BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031B22

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                289   8e-93   Sesamum indicum [beniseed]
gb|EPS65211.1|  hypothetical protein M569_09564                         283   2e-90   Genlisea aurea
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                282   5e-90   Erythranthe guttata [common monkey flower]
emb|CDP15943.1|  unnamed protein product                                282   6e-90   Coffea canephora [robusta coffee]
ref|XP_009593784.1|  PREDICTED: phospholipase A1-IIdelta                283   2e-89   Nicotiana tomentosiformis
ref|XP_002303465.1|  lipase family protein                              280   2e-89   
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                280   6e-89   Populus euphratica
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like           280   2e-88   Solanum tuberosum [potatoes]
ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           279   2e-88   Nicotiana tomentosiformis
gb|KJB71435.1|  hypothetical protein B456_011G123300                    276   1e-87   Gossypium raimondii
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                276   1e-87   Nelumbo nucifera [Indian lotus]
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          276   2e-87   
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                275   4e-87   Erythranthe guttata [common monkey flower]
ref|XP_004243279.1|  PREDICTED: phospholipase A1-IIdelta                274   5e-86   Solanum lycopersicum
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             270   4e-85   Phaseolus vulgaris [French bean]
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           269   8e-85   Solanum lycopersicum
ref|XP_009766306.1|  PREDICTED: phospholipase A1-IIdelta-like           271   9e-85   Nicotiana sylvestris
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           268   1e-84   Solanum tuberosum [potatoes]
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             270   1e-84   Prunus persica
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             268   2e-84   Citrus clementina [clementine]
emb|CDO98286.1|  unnamed protein product                                268   3e-84   Coffea canephora [robusta coffee]
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          267   4e-84   
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   266   7e-84   Citrus sinensis [apfelsine]
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           266   1e-83   Citrus sinensis [apfelsine]
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                266   3e-83   Prunus mume [ume]
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     264   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta                265   8e-83   Fragaria vesca subsp. vesca
gb|KFK37116.1|  hypothetical protein AALP_AA4G215000                    258   2e-81   Arabis alpina [alpine rockcress]
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           260   2e-81   Camelina sativa [gold-of-pleasure]
gb|ACJ85535.1|  unknown                                                 261   2e-81   Medicago truncatula
ref|XP_003607601.1|  Feruloyl esterase A                                261   3e-81   Medicago truncatula
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             259   4e-81   
dbj|BAH56866.1|  AT2G42690                                              258   5e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           260   1e-80   
ref|NP_181797.1|  phospholipase A1-IIdelta                              258   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                259   1e-80   Vitis vinifera
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                258   2e-80   Brassica rapa
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         258   2e-80   Jatropha curcas
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             257   2e-80   Capsella rubella
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    257   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    257   3e-80   Camelina sativa [gold-of-pleasure]
gb|EPS65213.1|  hypothetical protein M569_09566                         257   3e-80   Genlisea aurea
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           256   1e-79   
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             256   1e-79   Eutrema salsugineum [saltwater cress]
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           255   1e-79   
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    251   9e-78   Arabis alpina [alpine rockcress]
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           248   5e-77   Morus notabilis
emb|CBI21996.3|  unnamed protein product                                251   7e-77   Vitis vinifera
ref|XP_009142882.1|  PREDICTED: phospholipase A1-IIdelta-like           246   8e-77   Brassica rapa
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           248   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             247   2e-76   
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           246   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             246   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           246   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           247   8e-76   
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           244   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           245   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_002518706.1|  triacylglycerol lipase, putative                   245   2e-75   Ricinus communis
emb|CDY50817.1|  BnaC04g52540D                                          244   3e-75   Brassica napus [oilseed rape]
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                244   6e-75   Eucalyptus grandis [rose gum]
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like           238   2e-72   
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                235   9e-72   Tarenaya hassleriana [spider flower]
gb|AAD01804.1|  lipase                                                  234   8e-71   Dianthus caryophyllus [carnation]
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like           233   2e-70   
ref|XP_004306113.1|  PREDICTED: phospholipase A1-IIdelta-like           222   2e-69   Fragaria vesca subsp. vesca
ref|XP_011463616.1|  PREDICTED: phospholipase A1-IIdelta-like           221   7e-69   Fragaria vesca subsp. vesca
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           228   8e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011463615.1|  PREDICTED: phospholipase A1-IIdelta-like           219   1e-68   Fragaria vesca subsp. vesca
emb|CDY47985.1|  BnaA04g24630D                                          224   6e-68   Brassica napus [oilseed rape]
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   224   3e-67   Phoenix dactylifera
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              223   2e-66   Elaeis guineensis
emb|CDY14851.1|  BnaC04g48480D                                          220   2e-66   Brassica napus [oilseed rape]
ref|XP_004292180.1|  PREDICTED: phospholipase A1-IIdelta-like           210   1e-64   Fragaria vesca subsp. vesca
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   218   2e-64   
ref|XP_006858342.1|  hypothetical protein AMTR_s00064p00160580          206   9e-63   
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              211   5e-62   Elaeis guineensis
gb|ABK24664.1|  unknown                                                 210   6e-62   Picea sitchensis
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          209   4e-61   
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   209   5e-61   Brachypodium distachyon [annual false brome]
dbj|BAJ88202.1|  predicted protein                                      208   7e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85876.1|  predicted protein                                      208   7e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   207   2e-60   Zea mays [maize]
emb|CDM83808.1|  unnamed protein product                                204   4e-59   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63050.1|  Phospholipase A1-II 5                                   204   1e-58   Triticum urartu
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              202   2e-58   Setaria italica
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           199   1e-57   Morus notabilis
ref|XP_010104409.1|  Phospholipase A1-IIdelta                           196   3e-56   Morus notabilis
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           193   2e-55   Glycine max [soybeans]
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                193   2e-55   Prunus mume [ume]
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     192   2e-55   Vitis vinifera
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              193   3e-55   Oryza brachyantha
gb|KHN08451.1|  Phospholipase A1-IIgamma                                191   4e-55   Glycine soja [wild soybean]
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           192   6e-55   Pyrus x bretschneideri [bai li]
ref|XP_003593747.1|  Lipase                                             191   1e-54   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           191   2e-54   Fragaria vesca subsp. vesca
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            190   2e-54   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           190   2e-54   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           191   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           189   3e-54   Nelumbo nucifera [Indian lotus]
gb|AFK35349.1|  unknown                                                 185   4e-54   Lotus japonicus
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     189   7e-54   Eucalyptus grandis [rose gum]
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                189   7e-54   Malus domestica [apple tree]
gb|KHN18919.1|  Phospholipase A1-IIgamma                                188   1e-53   Glycine soja [wild soybean]
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           189   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           187   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           188   2e-53   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           187   2e-53   Eucalyptus grandis [rose gum]
gb|EPS68357.1|  hypothetical protein M569_06414                         181   3e-53   Genlisea aurea
ref|NP_001044041.1|  Os01g0710700                                       188   3e-53   
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             188   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           186   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           185   1e-52   Eucalyptus grandis [rose gum]
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    186   2e-52   Nelumbo nucifera [Indian lotus]
gb|EEE55280.1|  hypothetical protein OsJ_03214                          188   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    185   5e-52   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           182   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                182   5e-51   Cucumis melo [Oriental melon]
emb|CDO96758.1|  unnamed protein product                                181   5e-51   Coffea canephora [robusta coffee]
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           181   7e-51   Cucumis sativus [cucumbers]
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             181   8e-51   Citrus clementina [clementine]
ref|XP_011462291.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    181   8e-51   Fragaria vesca subsp. vesca
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           181   8e-51   Citrus sinensis [apfelsine]
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       181   1e-50   Cucumis sativus [cucumbers]
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           181   1e-50   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   180   1e-50   Elaeis guineensis
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           180   2e-50   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           179   2e-50   
gb|KJB69607.1|  hypothetical protein B456_011G033600                    179   3e-50   Gossypium raimondii
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              179   3e-50   Solanum lycopersicum
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   177   1e-49   Solanum lycopersicum
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             177   1e-49   Phaseolus vulgaris [French bean]
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              178   2e-49   Solanum tuberosum [potatoes]
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         177   2e-49   Jatropha curcas
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                177   4e-49   Cucumis melo [Oriental melon]
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           177   4e-49   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          175   1e-48   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           172   8e-48   Glycine max [soybeans]
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           173   8e-48   Tarenaya hassleriana [spider flower]
gb|ABR18391.1|  unknown                                                 173   8e-48   Picea sitchensis
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              173   8e-48   Nicotiana sylvestris
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              173   1e-47   Nicotiana tomentosiformis
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              171   3e-47   Solanum tuberosum [potatoes]
gb|ABK23399.1|  unknown                                                 171   4e-47   Picea sitchensis
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     171   5e-47   Zea mays [maize]
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   169   1e-46   Phoenix dactylifera
gb|KJB57431.1|  hypothetical protein B456_009G163800                    168   3e-46   Gossypium raimondii
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                169   3e-46   Sesamum indicum [beniseed]
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              168   3e-46   Nicotiana sylvestris
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    168   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    167   7e-46   Tarenaya hassleriana [spider flower]
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          167   1e-45   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             167   2e-45   Capsella rubella
ref|XP_002305750.2|  lipase class 3 family protein                      165   5e-45   Populus trichocarpa [western balsam poplar]
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                166   6e-45   Erythranthe guttata [common monkey flower]
ref|XP_002316835.2|  lipase class 3 family protein                      165   9e-45   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    165   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             164   1e-44   Phaseolus vulgaris [French bean]
ref|XP_002867985.1|  lipase class 3 family protein                      164   2e-44   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                164   2e-44   Camelina sativa [gold-of-pleasure]
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    164   2e-44   Arabis alpina [alpine rockcress]
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              164   2e-44   Setaria italica
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           164   2e-44   Nicotiana sylvestris
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           163   3e-44   Populus euphratica
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      161   3e-44   
ref|XP_009137120.1|  PREDICTED: phospholipase A1-IIgamma-like           162   4e-44   Brassica rapa
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              164   5e-44   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              163   5e-44   Sesamum indicum [beniseed]
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           163   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                163   6e-44   Brassica rapa
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           162   8e-44   Nicotiana tomentosiformis
gb|EMT21704.1|  Putative lipase                                         162   8e-44   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           162   8e-44   Solanum tuberosum [potatoes]
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           162   8e-44   Brassica rapa
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             162   9e-44   Eutrema salsugineum [saltwater cress]
emb|CDY01554.1|  BnaC07g35440D                                          162   1e-43   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           162   1e-43   Nicotiana sylvestris
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                162   1e-43   Populus euphratica
emb|CBI21954.3|  unnamed protein product                                161   1e-43   Vitis vinifera
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           161   2e-43   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      161   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           160   3e-43   Solanum tuberosum [potatoes]
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              160   3e-43   
ref|NP_001055438.1|  Os05g0390000                                       161   4e-43   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           160   4e-43   Nicotiana tomentosiformis
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          160   7e-43   Sorghum bicolor [broomcorn]
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           159   1e-42   Nicotiana tomentosiformis
ref|XP_002522554.1|  triacylglycerol lipase, putative                   159   1e-42   
gb|ABQ95989.1|  phospholipase A1                                        159   1e-42   Capsicum annuum
gb|EEC79153.1|  hypothetical protein OsI_19824                          161   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              159   3e-42   Brachypodium distachyon [annual false brome]
gb|ACG40994.1|  triacylglycerol lipase                                  153   3e-42   Zea mays [maize]
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             157   3e-42   Phaseolus vulgaris [French bean]
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           157   4e-42   Nicotiana tomentosiformis
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    158   4e-42   Oryza brachyantha
gb|AFW83434.1|  hypothetical protein ZEAMMB73_348788                    153   4e-42   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   157   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM83551.1|  unnamed protein product                                157   5e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              157   6e-42   Oryza brachyantha
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           157   6e-42   Solanum lycopersicum
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    159   6e-42   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    159   7e-42   Setaria italica
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           156   8e-42   Solanum lycopersicum
ref|NP_193590.1|  phospholipase A1-IIgamma                              157   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415331.1|  PREDICTED: phospholipase A1-II 5-like              156   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              156   1e-41   Setaria italica
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    158   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441042.1|  hypothetical protein SORBIDRAFT_09g019276          157   1e-41   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    158   1e-41   
ref|XP_009415339.1|  PREDICTED: phospholipase A1-II 5-like              156   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           156   2e-41   Solanum tuberosum [potatoes]
gb|AFK39140.1|  unknown                                                 150   2e-41   Medicago truncatula
ref|XP_003608120.1|  Lipase                                             155   2e-41   Medicago truncatula
gb|EMT15519.1|  Lipase                                                  155   3e-41   
dbj|BAJ96485.1|  predicted protein                                      155   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          155   4e-41   Sorghum bicolor [broomcorn]
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           155   4e-41   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    157   4e-41   Elaeis guineensis
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           155   4e-41   Solanum tuberosum [potatoes]
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              154   4e-41   Solanum tuberosum [potatoes]
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    156   5e-41   Phoenix dactylifera
ref|XP_002525127.1|  triacylglycerol lipase, putative                   154   5e-41   Ricinus communis
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    154   5e-41   Nicotiana sylvestris
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           154   6e-41   Solanum lycopersicum
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           155   7e-41   Tarenaya hassleriana [spider flower]
gb|EMT04701.1|  Lipase                                                  154   7e-41   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    154   8e-41   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         155   9e-41   Jatropha curcas
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   154   1e-40   Zea mays [maize]
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    155   1e-40   Cucumis melo [Oriental melon]
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   154   1e-40   Solanum lycopersicum
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              154   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    155   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    155   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          153   2e-40   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           153   2e-40   Nicotiana sylvestris
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              152   2e-40   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    153   2e-40   Sesamum indicum [beniseed]
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             153   2e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63185.1|  Phospholipase A1-II 1                                   156   4e-40   Triticum urartu
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    154   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    152   4e-40   Populus euphratica
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    154   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           152   5e-40   Solanum tuberosum [potatoes]
ref|NP_001152663.1|  triacylglycerol lipase precursor                   152   5e-40   Zea mays [maize]
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             151   6e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    156   8e-40   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    153   8e-40   Sesamum indicum [beniseed]
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           151   8e-40   Solanum lycopersicum
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             151   9e-40   Eutrema salsugineum [saltwater cress]
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       151   9e-40   
gb|AFK47098.1|  unknown                                                 151   9e-40   Medicago truncatula
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              152   9e-40   Zea mays [maize]
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           151   1e-39   Glycine max [soybeans]
ref|XP_003608122.1|  Lipase                                             151   1e-39   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    151   1e-39   Nicotiana sylvestris
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    151   1e-39   Arabis alpina [alpine rockcress]
ref|NP_001151242.1|  triacylglycerol lipase                             151   1e-39   
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    152   1e-39   Populus euphratica
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    150   1e-39   Nicotiana sylvestris
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       152   1e-39   Cucumis sativus [cucumbers]
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             150   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    152   2e-39   Elaeis guineensis
ref|XP_001779106.1|  predicted protein                                  151   2e-39   
gb|EMS51987.1|  Phospholipase A1-II 3                                   150   2e-39   Triticum urartu
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              151   2e-39   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    152   2e-39   Zea mays [maize]
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    150   2e-39   
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             152   2e-39   
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    151   3e-39   
ref|NP_001149813.1|  triacylglycerol lipase                             150   3e-39   Zea mays [maize]
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    150   3e-39   
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   150   3e-39   Eucalyptus grandis [rose gum]
emb|CBI16352.3|  unnamed protein product                                151   3e-39   Vitis vinifera
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    151   4e-39   Vitis vinifera
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           149   4e-39   Solanum lycopersicum
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    149   4e-39   
gb|EMS48809.1|  Phospholipase A1-II 6                                   150   4e-39   Triticum urartu
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    151   4e-39   Populus euphratica
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    149   5e-39   
emb|CDM85400.1|  unnamed protein product                                149   5e-39   
gb|EMT05578.1|  hypothetical protein F775_13080                         149   6e-39   
emb|CBI30665.3|  unnamed protein product                                148   7e-39   
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             150   7e-39   
emb|CAN74039.1|  hypothetical protein VITISV_012945                     150   8e-39   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    150   8e-39   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    150   8e-39   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             149   1e-38   
gb|KJB22934.1|  hypothetical protein B456_004G074700                    150   1e-38   
gb|KJB22933.1|  hypothetical protein B456_004G074700                    150   1e-38   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 148   1e-38   
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            148   1e-38   
gb|KJB42206.1|  hypothetical protein B456_007G142100                    148   1e-38   
emb|CAN83233.1|  hypothetical protein VITISV_005768                     149   1e-38   
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            148   1e-38   
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    146   1e-38   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         149   2e-38   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    149   2e-38   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    149   2e-38   
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    149   2e-38   
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             149   3e-38   
ref|XP_002892328.1|  predicted protein                                  146   3e-38   
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    149   3e-38   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     148   3e-38   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    148   3e-38   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    148   4e-38   
emb|CDY22842.1|  BnaA06g02350D                                          148   4e-38   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    148   4e-38   
emb|CDY10187.1|  BnaC05g04300D                                          147   4e-38   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    147   4e-38   
gb|KJB42205.1|  hypothetical protein B456_007G142100                    148   5e-38   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             148   5e-38   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           147   5e-38   
ref|XP_010446304.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    144   5e-38   
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          147   5e-38   
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     148   5e-38   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             148   5e-38   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    148   6e-38   
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              147   6e-38   
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          147   6e-38   
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       151   6e-38   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    148   6e-38   
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           147   6e-38   
ref|XP_002891639.1|  lipase class 3 family protein                      148   6e-38   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    147   7e-38   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    147   7e-38   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    146   8e-38   
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           147   9e-38   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          146   9e-38   
emb|CDP11819.1|  unnamed protein product                                145   1e-37   
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    147   1e-37   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    147   1e-37   
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    147   1e-37   
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    147   1e-37   
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     146   1e-37   
ref|XP_001779107.1|  predicted protein                                  146   2e-37   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                146   2e-37   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    145   2e-37   
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    146   2e-37   
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             146   2e-37   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    145   2e-37   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           145   3e-37   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    146   3e-37   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    146   3e-37   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         146   3e-37   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    144   3e-37   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             144   3e-37   
ref|XP_010104408.1|  Phospholipase A1-IIdelta                           145   3e-37   
emb|CDY57813.1|  BnaA10g28020D                                          146   3e-37   
gb|EPS70940.1|  hypothetical protein M569_03817                         144   3e-37   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    145   3e-37   
emb|CDY49813.1|  BnaC06g04560D                                          145   3e-37   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    145   4e-37   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    144   4e-37   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              144   4e-37   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    145   4e-37   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    145   5e-37   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             145   5e-37   
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    144   5e-37   
gb|AAM61647.1|  lipase-like protein                                     144   5e-37   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             144   6e-37   
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    145   7e-37   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    145   7e-37   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    144   8e-37   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              144   8e-37   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             144   8e-37   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   144   9e-37   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    144   9e-37   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    144   1e-36   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    144   1e-36   
gb|EAY75192.1|  hypothetical protein OsI_03084                          143   1e-36   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    144   1e-36   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              143   1e-36   
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             143   1e-36   
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    144   1e-36   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    144   1e-36   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             144   1e-36   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    144   1e-36   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   1e-36   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   1e-36   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   2e-36   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   2e-36   
ref|NP_564590.1|  DAD1-like lipase 2                                    144   2e-36   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       144   2e-36   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    143   2e-36   
ref|NP_001043730.2|  Os01g0651200                                       142   2e-36   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    144   2e-36   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   2e-36   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     142   2e-36   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             143   2e-36   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          143   3e-36   
emb|CDP09265.1|  unnamed protein product                                143   3e-36   
dbj|BAD68802.1|  lipase-like protein                                    142   3e-36   
emb|CDM86668.1|  unnamed protein product                                143   3e-36   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    143   3e-36   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    143   3e-36   
gb|KJB69894.1|  hypothetical protein B456_011G048500                    143   3e-36   
ref|XP_002513514.1|  triacylglycerol lipase, putative                   142   4e-36   
ref|NP_172115.1|  phospholipase A1-IIalpha                              142   4e-36   
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              141   4e-36   
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    142   5e-36   
emb|CDO96757.1|  unnamed protein product                                140   5e-36   
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          142   5e-36   
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    141   5e-36   
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    142   8e-36   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              141   8e-36   
ref|XP_001781080.1|  predicted protein                                  140   8e-36   
ref|XP_002525129.1|  triacylglycerol lipase, putative                   140   8e-36   
emb|CDY23963.1|  BnaC03g17280D                                          140   9e-36   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             142   9e-36   
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         141   9e-36   
emb|CDP21091.1|  unnamed protein product                                141   1e-35   
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             141   1e-35   
ref|XP_010540608.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    141   1e-35   
emb|CDX86530.1|  BnaC08g01730D                                          140   2e-35   
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                140   2e-35   
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              140   2e-35   
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    140   2e-35   
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg                140   2e-35   
gb|KFK44851.1|  hypothetical protein AALP_AA1G310600                    140   3e-35   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           139   3e-35   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   3e-35   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   3e-35   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   3e-35   
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   3e-35   
ref|XP_002314049.2|  hypothetical protein POPTR_0009s06300g             140   4e-35   
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          140   4e-35   
emb|CDX84801.1|  BnaA03g14290D                                          139   4e-35   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                139   4e-35   
gb|EMS63790.1|  Phospholipase A1-II 7                                   140   4e-35   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   4e-35   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             139   4e-35   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    140   5e-35   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    139   5e-35   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             140   5e-35   
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   5e-35   
gb|KJB35773.1|  hypothetical protein B456_006G127600                    139   5e-35   
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    139   5e-35   
emb|CDX97819.1|  BnaC04g41200D                                          139   5e-35   
emb|CDM86669.1|  unnamed protein product                                139   6e-35   
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    139   6e-35   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            138   6e-35   
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   6e-35   
dbj|BAJ99811.1|  predicted protein                                      139   7e-35   
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                139   7e-35   
gb|EMT11182.1|  hypothetical protein F775_27795                         139   8e-35   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   8e-35   
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          139   1e-34   
ref|XP_007223991.1|  hypothetical protein PRUPE_ppa014790mg             138   1e-34   
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             137   1e-34   
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           138   1e-34   
ref|XP_011025479.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   1e-34   
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480          138   1e-34   
emb|CDX77597.1|  BnaA07g07350D                                          138   1e-34   
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    139   1e-34   
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    138   1e-34   
ref|XP_002879267.1|  lipase class 3 family protein                      138   1e-34   
emb|CDY09593.1|  BnaC05g23260D                                          138   1e-34   
ref|XP_009115161.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    136   2e-34   
ref|XP_003607369.1|  Lipase                                             138   2e-34   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
dbj|BAJ95995.1|  predicted protein                                      137   2e-34   
emb|CDY02287.1|  BnaA09g26150D                                          138   2e-34   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
ref|XP_009102705.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
ref|NP_563772.1|  phospholipase A1-Igamma1                              137   2e-34   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    137   2e-34   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    138   2e-34   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    138   2e-34   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    137   2e-34   
ref|XP_008380696.1|  PREDICTED: galactolipase DONGLE, chloroplastic     137   2e-34   
emb|CDY54880.1|  BnaA10g27930D                                          137   2e-34   
ref|XP_007024952.1|  Alpha/beta-Hydrolases superfamily protein          137   3e-34   
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    137   3e-34   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    137   3e-34   
ref|XP_002892359.1|  lipase class 3 family protein                      137   3e-34   
ref|NP_850148.1|  phospholipase A1-Igamma2                              137   3e-34   
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    137   3e-34   
ref|NP_849603.1|  phospholipase A1-Igamma1                              137   4e-34   
ref|XP_006415481.1|  hypothetical protein EUTSA_v10007346mg             137   4e-34   
emb|CDY24728.1|  BnaC04g13330D                                          136   4e-34   
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    136   4e-34   
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    136   4e-34   
ref|NP_565701.1|  phospholipase A1-Igamma2                              137   4e-34   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    137   4e-34   
emb|CDY10228.1|  BnaC05g04710D                                          137   5e-34   
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            135   5e-34   
ref|XP_008222660.1|  PREDICTED: galactolipase DONGLE, chloroplastic     136   5e-34   
gb|KEH23857.1|  phospholipase A1                                        136   6e-34   
ref|XP_002272780.2|  PREDICTED: phospholipase A1-Igamma1, chlorop...    136   6e-34   
ref|XP_010245170.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    136   7e-34   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    136   7e-34   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    136   7e-34   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              135   8e-34   
emb|CDY29665.1|  BnaA04g17620D                                          136   8e-34   
gb|ACJ76846.1|  chloroplast lipase protein                              136   9e-34   
ref|XP_002531054.1|  triacylglycerol lipase, putative                   136   9e-34   
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    135   1e-33   



