e-112   
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 336   6e-112   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      334   6e-112   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  334   6e-112   
ref|XP_673091.1|  hypothetical protein                                  333   6e-112   
gb|AAW30622.1|  unknown                                                 331   7e-112   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             333   7e-112   
gb|ACN40824.1|  unknown                                                 340   7e-112   
gb|AAG49533.3|  alpha tubulin                                           334   7e-112   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      336   8e-112   
gb|EKF30131.1|  epsilon tubulin, putative                               332   8e-112   
ref|XP_001419217.1|  predicted protein                                  340   9e-112   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  340   9e-112   
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             335   9e-112   
gb|KGL81705.1|  Tubulin alpha-1C chain                                  332   9e-112   
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  336   9e-112   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   340   1e-111   
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             332   1e-111   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             332   1e-111   
gb|AIJ27191.1|  alpha-tubulin 1a                                        333   1e-111   
gb|EKF98903.1|  epsilon tubulin, putative                               333   1e-111   
gb|ETK93224.1|  tubulin alpha-2 chain                                   330   1e-111   
ref|XP_674476.1|  hypothetical protein                                  330   1e-111   
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  336   1e-111   
gb|AIK29207.1|  putative alpha-tubulin                                  333   1e-111   
gb|AEG74028.1|  alpha-tubulin                                           339   1e-111   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                339   2e-111   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    334   2e-111   
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    339   2e-111   
ref|NP_001060075.1|  Os07g0574800                                       339   2e-111   
emb|CAJ26346.1|  alpha-tubulin                                          330   2e-111   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              339   2e-111   
gb|KJB80786.1|  hypothetical protein B456_013G115100                    339   3e-111   
emb|CAE52514.1|  alpha tubulin                                          339   3e-111   
emb|CAB77671.1|  alpha-tubulin                                          339   3e-111   
gb|AII97815.1|  BLTX443                                                 332   3e-111   
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             339   3e-111   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              339   3e-111   
ref|XP_008872990.1|  tubulin alpha chain                                339   3e-111   
gb|ETO82054.1|  tubulin alpha chain                                     339   3e-111   
gb|ETM30643.1|  tubulin alpha chain                                     338   3e-111   
emb|CCI41153.1|  unnamed protein product                                339   3e-111   
ref|XP_008900864.1|  tubulin alpha chain                                339   3e-111   
ref|XP_002904195.1|  alpha-tubulin, putative                            339   3e-111   
emb|CAL80740.1|  alpha-tubulin                                          338   3e-111   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   338   3e-111   
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             331   4e-111   
ref|XP_002532068.1|  tubulin alpha chain, putative                      338   4e-111   
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             333   4e-111   
ref|XP_009842456.1|  tubulin alpha chain                                338   4e-111   
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 334   4e-111   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   338   5e-111   
gb|AEF59080.1|  alpha tubulin-like protein                              333   5e-111   
gb|ETM52951.1|  tubulin alpha chain                                     338   5e-111   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              338   5e-111   
emb|CCC46464.1|  putative alpha tubulin                                 333   6e-111   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    338   6e-111   
dbj|BAM28754.1|  tubulin                                                335   6e-111   
gb|EKG00415.1|  epsilon tubulin, putative                               335   6e-111   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    338   7e-111   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             338   7e-111   
ref|XP_002675196.1|  alpha-tubulin                                      338   7e-111   
gb|ESL08706.1|  alpha tubulin                                           333   7e-111   
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             336   7e-111   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                338   8e-111   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              337   8e-111   
gb|AFX62864.1|  alpha tubulin 84B                                       336   8e-111   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              332   8e-111   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          337   9e-111   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   337   1e-110   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              337   1e-110   
ref|XP_003629736.1|  Alpha-tubulin                                      337   1e-110   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     334   1e-110   
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             332   1e-110   
ref|XP_009833024.1|  tubulin alpha chain                                337   1e-110   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   337   1e-110   
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        337   1e-110   
gb|ABD92942.1|  alpha tubulin-1D                                        337   1e-110   
gb|ABO33166.1|  alpha tubulin a2                                        329   2e-110   
gb|ABD92943.1|  alpha tubulin-1B                                        337   2e-110   
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              332   2e-110   
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             335   2e-110   
sp|P09243.1|TBA2_STYLE  RecName: Full=Tubulin alpha-2 chain             337   2e-110   
emb|CAD26886.1|  alpha-tubulin                                          337   2e-110   
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             335   2e-110   
ref|NP_001105588.1|  tubulin alpha-6 chain                              337   2e-110   
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  333   2e-110   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       331   2e-110   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             337   2e-110   
gb|EPS70933.1|  tubulin alpha-6 chain                                   330   2e-110   
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    336   2e-110   
gb|EPY32753.1|  tubulin alpha                                           330   2e-110   
gb|EPY40566.1|  tubulin alpha                                           333   2e-110   
ref|NP_001275086.1|  uncharacterized LOC102577521                       337   2e-110   
emb|CAD24766.1|  alpha-tubulin                                          337   2e-110   
ref|XP_002777471.1|  Tubulin alpha chain, putative                      336   2e-110   
emb|CAD26887.1|  alpha-tubulin                                          336   2e-110   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   336   2e-110   
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    335   3e-110   
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              334   3e-110   
emb|CAD26893.1|  alpha-tubulin                                          336   3e-110   
gb|EHB00536.1|  Tubulin alpha-1C chain                                  336   3e-110   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    336   3e-110   
gb|ABS57456.1|  alpha-tubulin                                           328   3e-110   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              336   3e-110   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  336   3e-110   
gb|AIC33057.1|  tubulin alpha-1 chain                                   336   3e-110   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              332   3e-110   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    336   3e-110   
ref|NP_001237301.1|  tubulin A                                          336   4e-110   
emb|CAD24767.1|  alpha-tubulin                                          336   4e-110   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    336   4e-110   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           336   4e-110   
ref|NP_001275271.1|  alpha-tubulin-like protein                         336   4e-110   
ref|XP_008616224.1|  tubulin alpha chain                                336   4e-110   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              336   4e-110   
emb|CCD12221.1|  unnamed protein product                                333   4e-110   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 336   4e-110   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    335   4e-110   
ref|XP_002786953.1|  Tubulin alpha chain, putative                      336   5e-110   
dbj|BAJ06363.1|  alpha-tubulin                                          335   5e-110   
gb|KDO30581.1|  tubulin alpha chain                                     336   5e-110   
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    332   5e-110   
emb|CDQ72000.1|  unnamed protein product                                335   6e-110   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                335   6e-110   
ref|XP_004470253.1|  PREDICTED: tubulin alpha-1B chain-like             333   6e-110   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              335   6e-110   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     335   6e-110   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       335   6e-110   
gb|ETN59126.1|  tubulin alpha chain                                     332   6e-110   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    335   6e-110   
ref|XP_009313070.1|  putative alpha tubulin                             335   6e-110   
gb|AGG37284.1|  alpha-tubulin 2                                         335   6e-110   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   335   6e-110   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       335   7e-110   
gb|EPY25298.1|  tubulin alpha                                           332   7e-110   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             335   8e-110   
ref|XP_009861085.1|  PREDICTED: tubulin alpha chain, testis-speci...    335   8e-110   
gb|AFX62784.1|  alpha tubulin 84B                                       334   8e-110   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    335   8e-110   
ref|XP_005532035.1|  PREDICTED: tubulin alpha-1C chain isoform X2       335   8e-110   
gb|AFX62804.1|  alpha tubulin 84B                                       334   8e-110   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               335   8e-110   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       335   8e-110   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    335   8e-110   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  335   8e-110   