>ref|XP_011082995.1| PREDICTED: phospholipase A1-IIdelta [Sesamum indicum]
Length=402

 Score =   289 bits (740),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 168/206 (82%), Gaps = 5/206 (2%)
 Frame = +2

Query  32   MAT---EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSC  202
            MAT   EPTW +LLGS+NWEGLLDPL+LSLR LILRCGDFCQATYD+FNND NSKYAGS 
Sbjct  1    MATTVAEPTWGELLGSKNWEGLLDPLDLSLRRLILRCGDFCQATYDAFNNDENSKYAGSS  60

Query  203  RYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
            RYGK+SFF KVML SA DYQV+ +LYATAK+ + EA  LHS SRE+WDRESNWIGY++ T
Sbjct  61   RYGKKSFFSKVMLESASDYQVQCFLYATAKVGIIEAIFLHSRSREAWDRESNWIGYISTT  120

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D VS+ALGRREIYV +RGTT D EWI+VF AKP SA+ LL+    G+  DE+++KVPKV
Sbjct  121  TDEVSRALGRREIYVAWRGTTRDYEWIDVFGAKPDSAKELLQ--PGGEDDDEDEEKVPKV  178

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
            M GWL LY S DPNS FT  SAR QL
Sbjct  179  MDGWLKLYVSSDPNSPFTKFSARNQL  204



>gb|EPS65211.1| hypothetical protein M569_09564 [Genlisea aurea]
Length=417

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 158/208 (76%), Gaps = 8/208 (4%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            E +W +LLG  NW GLLDPLNL LR LILRCGDF QATYD+FNND NS++AGS RYGKRS
Sbjct  11   ESSWPELLGKNNWAGLLDPLNLDLRRLILRCGDFVQATYDAFNNDENSRFAGSSRYGKRS  70

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF KVML  ADDY+V ++LYATAKL   +A  LHSLSRESWDRESNWIGY+AVTSD+VS 
Sbjct  71   FFRKVMLEGADDYEVSSFLYATAKLGFTKALFLHSLSRESWDRESNWIGYIAVTSDSVSA  130

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRS-------ITNGDKGDEEDD-KVP  556
            ALGRREIYV FRGTT + EWI+V  A+P SA+ L++           GD  DEEDD K  
Sbjct  131  ALGRREIYVAFRGTTRNYEWIDVLGARPESAKQLMKQSNWEKKKANAGDSSDEEDDGKTA  190

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            K+M GWLT+Y S DP S FT LSAR QL
Sbjct  191  KIMKGWLTIYLSSDPKSEFTKLSARSQL  218



>gb|EYU41119.1| hypothetical protein MIMGU_mgv1a025698mg [Erythranthe guttata]
Length=408

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 162/208 (78%), Gaps = 7/208 (3%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EP+W +LLGS NWE LLDPL+LSLR LILRCGDFCQATYD+FNND NSK+AGS RYGK 
Sbjct  2    AEPSWAELLGSNNWENLLDPLDLSLRRLILRCGDFCQATYDAFNNDQNSKFAGSSRYGKD  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFF KVML SA DY+VE +LYATAK+ V +A  LHSLSRESWDRESNWIGY+A TSD +S
Sbjct  62   SFFQKVMLDSAADYKVECFLYATAKVGVGKAMFLHSLSRESWDRESNWIGYIATTSDELS  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT---NGDKGDEEDDK----VP  556
            ++ GRREIYVV+RGTT + EWI+V  A+P SA  LL+  +   N    DE++D     VP
Sbjct  122  RSSGRREIYVVWRGTTRNYEWIDVLGARPESAHELLQPTSDNYNNTPSDEDNDDDEHGVP  181

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            KVM GWLT+Y S DPNS FT LSAR QL
Sbjct  182  KVMKGWLTIYVSTDPNSSFTKLSARTQL  209



>emb|CDP15943.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 167/213 (78%), Gaps = 10/213 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            +  TEPTW +LLGS NWEGLLDPL+LSLR+LILRCGDFCQATYDSF ND+NSK+AGS RY
Sbjct  4    TAGTEPTWLELLGSNNWEGLLDPLDLSLRNLILRCGDFCQATYDSFVNDANSKFAGSSRY  63

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK+SFF KVML +A DYQV  +LYATA++ VPEA LLH+ SRE+WDRESNWIGY+A T+D
Sbjct  64   GKKSFFQKVMLENASDYQVYCFLYATAQIGVPEAILLHTRSREAWDRESNWIGYIATTTD  123

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEED--------  544
             VSK+LGRREIYV +RGT+ D EWI+VF A+P SA+ L +   + DK  E +        
Sbjct  124  EVSKSLGRREIYVAWRGTSRDYEWIDVFSARPESADQLFKP-KSWDKKVEANEDDSDEDE  182

Query  545  -DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             +K  KVM+GWLT+Y S+DP S FT  SAR+QL
Sbjct  183  EEKATKVMYGWLTIYVSEDPKSSFTKTSARKQL  215



>ref|XP_009593784.1| PREDICTED: phospholipase A1-IIdelta [Nicotiana tomentosiformis]
Length=483

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 161/212 (76%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M TEPTWH+LLGS NWE LLDPLNL LR LILRCGDFCQATYD+FNND NSKY GS RYG
Sbjct  1    MGTEPTWHELLGSNNWESLLDPLNLHLRRLILRCGDFCQATYDAFNNDQNSKYCGSSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFFHKVM  SA DY+V ++LYATA++   +A  LHSLSRESWDRESNWIGY+AVT+D 
Sbjct  61   KNSFFHKVMFESASDYKVYSFLYATARVGAHKALFLHSLSRESWDRESNWIGYIAVTNDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL--RSITNGD-------KGDEED  544
            VS+ LGRREIY+ FRGTT + EWINV  AKP SA  LL  +S+   +         D++D
Sbjct  121  VSENLGRREIYIAFRGTTRNYEWINVLGAKPESAGPLLHPKSLNKAELDDGDGGNVDDDD  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +  PKVM GWL +Y S DPNS FT LSAR QL
Sbjct  181  ENAPKVMNGWLKIYVSNDPNSPFTRLSARAQL  212



>ref|XP_002303465.1| lipase family protein [Populus trichocarpa]
 gb|EEE78444.1| lipase family protein [Populus trichocarpa]
Length=411

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 165/208 (79%), Gaps = 7/208 (3%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +E TW ++LGS NW+ LLDPL+LSLR LILRCGDFCQATYD+FNND NS+Y G+ RYGKR
Sbjct  5    SEATWPEILGSRNWDNLLDPLDLSLRKLILRCGDFCQATYDAFNNDQNSRYCGTSRYGKR  64

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            +FFHKVML + ++YQV ++LYATA++ +PEAFLLHSLSR+SWDRE+NWIGY+AVTSD  +
Sbjct  65   NFFHKVMLDNPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAVTSDEQT  124

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDE-------EDDKVP  556
            K LGRREIY+ FRGTT + EW+++  AK  SA+ LLR  T+     E       +DDKVP
Sbjct  125  KTLGRREIYIAFRGTTRNYEWVDILGAKLKSAKPLLRGATSTTHDQESSSSSDDDDDKVP  184

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            KVM GWLT+Y S DPNS FT LSAR QL
Sbjct  185  KVMLGWLTMYISDDPNSPFTKLSARAQL  212



>ref|XP_011028053.1| PREDICTED: phospholipase A1-IIdelta [Populus euphratica]
Length=413

 Score =   280 bits (715),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 170/210 (81%), Gaps = 9/210 (4%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +E TW ++LGS+NW+ LLDPL+LSLR LI+RCGDFCQATYD+FNND NS+Y G+ RYGKR
Sbjct  5    SEATWPEILGSKNWDNLLDPLDLSLRKLIIRCGDFCQATYDAFNNDKNSRYCGTSRYGKR  64

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            +FFHKVML + ++YQV ++LYATA++ +PEAFLLHSLSR+SWDRE+NWIGY+AVTSD  +
Sbjct  65   NFFHKVMLDNPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAVTSDEQT  124

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNG--DKG-------DEEDDK  550
            K LGRREIY+ FRGTT + EW+N+  AK  SA+ LLR  T+   D+G       D++DDK
Sbjct  125  KTLGRREIYIAFRGTTRNYEWVNILGAKLKSAKPLLRGATSTTRDQGSSSSSDDDDDDDK  184

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            VPKVM GWL++Y S DPNS FT LSAR QL
Sbjct  185  VPKVMLGWLSMYISDDPNSPFTKLSARAQL  214



>ref|XP_006348881.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=488

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M TEPTWH+LLGS NWEGLL+PL+L+LR LILRCGDFCQAT+D+FNND  S Y GS RYG
Sbjct  1    MGTEPTWHELLGSNNWEGLLEPLHLNLRRLILRCGDFCQATHDAFNNDEYSMYCGSSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFFHKVM  SA DYQ+ ++LYATA++   +AF LHSLSRESWDRESNWIGY+AVT+D 
Sbjct  61   KSSFFHKVMFKSASDYQIVSFLYATARVGAHKAFFLHSLSRESWDRESNWIGYIAVTNDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT---------NGDKGDEED  544
            +S+ LGRREIY+ FRGTT + EW+NV  A P SAE LL   +         NG     +D
Sbjct  121  MSEQLGRREIYIAFRGTTRNYEWVNVLSALPESAEPLLHPQSLNKPDPDGDNGGSNSNDD  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +  P+VM GWL +Y S DP S +T LSAR QL
Sbjct  181  ENAPRVMNGWLKIYISSDPKSPYTRLSARAQL  212



>ref|XP_009629724.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana tomentosiformis]
Length=453

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 167/254 (66%), Gaps = 51/254 (20%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M TEP WH+LLGS NWEGLL+PLNL+LR LILRCGDFCQATYD+FNND NSKY G+ RYG
Sbjct  1    METEPIWHELLGSNNWEGLLEPLNLNLRQLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K+SFF KVML SA +Y++  +LYATA++   EA  LHSLSRE+WDRESNWIGY+AVT+D 
Sbjct  61   KKSFFQKVMLQSASNYKISGFLYATARIGALEAIFLHSLSREAWDRESNWIGYIAVTTDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT------NGDKG-------  532
            V++ LGRREIYVVFRGTT + EWINV  A+P SA+SLLR  +      NGD G       
Sbjct  121  VTQELGRREIYVVFRGTTRNYEWINVLGARPESADSLLRPKSLHKIGVNGDDGVSGDNSK  180

Query  533  -----DEEDDKV---------------------------------PKVMFGWLTLYTSKD  598
                 DE   KV                                 PK+M GWL +Y S +
Sbjct  181  SSNADDENTPKVEDSWLKIFASSLCKPCGVNGDNSKSSSDDDENEPKIMDGWLKIYVSSN  240

Query  599  PNSRFTTLSAREQL  640
            PNS FT LSAREQL
Sbjct  241  PNSPFTKLSAREQL  254



>gb|KJB71435.1| hypothetical protein B456_011G123300 [Gossypium raimondii]
Length=416

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 161/210 (77%), Gaps = 9/210 (4%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EP+W +LLG +NW+ LLDPL+LSLR LILRCGDFCQATYD+FNND NSK+ GS RYGK 
Sbjct  7    AEPSWQELLGCKNWDSLLDPLHLSLRKLILRCGDFCQATYDAFNNDQNSKFCGSSRYGKS  66

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFF KVML SA DY+VE++LYATA + +P+AFLLHS SRESWDRE+NWIGY+A TSD  S
Sbjct  67   SFFDKVMLESASDYKVESFLYATAHVTLPQAFLLHSRSRESWDRETNWIGYIATTSDETS  126

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR--SITNGDKG-------DEEDDK  550
            KALGRR+IYVV+RGTT D EW+NV  AK    E LLR    +N + G        + +++
Sbjct  127  KALGRRDIYVVWRGTTRDYEWVNVLDAKLEPLEPLLRVDGSSNKEMGDSSSDSDSDNENE  186

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             PKVM GWLT+Y S DP S FT LSAREQL
Sbjct  187  KPKVMLGWLTIYISDDPKSPFTKLSAREQL  216



>ref|XP_010276983.1| PREDICTED: phospholipase A1-IIdelta [Nelumbo nucifera]
Length=428

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 162/224 (72%), Gaps = 24/224 (11%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            EPTW +LLGS+ WEGLLDPLNLSLR LILRCGD CQATYD+FN+D  SKY GS RYGKRS
Sbjct  7    EPTWAELLGSKQWEGLLDPLNLSLRRLILRCGDLCQATYDAFNSDPRSKYCGSSRYGKRS  66

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS-  397
            FF KV    A DY+V A+LYAT+++ VP+AFLLHSLSRE+WDRESNWIGY+AVTSD VS 
Sbjct  67   FFEKVKFQPASDYEVAAFLYATSRVDVPQAFLLHSLSREAWDRESNWIGYIAVTSDHVSK  126

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT--------------------  517
            K LGRREIYV +RGTT + EWI+V  AKP S +SLL S T                    
Sbjct  127  KVLGRREIYVAWRGTTRNYEWIDVADAKPKSIKSLLNSQTQDHTQQQSHWYDLILDRVHD  186

Query  518  --NGDKGD-EEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              +GD  D EE+D+ PKVM GW T+YTS DP S FT LSAR Q 
Sbjct  187  NGSGDSSDEEEEDRTPKVMKGWFTIYTSNDPKSPFTKLSARAQF  230



>ref|XP_007048713.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92870.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=420

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 160/213 (75%), Gaps = 13/213 (6%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            EP+W QLLGS+NW+ LL P+NLSLR  ILRCGDFCQATYD+FNND NSK+ G+ RYGK +
Sbjct  8    EPSWQQLLGSKNWDSLLHPINLSLRKHILRCGDFCQATYDAFNNDQNSKFCGTSRYGKPT  67

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF KVML SA DY+VE++LYATA++ +PEAFLLHS SRESWDRESNWIGY+A TSD  ++
Sbjct  68   FFDKVMLESASDYRVESFLYATARVSLPEAFLLHSKSRESWDRESNWIGYIATTSDERTE  127

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEED------------  544
            ALGRREIYVV+RGTT D EW+NV  AK  SA+ LLR   N    ++E             
Sbjct  128  ALGRREIYVVWRGTTRDYEWVNVLGAKLESAKPLLRVNENTSSTNKEKDDTSSSSDSDDD  187

Query  545  -DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             +K PKVM GWLT+Y S DP S FT +SAR QL
Sbjct  188  SEKKPKVMLGWLTIYISDDPKSPFTKVSARTQL  220



>gb|EYU41122.1| hypothetical protein MIMGU_mgv1a021036mg [Erythranthe guttata]
Length=418

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 163/210 (78%), Gaps = 10/210 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +EPTW +LLGS NWE LLDPL+LSLR LILRCGDFCQATYD+FNND NSK+ G+ RYGK+
Sbjct  11   SEPTWAELLGSNNWETLLDPLDLSLRRLILRCGDFCQATYDAFNNDVNSKFTGTSRYGKK  70

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFF KVML SA +YQV  +LYATAK+   EA  LHSLSRESWDRESNWIGY+A TSD +S
Sbjct  71   SFFDKVMLDSAANYQVHCFLYATAKVGTGEALFLHSLSRESWDRESNWIGYIATTSDELS  130

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDK---------GDEEDDK  550
            ++ GRREIYVV+RGTT + EW+NV  A+P SA+ LLR   N DK          D++D+ 
Sbjct  131  RSSGRREIYVVWRGTTRNYEWVNVLGARPESAQELLRP-KNWDKKTPDDNDSDDDDDDEG  189

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            VP+VM GWLT+Y S DPNS FT LSAR QL
Sbjct  190  VPRVMNGWLTIYMSTDPNSSFTKLSARTQL  219



>ref|XP_004243279.1| PREDICTED: phospholipase A1-IIdelta [Solanum lycopersicum]
Length=469

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 153/203 (75%), Gaps = 3/203 (1%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M  EPTWH+LLGS NWEGLL+PL+L+LR LILRCGDFCQATYD+FNND  S Y GS RYG
Sbjct  1    MGKEPTWHELLGSNNWEGLLEPLHLNLRRLILRCGDFCQATYDAFNNDEYSMYCGSSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K S FHKVM  SA DYQ+ ++LYATA++   +A  LHSLSRESWDRESNWIG++A+T+D 
Sbjct  61   KSSLFHKVMFKSASDYQIVSFLYATARVGAHKALFLHSLSRESWDRESNWIGFIAITNDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
            +S+ LGRREIY+ FRGTT + EW+NV  A+  SAE L   I NG     +D+  P+VM G
Sbjct  121  ISEQLGRREIYIAFRGTTRNYEWVNVLGARSESAEPL---ICNGGSICNDDENAPRVMNG  177

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            WL +Y S DP S FT LS R QL
Sbjct  178  WLKIYISSDPKSPFTRLSIRAQL  200



>ref|XP_007132834.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132835.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132836.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04828.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04829.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04830.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
Length=414

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 158/214 (74%), Gaps = 11/214 (5%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MA++PTW +LLG  NW GLLDPL+ +LR LILRCGDF QATYD+FNND NS + GS RYG
Sbjct  1    MASQPTWAELLGHNNWAGLLDPLHPALRSLILRCGDFIQATYDAFNNDKNSPFCGSSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML +AD Y V A+LYATA++ VPEAFLLHSLSRE+WDRESNWIGYVAVTS+ 
Sbjct  61   KTSFFRKVMLDNADHYDVTAFLYATARVSVPEAFLLHSLSREAWDRESNWIGYVAVTSER  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-----------RSITNGDKGDE  538
             SK LGRREIYVV+RGTT D+EWINVF A   SA  LL           +   +    D+
Sbjct  121  RSKELGRREIYVVWRGTTRDMEWINVFGAGQESASVLLNAESVKELKARKKDGSSSSDDD  180

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            E+   PKVM GWLT+YTS DP S FT  SAR Q+
Sbjct  181  ENSGTPKVMLGWLTIYTSDDPKSPFTKSSARTQV  214



>ref|XP_004251807.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum lycopersicum]
Length=410

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M  E TWH+LLGS++W+GLL PLNL LR LILRCGDFCQATYD+FNND NSKY G+ RYG
Sbjct  1    MEKEATWHELLGSKDWDGLLQPLNLPLRRLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML S+ DY++  +LYATAK+   EA  LHSLSRESWDRESNWIGY+AVT+D 
Sbjct  61   KSSFFDKVMLESSTDYKIYCFLYATAKIGALEAIFLHSLSRESWDRESNWIGYIAVTTDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL--RSITNGDKGDEEDDKVP---  556
            VS+ LGRRE+YVVFRGT+ + EW+NV  A+P SA+SLL  +S+  G     ++D+     
Sbjct  121  VSRKLGRREVYVVFRGTSRNYEWVNVLGARPDSADSLLHPKSLQKGINNKNDEDEDEDED  180

Query  557  --KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              KVM GWL +Y S +P S FT LSAREQL
Sbjct  181  EIKVMDGWLKIYVSSNPKSSFTRLSAREQL  210



>ref|XP_009766306.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana sylvestris]
Length=470

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 166/271 (61%), Gaps = 68/271 (25%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M TE TWH+LLGS NWEGLL+PLNL+LR LILRCGDFCQATYD+FNND NSKY G+ RYG
Sbjct  1    METETTWHELLGSNNWEGLLEPLNLNLRQLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K+SFF KVML SA +Y++  +LYATA++    A  LHSLSRE+WDRESNWIGY+AVT+D 
Sbjct  61   KKSFFQKVMLESASNYKISGFLYATARISALGAIFLHSLSREAWDRESNWIGYIAVTTDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR--------------SITNGDK  529
            VS+ LGRREIYV FRGTT + EWINV  A+P SA+SLLR                +NGD 
Sbjct  121  VSQELGRREIYVAFRGTTRNYEWINVLGARPESADSLLRPKSLQKIGVNGDNSKSSNGDD  180

Query  530  G------------DEEDDKV----------------------------------------  553
            G            DE + KV                                        
Sbjct  181  GVSGDNSKNSKDDDENEPKVEDGWFKIFASSLCKPLLRPKSLQKSGVNGDNSKSSSDDDE  240

Query  554  --PKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              PKVM GWL +Y S +PNS FT LSAREQL
Sbjct  241  NEPKVMDGWLKIYVSSNPNSPFTKLSAREQL  271



>ref|XP_006350025.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=412

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            M  EPTWH+LLGS++W+GLL PLNL LR LILRCGDFCQATYD+FNND NSKY G+ RYG
Sbjct  1    MEKEPTWHELLGSKDWDGLLQPLNLPLRRLILRCGDFCQATYDAFNNDQNSKYCGTSRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF+KVML S+ DY++  +LYATAK+   EA  LHSLSRESWDRESNWIGY+A+T+D 
Sbjct  61   KSSFFNKVMLESSTDYKIYCFLYATAKIGALEAIFLHSLSRESWDRESNWIGYIAITTDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL--RSITNGDKGDEEDDKVP---  556
            VS+ LGRRE+YVVFRGT    EWINV  A+P SA+ LL  +S+  G     ++ +     
Sbjct  121  VSRKLGRREVYVVFRGTARSYEWINVLGARPDSADPLLHPKSLQKGVNNKNDEGEDEDED  180

Query  557  ----KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
                KVM GWL +Y S +P S FT LSAREQL
Sbjct  181  EDEVKVMDGWLKIYVSSNPKSPFTRLSAREQL  212



>ref|XP_007217233.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
 gb|EMJ18432.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
Length=455

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 163/228 (71%), Gaps = 24/228 (11%)
 Frame = +2

Query  29   SMATEPT---WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGS  199
            SMAT  T   W +LLG+ NW GLLDPL+L+LR LILRCGDFCQATYD+FNND NSKY GS
Sbjct  27   SMATSETQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGS  86

Query  200  CRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAV  379
             RYGK SFF KV+L  A  YQV  +LYATA++ VPEA LLHS SRESWDRESNWIGY+AV
Sbjct  87   SRYGKASFFDKVVLQDASSYQVSCFLYATAEVSVPEALLLHSQSRESWDRESNWIGYIAV  146

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR------SITNGD-----  526
            T+DAVSKA+GRREIYV +RGT  + EW+NV  A   SA +LLR      S+TN       
Sbjct  147  TTDAVSKAIGRREIYVAWRGTIRNYEWVNVLGADLDSAAALLRSHESNPSLTNDQTDGGH  206

Query  527  ----------KGDEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
                         E+D+KVPKVM GWL++YTS D  S FT LSAR+QL
Sbjct  207  GSNSSSSSDDGKGEDDEKVPKVMRGWLSMYTSSDSKSPFTKLSARDQL  254



>ref|XP_006446810.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
 gb|ESR60050.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
Length=416

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 159/206 (77%), Gaps = 9/206 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS NW GLLDPL+LSLR L+LRCGDF QATYD+FNND NSKY G+ RYGKR FF 
Sbjct  12   WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRGFFD  71

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML +A DYQV ++LY TA++ VPEAFL+HSLSRESWDRESNWIGY+AVTSD  SKA+G
Sbjct  72   KVMLQNAPDYQVFSFLYGTARVSVPEAFLVHSLSRESWDRESNWIGYIAVTSDERSKAIG  131

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLL---------RSITNGDKGDEEDDKVPKV  562
            RREIYV +RGTT + EWINV  A+  S  S+L         ++ T+     ++D+ VPKV
Sbjct  132  RREIYVAWRGTTRNYEWINVLGAQQASVGSILNKSKFRVEEKNDTDSSSDSDDDETVPKV  191

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
            M GWLT+YTS+DP S FT LSAR QL
Sbjct  192  MQGWLTIYTSEDPKSSFTKLSARAQL  217



>emb|CDO98286.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 157/214 (73%), Gaps = 10/214 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S   EP W +LLGS  WEGLLDPL+ SLR LILRCGDFCQATYD+FNND NSK+ GS RY
Sbjct  5    STGGEPAWPELLGSNGWEGLLDPLDDSLRGLILRCGDFCQATYDAFNNDQNSKFCGSSRY  64

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK+SFF KVML S  +YQV  ++YATA++   +A  L SLSRESWDRESNWIGY+AVT+D
Sbjct  65   GKKSFFEKVMLESGSNYQVIGFIYATAQIGAHKAIFLRSLSRESWDRESNWIGYIAVTTD  124