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   361 bits (926),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   359 bits (921),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   360 bits (923),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   358 bits (920),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   353 bits (905),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSV YGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVGYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   360 bits (924),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   359 bits (921),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   354 bits (908),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   362 bits (928),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   360 bits (923),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   359 bits (921),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYN VLS
Sbjct  181  VVEPYNRVLS  190



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   360 bits (925),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   361 bits (926),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   360 bits (925),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   360 bits (925),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   351 bits (901),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSP VST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPHVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   350 bits (899),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 192/192 (100%), Gaps = 0/192 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+S
Sbjct  123  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQIS  182

Query  659  TSVVEPYNSVLS  694
            TSVVEPYNSVLS
Sbjct  183  TSVVEPYNSVLS  194



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   359 bits (921),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGL SLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   358 bits (920),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   357 bits (917),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   358 bits (920),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/198 (95%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  280
            +  S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTF
Sbjct  43   AGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTF  102

Query  281  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            FSETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  103  FSETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  162

Query  461  EIVDLCLDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIY  640
            EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+Y
Sbjct  163  EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY  222

Query  641  PSPQVSTSVVEPYNSVLS  694
            PSPQVSTSVVEPYNSVLS
Sbjct  223  PSPQVSTSVVEPYNSVLS  240



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   358 bits (920),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   358 bits (919),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   349 bits (895),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +2

Query  131  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  310
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  311  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  490
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  120

Query  491  RKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVV  670
            RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVV
Sbjct  121  RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVV  180

Query  671  EPYNSVLS  694
            EPYNSVLS
Sbjct  181  EPYNSVLS  188



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYN VLS
Sbjct  181  VVEPYNRVLS  190



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLGFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   356 bits (913),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   356 bits (913),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   356 bits (914),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  487
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  120

Query  488  IRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSV  667
            IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV
Sbjct  121  IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV  180

Query  668  VEPYNSVLS  694
            VEPYNSVLS
Sbjct  181  VEPYNSVLS  189



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 190/192 (99%), Gaps = 0/192 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS
Sbjct  156  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS  215

Query  659  TSVVEPYNSVLS  694
            T+VVEPYNSVLS
Sbjct  216  TAVVEPYNSVLS  227



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 188/190 (99%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   354 bits (909),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   355 bits (911),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   348 bits (894),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLAD+CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADSCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D T+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTLGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 190/190 (100%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKE+AANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPT+IDEVRTG YRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTMIDEVRTGDYRQLFHPEQVISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIH+GQAGIQ+GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   353 bits (905),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQP+GQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPEGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            M ECISIH+GQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MGECISIHMGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQ GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNA WELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNARWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGG TGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGXTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGNYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/190 (98%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLDFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            V EPYNSVLS
Sbjct  181  VDEPYNSVLS  190



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   352 bits (904),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGG DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGADAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPE LISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEHLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>gb|AAB84298.1| tubulin [Oryza sativa Indica Group]
Length=451

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQ FHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGLYRQFFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006431130.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 ref|XP_006482576.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Citrus sinensis]
 gb|ESR44370.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 gb|KDO72550.1| hypothetical protein CISIN_1g013066mg [Citrus sinensis]
Length=450

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/190 (98%), Positives = 187/190 (98%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQ GIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQPGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPS KTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSGKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   351 bits (901),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 189/190 (99%), Gaps = 0/190 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLS  694
            VVEPYNSVLS
Sbjct  181  VVEPYNSVLS  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340