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR----------SITNGDKGDE  538
              S+A+GRRE+Y+ FRGTT + EWI+V  A   SAE LLR          S++  D   +
Sbjct  125  EYSQAIGRREVYIAFRGTTRNYEWIDVLGAGLKSAEPLLRPKAWKKREDGSVSTSDSDGD  184

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +++K+PKVM GWL +Y S DP S FT LSAREQL
Sbjct  185  DEEKMPKVMQGWLKIYVSSDPKSPFTYLSAREQL  218



>ref|XP_007048712.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92869.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=411

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 159/211 (75%), Gaps = 7/211 (3%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            + A EP+W +L+GS +WE LLDPLNLSLR L+LRCGDFCQATYDSF ND NSKY G+ RY
Sbjct  3    TTAQEPSWEELIGSNDWESLLDPLNLSLRKLLLRCGDFCQATYDSFVNDQNSKYCGTSRY  62

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK + F KVML SA DY +  +LYATA++ VPE+ LLHS SRESWDRESNWIGY+AVTSD
Sbjct  63   GKSTLFEKVMLDSASDYVITNFLYATARVSVPESLLLHSHSRESWDRESNWIGYIAVTSD  122

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-------RSITNGDKGDEEDD  547
              SKALGRREIYVV+RGTT D EW+NVF  KP SAE LL            G   ++E  
Sbjct  123  ERSKALGRREIYVVWRGTTRDYEWVNVFKGKPESAECLLNDKFGDSEQNKQGKSSNDESQ  182

Query  548  KVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            + P VMFGWLTLYTS DP S FT LSAR+QL
Sbjct  183  QTPNVMFGWLTLYTSDDPKSPFTKLSARKQL  213



>gb|KDO63393.1| hypothetical protein CISIN_1g014927mg [Citrus sinensis]
Length=416

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 160/206 (78%), Gaps = 9/206 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS NW GLLDPL+LSLR L+LRCGDF QATYD+FNND NSKY G+ RYGKR+FF 
Sbjct  12   WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML +A DYQV ++LY TA++ +PEAFL+HSLSRESWDRESNWIGY+AVTSD   KA+G
Sbjct  72   KVMLQNAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAVTSDERLKAIG  131

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLL---------RSITNGDKGDEEDDKVPKV  562
            RREIYV +RGTT + EW+NV  A+  S  S+L         ++ T+     ++D+ VPKV
Sbjct  132  RREIYVAWRGTTRNYEWVNVLGAQQASVGSILNKSKFRVEEKNDTDSSSDCDDDETVPKV  191

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
            M GWLT+YTS+DPNS FT LSAR QL
Sbjct  192  MQGWLTIYTSEDPNSSFTKLSARAQL  217



>ref|XP_006468997.1| PREDICTED: phospholipase A1-IIdelta-like [Citrus sinensis]
Length=416

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 160/206 (78%), Gaps = 9/206 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLG+ NW GLLDPL+LSLR LILRCGDF QATYD+FNND NSKY G+ RYGKR+FF 
Sbjct  12   WPELLGNNNWNGLLDPLDLSLRKLILRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML +A DYQV ++LY TA++ +PEAFL+HSLSRESWDRESNWIGY+AVTSD   KA+G
Sbjct  72   KVMLQNAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAVTSDERLKAIG  131

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLL---------RSITNGDKGDEEDDKVPKV  562
            RREIYV +RGTT + EW+NV  A+  S  S+L         ++ T+     ++D+ VPKV
Sbjct  132  RREIYVAWRGTTRNYEWVNVLGAQQASVGSILNKSKFRVEEKNDTDSSSDCDDDETVPKV  191

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
            M GWLT+YTS+DPNS FT LSAR QL
Sbjct  192  MQGWLTIYTSEDPNSSFTKLSARAQL  217



>ref|XP_008228927.1| PREDICTED: phospholipase A1-IIdelta [Prunus mume]
Length=455

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 157/220 (71%), Gaps = 19/220 (9%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            T+  W +LLG+ NW GLLDPL+L+LR LILRCGDFCQATYD+FNND NSKY GS RYGK 
Sbjct  35   TQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGSSRYGKA  94

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFF KV+L  A  YQV  +LYATA++ VPEA LLHS SRESWDRESNWIGY+AVT+DAVS
Sbjct  95   SFFDKVVLQDASSYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDAVS  154

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRS----------ITNGDKGDEEDD  547
            KA+GRREIYV +RGT  + EWINV  A   SA  LLRS           T+G  G   + 
Sbjct  155  KAIGRREIYVAWRGTIRNYEWINVLGADLDSAAVLLRSHESNPSLTNDQTDGGHGGSSNS  214

Query  548  ---------KVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
                     K PKVM GWL++YTS DP S FT LSAR+QL
Sbjct  215  DDGKDEDDEKDPKVMRGWLSMYTSSDPKSPFTKLSARDQL  254



>ref|XP_010508539.1| PREDICTED: phospholipase A1-IIdelta isoform X1 [Camelina sativa]
 ref|XP_010508540.1| PREDICTED: phospholipase A1-IIdelta isoform X2 [Camelina sativa]
 ref|XP_010508541.1| PREDICTED: phospholipase A1-IIdelta isoform X3 [Camelina sativa]
Length=410

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 155/212 (73%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML SA DY+V ++LYATA++ +P+  LL S SR++WDRESNW GY+AVTSD 
Sbjct  61   KSSFFEKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG---------DEED  544
             +KALGRREIYV  RGT+ + EW+NV  A+  SA+ LLR     D G         D ED
Sbjct  121  RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSGVVEGTTFDSDSED  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQL  212



>ref|XP_004303191.1| PREDICTED: phospholipase A1-IIdelta [Fragaria vesca subsp. vesca]
Length=453

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 159/214 (74%), Gaps = 15/214 (7%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            P W  L+G  NW GLLDPL++ LR LILRCGDFCQ TYD+FNND+NSKYAGS RYG  +F
Sbjct  41   PAWSALVGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYGHANF  100

Query  224  FHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            F KVML  A +Y++ ++LYATA++ VPEAFLLHSLSRESWDRESNWIGYVAVT+D  SK+
Sbjct  101  FDKVMLQDAANYEIASFLYATAQVSVPEAFLLHSLSRESWDRESNWIGYVAVTTDQYSKS  160

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNG-------DKGDE--------  538
            +GRREIYV +RGTT + EW+NV  A+ VSAE LL+   N          G E        
Sbjct  161  IGRREIYVAWRGTTRNYEWVNVLGAELVSAEQLLKPENNNTVNKDLTQTGAEVSSSDEEE  220

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            EDDK+PKVM GWL++YTS D  S FT LSAR+QL
Sbjct  221  EDDKIPKVMRGWLSMYTSDDSKSAFTKLSARDQL  254



>gb|KFK37116.1| hypothetical protein AALP_AA4G215000 [Arabis alpina]
Length=346

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 153/217 (71%), Gaps = 14/217 (6%)
 Frame = +2

Query  32   MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            MAT  T W +LLGS+NW+ LLDPL+LSLR LILRCGDFCQ TYD+F ND NSKY G+ RY
Sbjct  1    MATTTTSWEELLGSKNWDTLLDPLDLSLRQLILRCGDFCQVTYDAFVNDENSKYCGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK S F KVML SA  Y V ++LYATA++ +PE  LLHS SR++WDRESNW GY+AVTSD
Sbjct  61   GKSSLFDKVMLESASHYVVTSFLYATARVSLPEGLLLHSQSRDAWDRESNWFGYIAVTSD  120

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG------------  532
              SKALGRREIYV  RGT+ + EWINV  A+P SAE LL+       G            
Sbjct  121  ERSKALGRREIYVALRGTSRNYEWINVLGARPTSAEPLLKGPEQTSSGSGVVGAGTTTFG  180

Query  533  -DEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             D ED++  KVM GWLT+YTS   +S+FT LS R QL
Sbjct  181  SDSEDEEGCKVMLGWLTIYTSDHADSKFTKLSLRAQL  217



>ref|XP_010506105.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=410

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 153/212 (72%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML S  DY+V ++LYATA++ +P+  LL S SR++WDRESNW GY+AVTSD 
Sbjct  61   KSSFFEKVMLESPSDYEVTSFLYATARVTLPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG---------DEED  544
             +KALGRREIYV  RGT+ + EW+NV  A+  SA+ LLR     D           D ED
Sbjct  121  RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQL  212



>gb|ACJ85535.1| unknown [Medicago truncatula]
Length=435

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 160/215 (74%), Gaps = 15/215 (7%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            + TW+QLLG+ NWE LL+PL+L+LR+LILRCGDF Q TYDSFNND NS Y GS RYGK S
Sbjct  29   QETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQNSIYCGSSRYGKTS  88

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF+KVML +   Y V ++LYATA++ VPEAF+LHSLSRESWDRESNWIGY+AV+SD  S+
Sbjct  89   FFNKVMLENPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRESNWIGYIAVSSDERSR  148

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT--------NGDK-------GD  535
             LGRREIYVV+RGTT DLEWINVF A P SA  LL + +        N +K        D
Sbjct  149  ELGRREIYVVWRGTTRDLEWINVFGAAPESASGLLSAKSLREFNLPNNNNKDDGSSSSDD  208

Query  536  EEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            E+D  VPK+M GWLT+YTS DP S FT  S R Q+
Sbjct  209  EDDKSVPKIMKGWLTIYTSDDPKSPFTKTSVRTQV  243



>ref|XP_003607601.1| Feruloyl esterase A [Medicago truncatula]
 gb|AES89798.1| phospholipase A1 [Medicago truncatula]
Length=442

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 160/215 (74%), Gaps = 15/215 (7%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            + TW+QLLG+ NWE LL+PL+L+LR+LILRCGDF Q TYDSFNND NS Y GS RYGK S
Sbjct  29   QETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQNSIYCGSSRYGKTS  88

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF+KVML +   Y V ++LYATA++ VPEAF+LHSLSRESWDRESNWIGY+AV+SD  S+
Sbjct  89   FFNKVMLENPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRESNWIGYIAVSSDERSR  148

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSIT--------NGDK-------GD  535
             LGRREIYVV+RGTT DLEWINVF A P SA  LL + +        N +K        D
Sbjct  149  ELGRREIYVVWRGTTRDLEWINVFGAAPESASGLLSAKSLREFNLPNNNNKDDGSSSSDD  208

Query  536  EEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            E+D  VPK+M GWLT+YTS DP S FT  S R Q+
Sbjct  209  EDDKSVPKIMKGWLTIYTSDDPKSPFTKTSVRTQV  243



>ref|XP_002881867.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58126.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTTSWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML SA  Y+V  +LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD 
Sbjct  61   KSSFFDKVMLESASAYEVANFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSI-TNGDKG---------DEE  541
             +KALGRREIY+  RGT+ + EW+NV  A+P SA+ LL     +G  G         D E
Sbjct  121  RTKALGRREIYIAMRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSAGVVEGTTFDSDSE  180

Query  542  DDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            D++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  DEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQL  213



>dbj|BAH56866.1| AT2G42690 [Arabidopsis thaliana]
Length=384

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 153/214 (71%), Gaps = 11/214 (5%)
 Frame = +2

Query  32   MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            MAT  T W +LLGS+NW+ +LDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RY
Sbjct  1    MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK SFF KVML +A DY+V  +LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD
Sbjct  61   GKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSD  120

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG----------DE  538
              SKALGRREIY+  RGT+ + EW+NV  A+P SA+ LL        G          D 
Sbjct  121  ERSKALGRREIYIALRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSGGVVEGTTFDSDS  180

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ED++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EDEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQL  214



>ref|XP_004505480.1| PREDICTED: phospholipase A1-IIdelta-like [Cicer arietinum]
Length=480

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 156/217 (72%), Gaps = 15/217 (7%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
             TEPTW+QLLG+ NWEGLL+P N+ LR+LILRCGDF Q TYD+FNND NS Y GS RYGK
Sbjct  65   TTEPTWNQLLGTNNWEGLLNPPNIHLRNLILRCGDFIQTTYDAFNNDQNSIYCGSSRYGK  124

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             SFFHKVML +   Y V  +LYATA++ VPEAF+L S SRESWDRESNWIGY+AV+SD  
Sbjct  125  SSFFHKVMLENPTHYTVVTFLYATARVSVPEAFILRSRSRESWDRESNWIGYIAVSSDER  184

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGD---------------K  529
            +K LGRREIYVV+RGTT D EWINVF A P SA  LL + T  +                
Sbjct  185  TKELGRREIYVVWRGTTRDYEWINVFGAAPESASGLLSAKTLSEFNLSNNKNGDSSSSSS  244

Query  530  GDEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             DE+D+ +PKVM GWLT+YTS DP S FT  S R Q+
Sbjct  245  DDEDDNNMPKVMKGWLTIYTSDDPKSPFTKTSVRTQV  281



>ref|NP_181797.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
 sp|Q9SJI7.1|PLA20_ARATH RecName: Full=Phospholipase A1-IIdelta [Arabidopsis thaliana]
 gb|AAD21737.1| putative lipase [Arabidopsis thaliana]
 gb|AAK93675.1| putative lipase [Arabidopsis thaliana]
 gb|AAL85087.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15382.1| putative lipase [Arabidopsis thaliana]
 gb|AEC10156.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
Length=412

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 153/214 (71%), Gaps = 11/214 (5%)
 Frame = +2

Query  32   MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            MAT  T W +LLGS+NW+ +LDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RY
Sbjct  1    MATTTTSWEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK SFF KVML +A DY+V  +LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD
Sbjct  61   GKSSFFDKVMLENASDYEVVNFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAVTSD  120

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG----------DE  538
              SKALGRREIY+  RGT+ + EW+NV  A+P SA+ LL        G          D 
Sbjct  121  ERSKALGRREIYIALRGTSRNYEWVNVLGARPTSADPLLHGPEQDGSGGVVEGTTFDSDS  180

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ED++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EDEEGCKVMLGWLTIYTSNHPESKFTKLSLRSQL  214



>ref|XP_002281095.2| PREDICTED: phospholipase A1-IIdelta [Vitis vinifera]
Length=470

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 162/221 (73%), Gaps = 9/221 (4%)
 Frame = +2

Query  5    LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNS  184
             K+ +   +  ++P+  Q+LGS NWEGLL+PLNLSLR LI+RCGDFCQ TYDSF ND NS
Sbjct  46   FKAPVTMGTSQSQPSLDQILGSNNWEGLLEPLNLSLRELIIRCGDFCQVTYDSFINDQNS  105

Query  185  KYAGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWI  364
            +Y G+CRYG +    KVML  A DY+V AYLYATA++ VPEAF+LHS+SRESWDRESNWI
Sbjct  106  RYCGACRYGMKFLLEKVMLIGASDYEVSAYLYATARVSVPEAFILHSMSRESWDRESNWI  165

Query  365  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR---SITN-----  520
            GY+AVT+D VS+A GRREIYV +RGTT D EW++V  A+  SAE LLR    I N     
Sbjct  166  GYIAVTTDEVSRARGRREIYVAWRGTTRDYEWVDVLGAELESAEELLRPQEGIKNEEGSS  225

Query  521  -GDKGDEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              D  DE+D+K  KVM GW T+YTS DP S FT  SAR+Q 
Sbjct  226  SSDSDDEDDEKNVKVMRGWFTIYTSGDPRSPFTKASARKQF  266



>ref|XP_009142078.1| PREDICTED: phospholipase A1-IIdelta [Brassica rapa]
Length=413

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 151/215 (70%), Gaps = 12/215 (6%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYDSF ND NSKY G+ RYG
Sbjct  1    MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDSFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML +A DYQV ++LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD 
Sbjct  61   KSSFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG------------D  535
             SK+LGRREIYV  RGT+ + EWINV  A+P SA+ LL        G            D
Sbjct  121  RSKSLGRREIYVALRGTSRNYEWINVLGARPTSADPLLTGPEQNGSGSKVVETLSTHGSD  180

Query  536  EEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             ED++  KVM GWLT+YTS    S+FT +S R QL
Sbjct  181  SEDEEGCKVMLGWLTIYTSDHAESKFTKMSLRLQL  215



>gb|KDP47123.1| hypothetical protein JCGZ_22119 [Jatropha curcas]
Length=416

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 154/207 (74%), Gaps = 14/207 (7%)
 Frame = +2

Query  56   QLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFHKV  235
            ++LGS +W+ LL+PL+L LR LILRCGDFCQATYD+FNND NS Y G+ RYGK SFFHKV
Sbjct  13   EILGSNDWKNLLEPLDLDLRKLILRCGDFCQATYDAFNNDQNSPYCGTSRYGKNSFFHKV  72

Query  236  MLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALGRR  415
            ML  A++Y V ++LY TA++ +PEAFLLHS SRESWDRESNWIGY+AVTSD  +K +GRR
Sbjct  73   MLEDAENYTVSSFLYGTARVSLPEAFLLHSQSRESWDRESNWIGYIAVTSDEYTKVIGRR  132

Query  416  EIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDK------------GDEEDDKVPK  559
            EIY+ FRGTT + EW+++  AK  SA+ LL+  +N  K            GD E  K PK
Sbjct  133  EIYIAFRGTTRNYEWVDILGAKLTSAKPLLKGSSNEFKENNNSSSDSDSEGDHE--KFPK  190

Query  560  VMFGWLTLYTSKDPNSRFTTLSAREQL  640
            VM GW+T+YTS D  S FT +SAR+QL
Sbjct  191  VMLGWITIYTSDDSRSPFTKISARDQL  217



>ref|XP_006294314.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
 gb|EOA27212.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
Length=410

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 152/212 (72%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTASWEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML SA DY+V  +LYATA++ +P+  LL S SR+SWDRESNW GY+AVTSD 
Sbjct  61   KSSFFDKVMLESASDYEVTNFLYATARVSLPQGLLLSSQSRDSWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG---------DEED  544
             +KALGRREIYV  RGT+ + EW+NV   +  SA+ LLR       G         D ED
Sbjct  121  RTKALGRREIYVALRGTSRNYEWVNVLGFRSTSADPLLRGPEQDGSGVVEGTTFDDDSED  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++  +VM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EEGCRVMLGWLTIYTSTHPESKFTNLSLRSQL  212



>ref|XP_010517807.1| PREDICTED: phospholipase A1-IIdelta-like isoform X2 [Camelina 
sativa]
Length=410

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 153/212 (72%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +  +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTTSCEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML SA DY+V ++LYATA++ +P+  LL S SR++WDRESNW GY+AVTSD 
Sbjct  61   KSSFFDKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG---------DEED  544
             +KALGRREIYV  RGT+ + EW+NV  A+  SA+ LLR     D           D ED
Sbjct  121  RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQL  212



>ref|XP_010517806.1| PREDICTED: phospholipase A1-IIdelta-like isoform X1 [Camelina 
sativa]
Length=410

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 153/212 (72%), Gaps = 9/212 (4%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MAT  +  +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F ND NSKY G+ RYG
Sbjct  1    MATTTSCEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYG  60

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            K SFF KVML SA DY+V ++LYATA++ +P+  LL S SR++WDRESNW GY+AVTSD 
Sbjct  61   KSSFFDKVMLESASDYEVVSFLYATARVALPQGLLLGSQSRDAWDRESNWFGYIAVTSDE  120

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG---------DEED  544
             +KALGRREIYV  RGT+ + EW+NV  A+  SA+ LLR     D           D ED
Sbjct  121  RTKALGRREIYVALRGTSRNYEWVNVLGARSTSADPLLRGPEKDDSAVVEGTTFDSDSED  180

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++  KVM GWLT+YTS  P S+FT LS R QL
Sbjct  181  EEGCKVMLGWLTIYTSNQPESKFTKLSLRSQL  212



>gb|EPS65213.1| hypothetical protein M569_09566 [Genlisea aurea]
Length=410

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            T  +W ++LG ++W+GLLDPL+ SLR  ILRCGD CQATYD+FNND NS YAGSCRYGK+
Sbjct  6    TAVSWEEILGGKDWDGLLDPLDDSLRLFILRCGDLCQATYDAFNNDENSGYAGSCRYGKK  65

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFF KV  P+ DDY V   LYA A++   EA    S SRESWDRESNWIG++AVT D VS
Sbjct  66   SFFRKVTFPNPDDYYVAGNLYAAARVSRLEALFFRSKSRESWDRESNWIGFIAVTGDDVS  125

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDK--GDEEDDKVPKVMFG  571
            + LGRREIYVV+RGTT   EWI+   AKP  A+ LLR   N D      +D+ VPKVM G
Sbjct  126  RTLGRREIYVVWRGTTRSYEWIDDMGAKPARADVLLRGNENRDAMIAGNDDEAVPKVMIG  185

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            WL++YT+ DP S FT LSAR+Q+
Sbjct  186  WLSVYTTSDPKSAFTALSARDQV  208



>ref|XP_008343100.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 154/205 (75%), Gaps = 7/205 (3%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W +LLGS NW+GLLDPL+L+LR  ILRCG+FCQATYD+FNND NSKY GS RYGK SFF
Sbjct  13   AWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFF  72

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             KVML  A +YQV  +LYATA++ VPEA LLHS SRESWDRESNWIGY+AVT+D VSKA+
Sbjct  73   DKVMLQDAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDEVSKAI  132

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-RSITNGDKGD------EEDDKVPKVM  565
            GRREIYV +RGT  + EWIN   A+  S E++L  S  NG +        E++++VPK M
Sbjct  133  GRREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXDKDDDEDEEEVPKAM  192

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GWLT+Y S DP S FT  SAR QL
Sbjct  193  RGWLTMYISNDPKSPFTKTSARVQL  217



>ref|XP_006411537.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
 gb|ESQ52990.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
Length=416

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 15/218 (7%)
 Frame = +2

Query  32   MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            MAT  T W +LLGS+NW+ LL+P + SLR LILRCGDFCQATYD+F ND NSKY G+ RY
Sbjct  1    MATTATPWEELLGSKNWDTLLEPFDQSLRQLILRCGDFCQATYDAFVNDQNSKYCGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK SFF KVML SA DY+V ++LYATA++ +P+  LLHS SR+SWDRESNW GY+AVTSD
Sbjct  61   GKSSFFDKVMLESASDYEVTSFLYATARVALPQGLLLHSQSRDSWDRESNWFGYIAVTSD  120

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL----RSITNGDKG--------  532
              +KALGRREIYV  RGT+ + EWINV  A+  SA+ LL    ++ +  D G        
Sbjct  121  ERTKALGRREIYVALRGTSRNYEWINVLGARLTSADPLLHGPEQNASGSDSGVVGAASTY  180

Query  533  --DEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              D ED++  KVM GWLT+YTS++P S FT LS R QL
Sbjct  181  SSDSEDEEGCKVMLGWLTIYTSENPESEFTRLSLRLQL  218



>ref|XP_008353849.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 154/205 (75%), Gaps = 7/205 (3%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W +LLGS NW+GLLDPL+L+LR  ILRCG+FCQATYD+FNND NSKY GS RYGK SFF
Sbjct  13   AWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFF  72

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             KVML  A +YQV  +LYATA++ VPEA LLHS SRESWDRESNWIGY+AVT+D VSKA+
Sbjct  73   DKVMLQDAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAVTTDEVSKAI  132

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-RSITNGDKGD------EEDDKVPKVM  565
            GRREIYV +RGT  + EWIN   A+  S E++L  S  NG +        E++++VPK M
Sbjct  133  GRREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXDKDDDEDEEEVPKAM  192

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GWLT+Y S DP S FT  SAR QL
Sbjct  193  RGWLTMYISNDPKSPFTKTSARVQL  217



>gb|KFK37117.1| hypothetical protein AALP_AA4G215100 [Arabis alpina]
Length=414

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 152/217 (70%), Gaps = 14/217 (6%)
 Frame = +2

Query  32   MATEPT-WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            MAT  T W +LLGS+NW+ LLDPL+LSLR LILRCGDFCQA+YD+F  D  SKY G+ RY
Sbjct  1    MATTTTSWEELLGSKNWDTLLDPLDLSLRQLILRCGDFCQASYDAFVKDQKSKYCGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK SFF KVML SA DY+V  +LYATA++ +P+  LLHS S +SWDRESN+ GY+AVTSD
Sbjct  61   GKSSFFDKVMLESASDYEVTTFLYATARVDLPKGLLLHSQSTDSWDRESNFFGYIAVTSD  120

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKG------------  532
              +KA+GRREIYV  RGT+ + EWINV  A+P SAE LL        G            
Sbjct  121  ERTKAIGRREIYVAMRGTSRNHEWINVLGARPTSAEPLLHGPDENGSGSGVVGAATSTYD  180

Query  533  -DEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             D ED++  KVM GWLT+YTS  P S+FT +S R QL
Sbjct  181  SDSEDEEGCKVMLGWLTIYTSHHPGSKFTKVSLRAQL  217



>ref|XP_010104406.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00251.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=400

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 8/201 (4%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +EPTW +LLG+ NW+GLLDPL+L+LR LILRCGDFCQ TYD+FN+D NSKY G+ RYGK 
Sbjct  6    SEPTWEELLGANNWDGLLDPLDLALRKLILRCGDFCQVTYDAFNSDQNSKYCGASRYGKS  65

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            S F  V  P+A  Y V ++LYATA++ VPEA LLHS SR+SWDRESNW+GY+AVT+D+VS
Sbjct  66   SIFRAVFFPNASSYDVVSFLYATARISVPEALLLHSRSRDSWDRESNWMGYIAVTTDSVS  125

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
            ++L RREI+V +RGT  D EWINV  A   SA+ LL    N D  D +     KVM GWL
Sbjct  126  RSLSRREIHVAWRGTIRDYEWINVLGADQDSAKPLL----NKDSTDHD----AKVMRGWL  177

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YTS + NS F   SAR QL
Sbjct  178  TIYTSNNLNSPFVKTSARVQL  198



>emb|CBI21996.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 154/212 (73%), Gaps = 12/212 (6%)
 Frame = +2

Query  5    LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNS  184
             K+ +   +  ++P+  Q+LGS NWEGLL+PLNLSLR LI+RCGDFCQ TYDSF ND NS
Sbjct  80   FKAPVTMGTSQSQPSLDQILGSNNWEGLLEPLNLSLRELIIRCGDFCQVTYDSFINDQNS  139

Query  185  KYAGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWI  364
            +Y G+CRYG +    KVML  A DY+V AYLYATA++ VPEAF+LHS+SRESWDRESNWI
Sbjct  140  RYCGACRYGMKFLLEKVMLIGASDYEVSAYLYATARVSVPEAFILHSMSRESWDRESNWI  199

Query  365  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEED  544
            GY+AVT+D VS+A GRREIYV +RGTT D EW++V  A+   ++             E+D
Sbjct  200  GYIAVTTDEVSRARGRREIYVAWRGTTRDYEWVDVLGAELDDSDD------------EDD  247

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +K  KVM GW T+YTS DP S FT  SAR+Q 
Sbjct  248  EKNVKVMRGWFTIYTSGDPRSPFTKASARKQF  279



>ref|XP_009142882.1| PREDICTED: phospholipase A1-IIdelta-like [Brassica rapa]
Length=336

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 146/206 (71%), Gaps = 10/206 (5%)
 Frame = +2

Query  23   FQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSC  202
            +  +  EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ 
Sbjct  8    YHQIMAEPSWEELLGQDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSIYCGAS  67

Query  203  RYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
            RYGK SFFHKVML  A  Y V ++LYATA++   EAF L S+SRESWDRE+NWIGY+AVT
Sbjct  68   RYGKPSFFHKVMLDDARHYDVVSFLYATARVSNHEAFFLSSMSRESWDRETNWIGYIAVT  127

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            SD  +  +GRREIYVVFRGTT + EW+NV  AK  S E LL    +G          P+V
Sbjct  128  SDERTAEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVEELLMDGRDG----------PEV  177

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
            M GW T+YT+ +P+S FT +S R QL
Sbjct  178  MLGWFTIYTTANPDSPFTKMSGRSQL  203



>ref|XP_010689863.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=423

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 148/213 (69%), Gaps = 14/213 (7%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            PTW  LLGS NWEGLLDPLN  LRHLI+RCGDFCQ TYD+F ND NS Y G  RYGK S 
Sbjct  13   PTWKNLLGSHNWEGLLDPLNDELRHLIIRCGDFCQVTYDTFINDPNSAYCGCSRYGKSSL  72

Query  224  FHKVMLPSA-DDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
              K   P   D Y V ++LYATA++ VPEAFLL SLSRE WDRESNW+GY+AV++D VS+
Sbjct  73   LRKTTFPGGWDKYDVVSFLYATARVSVPEAFLLKSLSRERWDRESNWMGYIAVSNDTVSR  132

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLR--SITNGDKGD-----------EE  541
             +GRREIYV +RGTT   EWI+V  AK  SA+ LLR  +  + + G+           + 
Sbjct  133  EMGRREIYVAWRGTTRSYEWIDVLGAKLQSAKPLLREGAFDHHENGEDGSDNDDSDNEDH  192

Query  542  DDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              K+PKVM GWLT+YTS DP S FT LSAR QL
Sbjct  193  HHKLPKVMRGWLTIYTSDDPKSPFTKLSARSQL  225



>ref|XP_002881868.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58127.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 147/201 (73%), Gaps = 10/201 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EPTW +LLG +NW+ +L+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK 
Sbjct  2    VEPTWEELLGRDNWQNILEPLDHSLRQLILRTGDFCQATYDTFINDQNSIYCGASRYGKP  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFFHKVML  A  Y+V ++LYATA++   EAF L S+SRESWDRE+NWIGY+AVTSD  +
Sbjct  62   SFFHKVMLDDARHYEVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERT  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              +GRREIYVVFRGTT + EW+NV  AK  S + LL      D GD      P+VM GW 
Sbjct  122  AEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLM-----DGGDG-----PEVMLGWF  171

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YT+ +PNS FT +SAR QL
Sbjct  172  TIYTTANPNSPFTKMSARSQL  192



>ref|XP_010512889.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 146/201 (73%), Gaps = 10/201 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK 
Sbjct  2    VEPTWEELLGLDNWQNLLEPLDHSLRKLILRAGDFCQATYDTFINDQNSIYCGASRYGKP  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFFHKVML  A  Y V ++LYATA++   EAF L S+SRESWDRE+NWIGY+AVTSD  +
Sbjct  62   SFFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERT  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              +GRREIYVVFRGTT + EW+NV  AK  S + LL      D GD      P+VM GW 
Sbjct  122  AEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLM-----DGGDG-----PEVMLGWF  171

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YT+ +PNS FT +SAR QL
Sbjct  172  TIYTTANPNSPFTKMSARSQL  192



>ref|XP_006411539.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
 gb|ESQ52992.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
Length=396

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 147/201 (73%), Gaps = 10/201 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK 
Sbjct  2    VEPSWEELLGQDNWQNLLEPLDQSLRRLILRAGDFCQATYDTFINDQNSIYCGASRYGKP  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFFHKVML  A  Y+V ++LYATA++   EAF L S+SRESWDRE+NWIGY+AVTSD  +
Sbjct  62   SFFHKVMLDDARHYEVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERT  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              +GRREIYVVFRGTT + EW+NV  AK    + LL    +G+ G       P+VM GW 
Sbjct  122  AEIGRREIYVVFRGTTRNYEWVNVMGAKLTPVKELL---MDGEDG-------PEVMLGWF  171

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YT+ +PNS FT LSAR QL
Sbjct  172  TIYTTANPNSPFTKLSARSQL  192



>ref|XP_010507708.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 145/201 (72%), Gaps = 10/201 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK 
Sbjct  2    VEPTWEELLGRDNWQNLLEPLDHSLRQLILRTGDFCQATYDTFINDQNSIYCGASRYGKP  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFFHKVML  A  Y V ++LYATA++   EAF L S+SRESWDRE+NWIGY+AVTSD  +
Sbjct  62   SFFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERT  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              +GRREIYVVFRGTT + EW+NV  AK  S + LL    +G          P+VM GW 
Sbjct  122  AEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGHG----------PEVMLGWF  171

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YT+ +PNS FT +SAR QL
Sbjct  172  TIYTTANPNSPFTKMSARSQL  192



>ref|XP_008348571.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=442

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 158/210 (75%), Gaps = 13/210 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QLLGS NW+GLLDPL+L+L  LILRCGDFCQATYD+FNND NSKY GS RYGK SFF 
Sbjct  33   WAQLLGSNNWDGLLDPLDLNLLTLILRCGDFCQATYDAFNNDQNSKYCGSSRYGKHSFFD  92

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML  A +YQV  +LYATA++ VPEA LLHSLSRESWDRESNWIGY+AVTSD VS+A+G
Sbjct  93   KVMLQDAANYQVSCFLYATAQVSVPEALLLHSLSRESWDRESNWIGYIAVTSDQVSQAIG  152

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEE-------------DDK  550
            RREIYV +RGTTT+ EW+NV  A+  SA SLLR      K   +             ++K
Sbjct  153  RREIYVAWRGTTTNYEWVNVLGAELESAASLLRPDPTSAKDQTDGGRSSTSSSDDDDNEK  212

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            VPKVM GWL++YTS  P S FT LSAR+Q+
Sbjct  213  VPKVMRGWLSMYTSDXPKSPFTKLSARDQI  242



>ref|XP_010413021.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 145/201 (72%), Gaps = 10/201 (5%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
             EPTW +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK 
Sbjct  2    VEPTWEELLGLDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSTYCGASRYGKP  61

Query  218  SFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            SFFHKVML  A  Y V ++LYAT+++   EAF L S+SRESWDRE+NWIGY+AVTSD  +
Sbjct  62   SFFHKVMLDDARHYDVVSFLYATSRVSDHEAFFLSSMSRESWDRETNWIGYIAVTSDERT  121

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              +GRREIYVVFRGTT + EW+NV  AK  S + LL    +G          P+VM GW 
Sbjct  122  AEIGRREIYVVFRGTTRNYEWVNVMGAKLTSVKELLMDGGHG----------PEVMLGWF  171

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            T+YT+ +PNS FT +SAR QL
Sbjct  172  TIYTTANPNSPFTKMSARSQL  192



>ref|XP_010525149.1| PREDICTED: phospholipase A1-IIdelta-like [Tarenaya hassleriana]
Length=414

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            + A EPTW  LLG  NWEGLL+PLN+SLR L+LR GDFCQATYD+F ND NS + G  RY
Sbjct  2    AAAEEPTWEDLLGRNNWEGLLNPLNVSLRRLVLRAGDFCQATYDAFVNDPNSAFCGVSRY  61

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
            GK SFF KVML  AD Y V ++LYATA++   EAF L S+SR+SWDRE+NWIGYVAVTSD
Sbjct  62   GKPSFFRKVMLDDADHYDVVSFLYATARVSDHEAFFLKSMSRDSWDRETNWIGYVAVTSD  121

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-----RSITNGDKGDEEDDKV  553
            A +  +GRREIYVVFRGTT + EWINV  AK  S + LL          GD   ++DD  
Sbjct  122  ARTAEIGRREIYVVFRGTTRNYEWINVLGAKLTSLKCLLTGGDGNCGGGGDGLADDDDDG  181

Query  554  PKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            PK M GW+T+YT+ +P S+FT +SAR QL
Sbjct  182  PKAMLGWVTIYTTANPRSQFTKMSARSQL  210



>ref|XP_002518706.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF43631.1| triacylglycerol lipase, putative [Ricinus communis]
Length=417

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 155/213 (73%), Gaps = 15/213 (7%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            + TW +LLG  NWE LLDPL+L+LR LILRCGD CQATYDSFNND NSKY G+ RYGK +
Sbjct  8    QATWSELLGQNNWENLLDPLDLNLRKLILRCGDLCQATYDSFNNDQNSKYCGASRYGKHN  67

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF KVM   A++YQV ++LY TA++ +PEAF+LHS SRESWDRESNWIGY+AVT+D  SK
Sbjct  68   FFQKVMFEEAENYQVSSFLYGTARVSLPEAFILHSQSRESWDRESNWIGYIAVTTDEYSK  127

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEE-------------  541
            A GRR+IY+  RGTT + EW+N+  AK  SA  LL+  +N    D+E             
Sbjct  128  ATGRRDIYIALRGTTRNYEWVNILGAKLQSANHLLQGSSN--NLDQEMKNSASSSDSDDD  185

Query  542  DDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            ++KVPKVM GWLT+Y S DP S FT LS R+QL
Sbjct  186  NEKVPKVMQGWLTIYVSDDPKSPFTKLSLRKQL  218



>emb|CDY50817.1| BnaC04g52540D [Brassica napus]
Length=392

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 144/200 (72%), Gaps = 10/200 (5%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            EP+W +LLG +NW+ LL+PL+ SLR LILR GDFCQATYD+F ND NS Y G+ RYGK S
Sbjct  3    EPSWEELLGQDNWQNLLEPLDHSLRRLILRAGDFCQATYDTFINDQNSIYCGASRYGKPS  62

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FFHKVML  A  Y V ++LYATA++   EAF L S+SRESWDRE+NWIGY+ VTSD  + 
Sbjct  63   FFHKVMLDDARHYDVVSFLYATARVSDHEAFFLSSMSRESWDRETNWIGYITVTSDERTA  122

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             +GRREIYVVFRGTT + EW+NV  AK  S E LL    +G          P+VM GW T
Sbjct  123  EIGRREIYVVFRGTTRNYEWVNVMGAKLTSVEELLMDGRDG----------PEVMLGWFT  172

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YT+ +P+S FT +SAR QL
Sbjct  173  IYTTANPDSPFTKMSARSQL  192



>ref|XP_010052794.1| PREDICTED: phospholipase A1-IIdelta [Eucalyptus grandis]
 gb|KCW89651.1| hypothetical protein EUGRSUZ_A01923 [Eucalyptus grandis]
Length=452

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 151/216 (70%), Gaps = 16/216 (7%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            E TW +LLGS +WEGLL+PL++ LR LILRCGDF QATYD+F ND NSKY G  RYGK  
Sbjct  38   ESTWAELLGSGDWEGLLEPLDIGLRRLILRCGDFIQATYDTFINDENSKYCGCSRYGKAD  97

Query  221  FFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            FF KVM+ +  DY+V A+LY TA++   E FL HS SRE+WDRESNWIGY+AVT+D VS 
Sbjct  98   FFQKVMMENGSDYEVVAFLYGTARVSSKEYFLFHSQSREAWDRESNWIGYIAVTTDEVSA  157

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRS----------------ITNGDKG  532
             LGRREIY+ +RGTT + EWIN+  AK  S ESLL +                 ++ D  
Sbjct  158  QLGRREIYIAWRGTTRNYEWINILGAKRKSIESLLSTNGGGEHEPGEEEARNDSSSSDDD  217

Query  533  DEEDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            D +D+KVPKVM GW T+YT+ DP S FT LSAR QL
Sbjct  218  DRDDEKVPKVMLGWYTIYTTDDPKSPFTKLSARTQL  253



>ref|XP_008362525.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=441

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 155/207 (75%), Gaps = 10/207 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS NW+ LLDPL+L+LR LILRCG+FCQATYD+FNND NSKY GS RYGK SFF 
Sbjct  35   WSELLGSNNWDXLLDPLDLNLRTLILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFFD  94

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML  A +YQV  +LYATA++ VPEA LL S SRESWDRESNWIGY+AVT+D VSK +G
Sbjct  95   KVMLQDAANYQVSCFLYATAQVSVPEALLLKSKSRESWDRESNWIGYIAVTTDEVSKVIG  154

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLL----RSITNGDKGD------EEDDKVPK  559
            RREIYV +RGT  + EWINV  A+  SAE +L     S+ NG +        E+D+KVPK
Sbjct  155  RREIYVAWRGTIRNYEWINVMGAELESAEIILGSSHASLANGHQNHDDKDDDEDDEKVPK  214

Query  560  VMFGWLTLYTSKDPNSRFTTLSAREQL  640
            VM GWLT+Y S DP S FT  SAR QL
Sbjct  215  VMRGWLTMYISNDPKSPFTKTSARVQL  241



>ref|XP_010525104.1| PREDICTED: phospholipase A1-IIdelta [Tarenaya hassleriana]
Length=407

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 148/209 (71%), Gaps = 6/209 (3%)
 Frame = +2

Query  32   MAT---EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSC  202
            MAT   EP+W + LGS+NWE LLDPL+ +LR +ILRCGDFCQATYD+F+ND NSKY G+ 
Sbjct  1    MATPKAEPSWGEHLGSKNWENLLDPLDQTLRTIILRCGDFCQATYDAFDNDENSKYCGAS  60

Query  203  RYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
            RYGK SFF KVML SA DY V ++LYATA++ VP+AF+LHSLS+E WDRESNW GY+AVT
Sbjct  61   RYGKSSFFDKVMLDSASDYNVYSFLYATARISVPKAFILHSLSKECWDRESNWFGYIAVT  120

Query  383  SDAVSKALGRREIYVVFRGTTT---DLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKV  553
            SD  SK LGRREIYV +   +T    LE  N  +       +    I   D   +++  V
Sbjct  121  SDERSKNLGRREIYVAYHSPSTRNSTLENSNRLMHGAGQDVTDAIVIGGSDSDSDDESGV  180

Query  554  PKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            PKVM GW T+YTS +P SRFT LS R QL
Sbjct  181  PKVMSGWFTIYTSHNPKSRFTNLSLRSQL  209



>gb|AAD01804.1| lipase [Dianthus caryophyllus]
Length=447

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 146/235 (62%), Gaps = 36/235 (15%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            PTW +LLGS  W GLL+PLN  LR L+LRCGDFCQ TYD+F ND NS Y GS RYGK   
Sbjct  15   PTWPELLGSNAWAGLLNPLNDELRELLLRCGDFCQVTYDTFINDQNSSYCGSSRYGKADL  74

Query  224  FHKVMLPS-ADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
             HK   P  AD + V AYLYATAK+ VPEAFLL S SRE WDRESNWIGYV V++D  S+
Sbjct  75   LHKTAFPGGADRFDVVAYLYATAKVSVPEAFLLKSRSREKWDRESNWIGYVVVSNDETSR  134

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRS--ITNGDKGDEEDDK--------  550
              GRRE+YVV+RGT  D EW++V  A+  SA  LLR+   T+ +K + E+ K        
Sbjct  135  VAGRREVYVVWRGTCRDYEWVDVLGAQLESAHPLLRTQQTTHVEKVENEEKKSIHKSSWY  194

Query  551  -------------------------VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
                                      PKVM GW+T+YTS+DP S FT LSAR QL
Sbjct  195  DCFNINLLGSASKDKGKGSDDDDDDDPKVMQGWMTIYTSEDPKSPFTKLSARTQL  249



>ref|XP_008343102.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=438

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 152/204 (75%), Gaps = 7/204 (3%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS NW+ LLDPL+L+LR LILRCG+FCQATYD+FNND NSKY GS RYGK SFF 
Sbjct  35   WSELLGSNNWDXLLDPLDLNLRTLILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHSFFD  94

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML  A +YQV  +LYATA++ VPEA LL S SRESWDRESNWIGY+AVT+D VSK +G
Sbjct  95   KVMLQDAANYQVSCFLYATAQVSVPEALLLXSXSRESWDRESNWIGYIAVTTDEVSKXIG  154

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLL-RSITNGDKGD------EEDDKVPKVMF  568
            RREIYV +RGT  + EWIN   A+  S E++L  S  NG +        E++++VPK M 
Sbjct  155  RREIYVAWRGTIRNYEWINGMGAELESVENILGSSHANGHQNHXDKDDDEDEEEVPKAMR  214

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            GWLT+Y S DP S FT  SAR QL
Sbjct  215  GWLTMYISNDPKSPFTKTSARVQL  238



>ref|XP_004306113.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  LLG  NW GLLDPL++ LR LILRCGDFCQ TYD+FNND+NSKYAGS RYG  +FF 
Sbjct  24   WSALLGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYGHANFFD  83

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KVML  A +Y++  +LY TA++ VPEAFLLHS+S ESWDRESNWIGYV VT+D  SK++G
Sbjct  84   KVMLQDAANYEIAFFLYTTAQVSVPEAFLLHSMSHESWDRESNWIGYVVVTTDQYSKSIG  143

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITN  520
             REIYV +RG T + EW+NV  A+ VSAE LLR   N
Sbjct  144  HREIYVAWRGNTRNYEWVNVLGAELVSAEQLLRPENN  180



>ref|XP_011463616.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=199

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 126/163 (77%), Gaps = 5/163 (3%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            +A  PTW  LLG  NW GLLDPL++ LR LILRCGDFCQ TYD+FNND+NSKYAGS RYG
Sbjct  18   LAAGPTWSALLGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYG  77

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
              +FF KVML  A +Y++ ++LYATA++ VPEAFLLHS+S     RESNWIGYVAVT+D 
Sbjct  78   HANFFDKVMLQDAANYEIASFLYATAQVSVPEAFLLHSMS-----RESNWIGYVAVTTDQ  132

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITN  520
             SK++GRREIYV +RGTT + EW+NV   + VSAE LLR   N
Sbjct  133  YSKSIGRREIYVAWRGTTLNYEWVNVLGTELVSAEQLLRPENN  175



>ref|XP_010689845.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=426

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 139/213 (65%), Gaps = 14/213 (7%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            PTW  LLGS NW+ LLDPLN  LR LILRCGDFCQ TYD+F ND NS Y G+ RY K   
Sbjct  16   PTWQHLLGSHNWDHLLDPLNEDLRRLILRCGDFCQVTYDTFINDPNSAYCGASRYAKADL  75

Query  224  FHKVMLPS-ADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
              K   P  +D Y V  +LYATA++ VPEAFL  S+SRE WDRESNWIGY+AV++D VS 
Sbjct  76   LKKTAFPGGSDKYDVVGFLYATARVSVPEAFLFKSMSRERWDRESNWIGYIAVSNDEVSN  135

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDK-------------GDEE  541
             +GRREIYV +RGTT + EWI+V  AK  SA  LL    + D               DE 
Sbjct  136  EIGRREIYVAWRGTTRNYEWIDVLGAKLQSAMPLLSEGGDHDHNENGEDDEDEDEDHDEH  195

Query  542  DDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              ++PKVM GWLT+YTS D  S FT LSAR Q+
Sbjct  196  GHRLPKVMKGWLTIYTSDDEKSPFTKLSARAQI  228



>ref|XP_011463615.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=181

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  74   NWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFHKVMLPSAD  253
            NW GLLDPL++ LR LILRCGDFCQ TYD+FNND+NSKYAGS RYG  +FF KVML  A 
Sbjct  9    NWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYGHANFFDKVMLQDAA  68

Query  254  DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALGRREIYVVF  433
            +Y++ ++LY+TA++ VPEAFLLHS+SRESWDRESNWIGYVAVT+D  SK++GRREIYV +
Sbjct  69   NYEIASFLYSTAQVSVPEAFLLHSMSRESWDRESNWIGYVAVTTDQYSKSIGRREIYVAW  128

Query  434  RGTTTDLEWINVFIAKPVSAESLLRSITN  520
              TT + EW+NV  A+ VSAE LLR  TN
Sbjct  129  HCTTRNYEWVNVLGAELVSAEQLLRPETN  157



>emb|CDY47985.1| BnaA04g24630D [Brassica napus]
Length=378

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 138/203 (68%), Gaps = 23/203 (11%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYDSF+              
Sbjct  1    MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDSFS--------------  46

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
              SFF KVML +A DYQV ++LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD 
Sbjct  47   --SFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  104

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
             +KALGRREIYV  RGT+ + EWINV  A+P SA+ LL        G E++    KVM G
Sbjct  105  RTKALGRREIYVALRGTSRNYEWINVLGARPTSADPLL-------TGPEQNGSGSKVMLG  157

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            WLT+YTS    S+FT +S R QL
Sbjct  158  WLTIYTSDHAESKFTKMSLRLQL  180



>ref|XP_008807980.1| PREDICTED: phospholipase A1-II 5 [Phoenix dactylifera]
Length=450

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P+W  LLGS  W GLLDPL+LSLR L+L+CGDFCQ TYDSFN+D +SKY GSCRY K
Sbjct  6    AATPSWQDLLGSNQWAGLLDPLDLSLRRLLLQCGDFCQVTYDSFNSDQHSKYCGSCRYSK  65

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +   +V  PSA D+ V  YLYAT+++ +P+ FLL S S E+W +ESNWIGY+AV+SDA 
Sbjct  66   SNLLSRVFFPSAADFSVAEYLYATSQIDLPDGFLLFSRSDEAWSKESNWIGYIAVSSDAA  125

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
            +   GRREIYV +RGT   LEW++VF  + V  +S+L S     KG  +DD+VPKVM GW
Sbjct  126  ALKTGRREIYVAWRGTIRTLEWVDVFQPELVPIDSILSSTQ---KGSADDDEVPKVMKGW  182

Query  575  LTLYTSKDPNSRFTTLSAREQL  640
              +YTS +P S F   SAR+QL
Sbjct  183  YVIYTSSNPKSPFNKESARDQL  204



>ref|XP_010925003.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=449

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P W +LLGS +W GLLDPLNLSLR L+L+CGD CQ TYDSFN+D +SKY GSCRY K
Sbjct  6    AATPPWQELLGSNHWAGLLDPLNLSLRRLLLQCGDLCQVTYDSFNSDQHSKYCGSCRYSK  65

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +   KV  PSA D+ V  YLYAT+++ +P   LL SLS E+W +ESNWIGYVAV+SDA 
Sbjct  66   STLLSKVFFPSAADFSVVEYLYATSQIGLPNDLLLFSLSDEAWSKESNWIGYVAVSSDAA  125

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
            +   GRREIYV +RGT   LEW++V + + V  +S+L S     KG  +D+++PKVM GW
Sbjct  126  ALQTGRREIYVAWRGTIRTLEWVDVAMPELVPIDSILSST---QKGSADDEEIPKVMKGW  182

Query  575  LTLYTSKDPNSRFTTLSAREQL  640
              +YTS DP SRF   SAR QL
Sbjct  183  YMIYTSSDPQSRFNKESARNQL  204



>emb|CDY14851.1| BnaC04g48480D [Brassica napus]
Length=378

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 135/203 (67%), Gaps = 23/203 (11%)
 Frame = +2

Query  32   MATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG  211
            MA    W +LLGS+NW+ LLDPL+ SLR LILRCGDFCQATYD+F+              
Sbjct  1    MAAATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDAFS--------------  46

Query  212  KRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
              SFF KVML +A DYQV ++LYATA++ +PE  LL S SR+SWDRESNW GY+AVTSD 
Sbjct  47   --SFFDKVMLENASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAVTSDE  104

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
             SK+LGRREIYV  RGT+ + EWINV  A+P SA+ LL        G        KVM G
Sbjct  105  RSKSLGRREIYVALRGTSRNYEWINVLGARPTSADPLLTGPVQNGSGS-------KVMLG  157

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            WLT+YTS    S+FT +S R QL
Sbjct  158  WLTIYTSDHAESKFTKMSLRLQL  180



>ref|XP_004292180.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=199

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 5/162 (3%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P W  LLG  NW GLLDPL++ L+ LIL CGDFCQ TYD+FNND+NSKYAGS RY  
Sbjct  19   AAGPAWSALLGENNWAGLLDPLDVHLQTLILCCGDFCQGTYDAFNNDTNSKYAGSSRYDH  78

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +FF+KVML    +Y++ ++LYATA++ +PEAFLLHS+S     RESNWIGYVAVT+D  
Sbjct  79   ANFFNKVMLQDVANYEIASFLYATAQVSIPEAFLLHSMS-----RESNWIGYVAVTTDQY  133

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITN  520
            SK++GRREIYV +RGTT + EW+NV  A+ VSAE LLR   N
Sbjct  134  SKSIGRREIYVAWRGTTRNYEWVNVLGAELVSAEQLLRPENN  175



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 147/205 (72%), Gaps = 4/205 (2%)
 Frame = +2

Query  26   QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCR  205
            +++   P+W +LLGS++W GLLDPL+LSLR L+L+CGD CQ TYDSF+ND +SKY GSCR
Sbjct  4    KAVTRSPSWPELLGSKHWSGLLDPLDLSLRRLLLQCGDMCQVTYDSFDNDPHSKYCGSCR  63

Query  206  YGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
            YG+R+   KV+ P A  Y V  Y YATA++ +P+ F L S +R++W +ESNW+GYVAV++
Sbjct  64   YGRRTLLDKVLFPYAASYSVSGYFYATAQVGLPDHFFLFSYARDAWSKESNWMGYVAVST  123

Query  386  DAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
            DA ++A GRREIYV +RGT   LEW++V   + +  +S+L S       +E+    PKVM
Sbjct  124  DAAARATGRREIYVAWRGTIRTLEWVDVLEPELLPVDSILSSKKEATAEEEK----PKVM  179

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GW  +YTS +PNS + T SAREQL
Sbjct  180  KGWFVIYTSSNPNSSYNTQSAREQL  204



>ref|XP_006858342.1| hypothetical protein AMTR_s00064p00160580 [Amborella trichopoda]
 gb|ERN19809.1| hypothetical protein AMTR_s00064p00160580 [Amborella trichopoda]
Length=211

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 130/207 (63%), Gaps = 26/207 (13%)
 Frame = +2

Query  41   EPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRS  220
            E  W +L GS+ WEGLL+PLN  LR +ILR GD CQATYD+FN+D +SKY GS R GKRS
Sbjct  5    EKAWQELHGSKQWEGLLEPLNEGLREIILRYGDLCQATYDAFNSDPHSKYCGSSRCGKRS  64

Query  221  FFHKVMLP--------------SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESN  358
            FF KV L               S  DY+V  +LY TAK+ +P +FLLHSLSRE+W RESN
Sbjct  65   FFTKVGLAPPHVSNTAESSDAASGTDYRVAGFLYGTAKIDIPASFLLHSLSREAWSRESN  124

Query  359  WIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDK---  529
            WIGYVA++SD  S+ LGRR+I V +RGT  DLEW+NVF     S  SLL    + D    
Sbjct  125  WIGYVAISSDTFSQNLGRRDIVVAYRGTIRDLEWMNVFSPSLESIASLLPPSEDFDDDSP  184

Query  530  ---------GDEEDDKVPKVMFGWLTL  583
                     G  EDD  PKVM GW T+
Sbjct  185  LKHRFERFLGRGEDDDEPKVMDGWYTI  211



>ref|XP_010925002.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=440

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 142/202 (70%), Gaps = 3/202 (1%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P+W +LLGS +W GLLDPL+LSLR L+L+CGD CQ TYDSFN+D +SKY GSCRY K
Sbjct  6    AATPSWQELLGSNHWAGLLDPLDLSLRRLLLQCGDLCQVTYDSFNSDKHSKYCGSCRYSK  65

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +  +KV  PSA D+ V  YLYAT+++ +P+ FLL  +   +W ++SNWIGY+AV+SDA 
Sbjct  66   STLLNKVFFPSAADFSVVDYLYATSQIGLPDDFLLFPICDGAWSKDSNWIGYIAVSSDAA  125

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
            +   GRREIYV +RGT   LEW++V + + V  +S+L S     +    DD+VPKVM GW
Sbjct  126  ALKNGRREIYVAWRGTIRPLEWVDVAMPQLVPIDSILSSTQ---RCWAHDDEVPKVMKGW  182

Query  575  LTLYTSKDPNSRFTTLSAREQL  640
              +YTS DP S F   SAR+QL
Sbjct  183  YIIYTSSDPQSPFNKQSARDQL  204



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 137/210 (65%), Gaps = 13/210 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  + GS+NWEGLL+PL+  LR  IL  GD  QATYD+FN+D +SK+ GS RYGK+ FF 
Sbjct  11   WRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYGKKDFFQ  70

Query  230  KVMLPSADD---YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L + DD   Y+V  +LYAT++L +P+AF+L SLSRE+W RESNWIGYVAV +D   +
Sbjct  71   KVSLATGDDEWNYEVTRFLYATSRLELPQAFMLKSLSREAWSRESNWIGYVAVATDRGKQ  130

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEE----------DDK  550
             LGRREI V +RGT  DLEW +VF   PVS   +L      D   +           D++
Sbjct  131  RLGRREIVVAWRGTIRDLEWSDVFNPIPVSIAPILSQEQRHDHDHDHHWYDRVLHLVDEE  190

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             PKVM GW  +YTS DP S FT  SAREQ 
Sbjct  191  EPKVMNGWFVIYTSTDPKSPFTKSSAREQF  220



>ref|XP_002458388.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
 gb|EES03508.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
Length=473

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 7/198 (4%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            +W +LLGS +WEGLLDPL+L+LR LIL CGD CQ TYDSFN+D +SKY+GSCRY + + F
Sbjct  22   SWPELLGSAHWEGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDPHSKYSGSCRYSRSTLF  81

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             + + P+A D    AYLYAT++   P   ++ SLSRE+W +ESNWIGYV+V++DA + A 
Sbjct  82   ARTLFPAAADISPAAYLYATSQSSFPGGIMVFSLSREAWSKESNWIGYVSVSTDAAAAAT  141

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            G+R IYV +RGT   LEW++V   + VS +++L       +GD    +  +VM GW  +Y
Sbjct  142  GQRVIYVAWRGTIRTLEWVDVLKPELVSPDAIL------PEGDPSRGQA-RVMEGWYLIY  194

Query  587  TSKDPNSRFTTLSAREQL  640
            TS D  S F+  SAREQL
Sbjct  195  TSSDERSPFSRYSAREQL  212



>ref|XP_003569665.1| PREDICTED: phospholipase A1-II 5 [Brachypodium distachyon]
Length=471

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 141/210 (67%), Gaps = 7/210 (3%)
 Frame = +2

Query  11   SFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKY  190
            + +   +  T P W +LLGS +W+GLLDPLNL+LR LIL CGD CQ TYDSFN+DS+SKY
Sbjct  12   ALVGAGANGTTPAWPELLGSAHWDGLLDPLNLTLRRLILLCGDLCQVTYDSFNSDSHSKY  71

Query  191  AGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGY  370
             G+CR+ + + F +   P+A D  V A LYATA+  +P   +++SLSRE+W +ESNWIGY
Sbjct  72   CGTCRFSRATLFSRTQFPAAADVSVAANLYATAQTSLPAGLMVYSLSREAWSKESNWIGY  131

Query  371  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDK  550
            VAV++DA + A G+R IYV  RGT  +LEW++V     V+ +++L   ++  +G      
Sbjct  132  VAVSTDAAAAATGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAILPE-SDPARGHA----  186

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              +VM GW  +YTS D  S F+  SAR+QL
Sbjct  187  --RVMKGWYVIYTSSDERSPFSKYSARDQL  214



>dbj|BAJ88202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 135/199 (68%), Gaps = 7/199 (4%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN+DS+SKY G+CR+ K + 
Sbjct  22   PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDSHSKYCGTCRFSKATL  81

Query  224  FHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            F +   P+A D  V A LYATA   +P   ++HSLSRE+W +ESNWIGYVAV++DA + A
Sbjct  82   FSRTQFPAAADISVAANLYATAATSLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
             G+R IYV  RGT  +LEW++V     V+ +++L       +GD       +VM GW  +
Sbjct  142  TGQRVIYVALRGTIRNLEWVDVLKPDLVTPDTIL------PEGDPASGHA-RVMNGWYVI  194

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+  SAR+QL
Sbjct  195  YTSTDERSPFSKYSARDQL  213



>dbj|BAJ85876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 135/199 (68%), Gaps = 7/199 (4%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN+DS+SKY G+CR+ K + 
Sbjct  22   PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDSHSKYCGTCRFSKATL  81

Query  224  FHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            F +   P+A D  V A LYATA   +P   ++HSLSRE+W +ESNWIGYVAV++DA + A
Sbjct  82   FSRTQFPAAADISVAANLYATAATSLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
             G+R IYV  RGT  +LEW++V     V+ +++L       +GD       +VM GW  +
Sbjct  142  TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDTIL------PEGDPASGHA-RVMNGWYVI  194

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+  SAR+QL
Sbjct  195  YTSTDERSPFSKYSARDQL  213



>ref|XP_008675114.1| PREDICTED: phospholipase A1-II 5 [Zea mays]
 tpg|DAA57900.1| TPA: hypothetical protein ZEAMMB73_499727 [Zea mays]
Length=469

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 7/198 (4%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            +W +LLGS +WEGLLDPL+L+LR LIL CGD CQ TYDSFN+D++SKY GSCRY + + F
Sbjct  22   SWPELLGSAHWEGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDTHSKYCGSCRYSRSTLF  81

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             + + P+A D    AYLYAT++   P   ++ SLSRE+W++ESNWIGYV+V++DA + A 
Sbjct  82   ARTLFPAAADIFPAAYLYATSQSSFPGGIMVFSLSREAWNKESNWIGYVSVSTDAAAAAT  141

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            G+R IYV +RGT   LEW++V   + VS +++L       +GD       +VM GW  +Y
Sbjct  142  GQRVIYVAWRGTIRTLEWVDVLKPELVSPDAIL------PEGDPARGHA-RVMEGWYLIY  194

Query  587  TSKDPNSRFTTLSAREQL  640
            TS D  S F+  SAREQL
Sbjct  195  TSSDERSPFSKYSAREQL  212



>emb|CDM83808.1| unnamed protein product [Triticum aestivum]
Length=462

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 135/199 (68%), Gaps = 7/199 (4%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            P W +LLGS +W+GL+DPL+L+LR L+L CGD CQ TYDSFN+D++SKY G+CR+ + + 
Sbjct  22   PAWPELLGSAHWDGLIDPLDLTLRRLVLLCGDLCQVTYDSFNSDAHSKYCGTCRFSRATL  81

Query  224  FHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            F +   P+A D  V A LYATA   +P   ++HSLSRE+W +ESNWIGYVAV++DA + A
Sbjct  82   FSRTQFPAAADVSVAANLYATAATWLPPGLMVHSLSREAWSKESNWIGYVAVSTDAAAAA  141

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
             G+R IYV  RGT  +LEW++V     V+ +++L       +GD       +VM GW  +
Sbjct  142  TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAIL------PEGDPARGHA-RVMKGWYVI  194

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+  SAR+QL
Sbjct  195  YTSTDERSPFSKYSARDQL  213



>gb|EMS63050.1| Phospholipase A1-II 5 [Triticum urartu]
Length=510

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 134/199 (67%), Gaps = 7/199 (4%)
 Frame = +2

Query  44   PTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            P W +LLGS +W+GLLDPL+L+LR L+L CGD CQ TYDSFN+D +SKY G+CR+ + + 
Sbjct  70   PAWPELLGSAHWDGLLDPLDLTLRRLVLLCGDLCQVTYDSFNSDPHSKYCGTCRFSRATL  129

Query  224  FHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            F +   P+A D  V A LYATA   +P   ++HSLSRE+W +ESNW+GYVAV++DA + A
Sbjct  130  FSRTQFPAAADVSVAANLYATAATWLPPGLMVHSLSREAWSKESNWVGYVAVSTDAAAAA  189

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
             G+R IYV  RGT  +LEW++V     V+ +++L       +GD       +VM GW  +
Sbjct  190  TGQRVIYVALRGTIRNLEWVDVLKPDLVAPDAIL------PEGDPARGHA-RVMKGWYVI  242

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+  SAR+QL
Sbjct  243  YTSTDERSPFSKYSARDQL  261



>ref|XP_004969721.1| PREDICTED: phospholipase A1-II 5-like [Setaria italica]
Length=459

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            +W +LLGS++W+GLLDPL+L+LR LIL CGD CQ TYDSFN+DS+SKY GSCRY + + F
Sbjct  22   SWPELLGSKHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGSCRYSRSTLF  81

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             + + P+A D    AYLY T++   P   ++ SLSRE+W +ESNWIGYV+V++DA + A 
Sbjct  82   ARTLFPAAADVTPAAYLYGTSQASFPGGVMVFSLSREAWSKESNWIGYVSVSTDAAAAAT  141

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            G+R IYV  RGT   LEW++V     V  +++L     G  G        +VM GW  +Y
Sbjct  142  GQRVIYVALRGTIRTLEWVDVLKPDLVFPDAIL---PEGHPGAHA-----RVMKGWYLIY  193

Query  587  TSKDPNSRFTTLSAREQL  640
            TS D  S F   SAR+QL
Sbjct  194  TSSDERSPFNKHSARDQL  211



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 132/199 (66%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G +NWEGLLDPLN+ LR  I+  G+  QATYD+FN +  SKYAGS RYG++  F 
Sbjct  39   WKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATYDAFNGEKASKYAGSSRYGRKDLFA  98

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AF++ SLSRE+W +ESNW+GYVAV +D     
Sbjct  99   KVSLENGNPFKYSVTKFLYATSQVDVPDAFIVKSLSREAWSKESNWMGYVAVATDEGKAE  158

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEWIN F  + VSA  +L     GDK  +     PKV  GW ++
Sbjct  159  LGRRDIVIAWRGTVRTLEWINDFEFRLVSASKIL-----GDKAGD-----PKVHQGWYSI  208

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+D  SRF   SAR+Q+
Sbjct  209  YTSEDQRSRFNKTSARQQV  227



>ref|XP_010104409.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00254.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=432

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 144/208 (69%), Gaps = 11/208 (5%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDP-LNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSF  223
            +W +LLGS NWE LL+P LNLSLR  ILRCG+FC+ATYD+FN++  S   G+ RYG+ +F
Sbjct  15   SWEELLGSNNWEALLEPELNLSLREFILRCGNFCEATYDAFNSNPISPNCGNSRYGEETF  74

Query  224  FHKVMLPSADDYQVEAYLYATAKL--PVPEAFLLHSLSR-ESWDRESNWIGYVAVTSDAV  394
            FH V+L  A +YQV A+LYAT+ +     + FL  + +  E WDR+SNW+G+VAVT+D +
Sbjct  75   FHDVVLQDASNYQVVAFLYATSGIGDTKKKLFLFSANTELEPWDRQSNWMGFVAVTTDKI  134

Query  395  SKALGRREIYVVFRGTTTDLEWI-NVFIAKPVSAESLL---RSITNGDK--GDEEDDKVP  556
            S+A+GRRE+YVV+RGT T  EW  N+F   P  A+ LL   R  T+     G    D+ P
Sbjct  135  SQAIGRREVYVVWRGTITTSEWTSNLFQTGPEPAKPLLASDRQTTDRPNFFGIPLKDE-P  193

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            KV  GWL++YTS + NS +TT SAR+QL
Sbjct  194  KVHGGWLSIYTSTNLNSIYTTASARDQL  221



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGSCRY K+SFF 
Sbjct  34   WRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSFFS  93

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  94   KVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  153

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I +V+RGT   LEW+N      V A  +    T+           PKV  GW ++
Sbjct  154  LGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-----------PKVHQGWYSI  202

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F   SAR Q+
Sbjct  203  YTSEDPRSPFNQTSARSQV  221



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 129/206 (63%), Gaps = 13/206 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S +    W  L G  NW+GLLDPL++ LR  I+  G+  QATYD+FN +  SKYAGS RY
Sbjct  33   SHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRY  92

Query  209  GKRSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             ++SFF +V L   +   Y V  ++YAT+++ VPEAFL+ SLSRESW +ESNW+GYVAV 
Sbjct  93   ARKSFFSRVCLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAVA  152

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D    ALGRR+I + +RGT   LEW+N      VSA  LL     G+ GD      PKV
Sbjct  153  TDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKLL-----GEDGD------PKV  201

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GW ++YTS D  S F   SAR Q+
Sbjct  202  HEGWYSIYTSDDSRSPFNKTSARYQV  227



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 129/199 (65%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN++  S++AGS RY K+ FF 
Sbjct  23   WRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAKKDFFS  82

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV +   +   Y V  YLYAT+++ VP+ F+L SLSRE+W +ESNW+GYVAV +D     
Sbjct  83   KVGIDIGNPFKYYVTKYLYATSEIQVPDGFILKSLSREAWSKESNWMGYVAVATDEGKAV  142

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    VSA  +L     G+ G E     PKV  GW ++
Sbjct  143  LGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKIL-----GEAGGE-----PKVHQGWYSI  192

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F+  SAR+Q+
Sbjct  193  YTSDDPLSSFSKTSARDQV  211



>ref|XP_006644603.1| PREDICTED: phospholipase A1-II 5-like [Oryza brachyantha]
Length=455

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 133/197 (68%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS NW+GLLDPL+L+LR LIL CGD CQ TYDSFN+DS+SKY G+CR+ + + F 
Sbjct  17   WPELLGSANWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRATLFA  76

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P+A D  V A LYAT++       +++SLSRE+W +ESNWIGYVAV++DA + A G
Sbjct  77   RTQFPAAGDLSVAANLYATSQATSFPGSMVYSLSREAWSKESNWIGYVAVSNDAAAAAAG  136

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            +R IYVV+RGT   LEW++V     V  + +L       +G +   +  +VM GW  +YT
Sbjct  137  QRVIYVVWRGTIRSLEWVDVLKPDLVDHDGIL------PEGHQARGR-SRVMKGWYLIYT  189

Query  590  SKDPNSRFTTLSAREQL  640
            S D  S F+  SAR+Q+
Sbjct  190  STDERSPFSKYSARDQM  206



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGSCRY K+SFF 
Sbjct  9    WRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRYAKKSFFS  68

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  69   KVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      V A  +    T+           PKV  GW ++
Sbjct  129  LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-----------PKVHQGWYSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F   SAR Q+
Sbjct  178  YTSEDPRSPFNQTSARSQV  196



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G   W+GLLDPLN+ LR  I+  G+  QATYD+FN++  SKYAGS RY +++FF 
Sbjct  40   WKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFS  99

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   Y V  ++YAT+++P+PEAFL+ SLSRESW +ESNW+ Y+AV +D     
Sbjct  100  KVGLEKGNPFKYNVTKFVYATSQIPIPEAFLIKSLSRESWCKESNWMAYIAVATDEGKAV  159

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA ++L     G++GD      PKV  GW ++
Sbjct  160  LGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNIL-----GEEGD------PKVHQGWYSI  208

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR Q+
Sbjct  209  YTSDDSRSPFNKTSARHQV  227



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 10/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G  +W GLLDPL++ LR  I+  G+  QATYD+FN +  SK+AGSCRY K  FF 
Sbjct  24   WQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRYAKNDFFS  83

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  ++YAT+++ VPEAF++ SLSRE+W +ESNWIG+VAV +D     
Sbjct  84   KVFLENGNPFKYSVTKFIYATSEINVPEAFIIKSLSREAWSKESNWIGFVAVANDEGKDV  143

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA  +         G+  +   PKV  GW ++
Sbjct  144  LGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVF--------GNSNNINDPKVHQGWYSI  195

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F+  SAR Q+
Sbjct  196  YTSEDPRSPFSKTSARNQV  214



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  SK+AGS RY ++SFF 
Sbjct  45   WKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSSRYARKSFFS  104

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L  A+   Y V  +LYAT+++ VPEAF++ SLSRE+W +ESNWIGYVAV +D     
Sbjct  105  RVGLEKANAFRYNVTKFLYATSQIQVPEAFIVKSLSREAWSKESNWIGYVAVATDEGKAL  164

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA ++L        G+E D KV +   GW ++
Sbjct  165  LGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNIL--------GEEADAKVHQ---GWYSI  213

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D +S F   SAR Q+
Sbjct  214  YTSDDSHSPFNKTSARNQV  232



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 128/206 (62%), Gaps = 13/206 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S +    W  L G  NW+GLLDPL++ LR  I+  G+  QATYD+FN +  SKYAGS RY
Sbjct  4    SHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSRY  63

Query  209  GKRSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             +++FF +V L   +   Y V  ++YAT+++ VPEAFL+ SLSRESW +ESNW+GYVAV 
Sbjct  64   ARKNFFSRVGLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAVA  123

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D    ALGRR+I + +RGT   LEW+N      VS   LL     G+ GD      PKV
Sbjct  124  TDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLL-----GEDGD------PKV  172

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GW ++YTS D  S F   SAR Q+
Sbjct  173  HEGWYSIYTSDDSRSPFNKTSARYQV  198



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 132/214 (62%), Gaps = 14/214 (7%)
 Frame = +2

Query  5    LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNS  184
            + + I+  S+A +  W QL G  NW GLL PL++ LR  I+  G+  QATYD+FN +  S
Sbjct  14   MNNNINRSSIANK--WRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAFNTEKAS  71

Query  185  KYAGSCRYGKRSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESN  358
            K+AGSCRY K  FF KV L + +   Y V  Y+YAT+++ VPEAF++ S SRE+W +ESN
Sbjct  72   KFAGSCRYAKNDFFSKVYLENGNPFKYNVTKYIYATSEMDVPEAFIIKSFSREAWSKESN  131

Query  359  WIGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDE  538
            WIGYV V+SD     LGRR+I + +RGT   LEW+N      VSA  L         G+ 
Sbjct  132  WIGYVGVSSDEGKDVLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLF--------GNN  183

Query  539  EDDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
              D  PKV  GW ++YTS+DP S F   SAR Q+
Sbjct  184  IID--PKVHQGWYSIYTSEDPRSPFNKTSARNQV  215



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 130/206 (63%), Gaps = 13/206 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S +    W  L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  SKYAGS RY
Sbjct  42   SRSIAKKWKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKTSKYAGSSRY  101

Query  209  GKRSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             +++FF KV L  A+   Y V  ++YAT+++ VPEAFL+ SLSRESW +ESNW+ YVAV 
Sbjct  102  ARKNFFSKVGLEKANPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMAYVAVA  161

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D    ALGRR+I + +RGT   LEW++      VSA ++L          EE D  PKV
Sbjct  162  TDEGKAALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNIL---------SEEGD--PKV  210

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GW ++YTS D +S F   SAR Q+
Sbjct  211  HQGWYSIYTSNDSHSPFNKTSARHQV  236



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G ENW+ LLDPL++ LR  I+  G+  QATYD+F  +  SK+AGS RY +  FF 
Sbjct  9    WRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSRYARADFFS  68

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   YQV  +LYAT+++ VPEAF++ SLSRE+W RESNW+GYVAV +D     
Sbjct  69   KVGLVKTNPFKYQVTKFLYATSRIEVPEAFIIKSLSREAWSRESNWMGYVAVATDEGKAV  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT  DLEW++ F    VSA  +L    +           PKV  GWL++
Sbjct  129  LGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTND-----------PKVHQGWLSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F   SAR+Q+
Sbjct  178  YTSDDPRSPFNKASARDQV  196



>gb|AFK35349.1| unknown [Lotus japonicus]
Length=246

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 124/199 (62%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G ++W  LLDPL++ LR  I+  G+  QATYD+FN +  SK AG+ RYGK  FF 
Sbjct  42   WQQLSGQDDWNNLLDPLDIDLRQYIIHYGERAQATYDTFNTEKASKNAGNTRYGKDDFFS  101

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   Y V  +LYAT+K+ +PEAF++ SLSRE+W RESNWIGYVAV +D     
Sbjct  102  KVSLEQGNPFKYSVTKFLYATSKIDLPEAFIVKSLSREAWSRESNWIGYVAVATDEGKAV  161

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT   LEW++ F    V A  +  +          + K PKV  GW ++
Sbjct  162  LGRRDIVVAWRGTVQTLEWVDDFQFILVPAPKVFGN----------NSKNPKVHQGWYSI  211

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F   SAR+Q+
Sbjct  212  YTSDDPRSPFNITSARDQV  230



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 13/206 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S +    W  L G ++WE LLDPLN+ LR  IL  G+  QA YD+F  +  SK+AG CRY
Sbjct  18   SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  77

Query  209  GKRSFFHKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             +R FF KV L   + Y+  V  +LYAT+++ VP+AF++ SLSRE+W +ESNWIGYVAV 
Sbjct  78   ARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVA  137

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D     LGRR+I + +RGT   LEW+N F    VSA  +L     G+KGD      P+V
Sbjct  138  TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKIL-----GEKGD------PRV  186

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GW ++YTS D  S F  +SAR+Q+
Sbjct  187  HQGWYSIYTSDDSRSPFNRISARDQV  212



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 127/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G   W+GLLDPLN+ LR  I+  G+  QATYD+FN++  SKYAGS RY +++FF 
Sbjct  40   WKHLSGENKWDGLLDPLNIDLRRYIIHYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFS  99

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   Y V  ++YAT+++ VPEAFL+ SLSRESW +ESNW+ Y+AV +D     
Sbjct  100  KVGLEKGNPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMAYIAVATDEGKAV  159

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA ++L     G++GD      PKV  GW ++
Sbjct  160  LGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNIL-----GEEGD------PKVHQGWYSI  208

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR Q+
Sbjct  209  YTSDDSRSPFNKTSARHQV  227



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGS RY K+SFF 
Sbjct  9    WRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSFFS  68

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  69   KVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      V A  +    T+           PKV  GW ++
Sbjct  129  LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-----------PKVHQGWYSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F   SAR Q+
Sbjct  178  YTSEDPRSPFNKTSARTQV  196



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 13/206 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S +    W  L G ++WE LLDPLN+ LR  IL  G+  QA YD+F  +  SK+AG CRY
Sbjct  58   SNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFAGGCRY  117

Query  209  GKRSFFHKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             +R FF KV L   + Y+  V  +LYAT+++ VP+AF++ SLSRE+W +ESNWIGYVAV 
Sbjct  118  ARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIGYVAVA  177

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D     LGRR+I + +RGT   LEW+N F    VSA  +L     G+KGD      P+V
Sbjct  178  TDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKIL-----GEKGD------PRV  226

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GW ++YTS D  S F  +SAR+Q+
Sbjct  227  HQGWYSIYTSDDSRSPFNRISARDQV  252



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 135/208 (65%), Gaps = 15/208 (7%)
 Frame = +2

Query  23   FQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSC  202
             QS+AT   W  L G  NW+ LLDPL++ LR  I++ G+  QATYD+FN++  S +AGS 
Sbjct  2    LQSIATR--WKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSS  59

Query  203  RYGKRSFFHKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVA  376
            RY K +FF K+ L  A+ Y+  V  +LYAT+++ VP+AF++ SLSRE+W RESNW+GYVA
Sbjct  60   RYSKANFFSKLGLEKANPYKYNVTKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVA  119

Query  377  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVP  556
            V +D     LGRR+I + +RG+   LEWIN F    VSA  +L     G K D      P
Sbjct  120  VATDEGKAVLGRRDILIAWRGSVQALEWINDFNFILVSASGIL-----GTKND------P  168

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             V  GWL++YTS DP S + T SAR+Q+
Sbjct  169  NVHQGWLSIYTSDDPRSAYNTTSARQQV  196



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G ++W+GL+DPL++ LR  I+  G+  QA YD+FN +  SKYAGS RY K+SFF 
Sbjct  36   WRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRYAKKSFFS  95

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  96   KVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  155

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      V A  +    T+           PKV  GW ++
Sbjct  156  LGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTD-----------PKVHQGWYSI  204

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F   SAR Q+
Sbjct  205  YTSEDPRSPFNKTSARTQV  223



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL++ LR +I+  G+  QATYD+F+ +  S++AGS RY KR FF 
Sbjct  21   WRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFFS  80

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   Y V  +LYAT+++ VP+AFL+  LSRE+W +ESNWIGYVAV +D    A
Sbjct  81   KVGLDKGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKTA  140

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT   LEWI+ F    VSA  +L        G+  D   PKV  GW ++
Sbjct  141  LGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVL--------GEAND---PKVHQGWYSI  189

Query  584  YTSKDPNSRFTTLSAREQL  640
            Y S DP S F   SAR Q+
Sbjct  190  YNSSDPRSPFNKKSARHQV  208



>gb|EPS68357.1| hypothetical protein M569_06414, partial [Genlisea aurea]
Length=191

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G + WEGLLDPL+  LR  I+  G+  QATYD+FN++  SKYAGSCRY KR FF 
Sbjct  4    WKILNGQDRWEGLLDPLDPDLRRWIIHYGERAQATYDAFNSEKASKYAGSCRYLKRDFFS  63

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +  L   +   Y+V  YLYAT+   +P+AFL+ S SRE+W +ESNW+GYVAV +D     
Sbjct  64   RAGLEVGNPYRYRVTRYLYATSNGAMPDAFLVRSWSREAWSKESNWMGYVAVATDEGVGV  123

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    VSA  +         G++E     KV FGW ++
Sbjct  124  LGRRDILIAWRGTVRSLEWVNDFQFGLVSAPEIF-------GGNDE----AKVHFGWYSI  172

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+ +SAR+Q+
Sbjct  173  YTSSDSQSPFSKISARDQV  191



>ref|NP_001044041.1| Os01g0710700 [Oryza sativa Japonica Group]
 sp|Q5NAI4.1|PLA5_ORYSJ RecName: Full=Phospholipase A1-II 5 [Oryza sativa Japonica Group]
 dbj|BAD81525.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05955.1| Os01g0710700 [Oryza sativa Japonica Group]
 dbj|BAG91498.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96630.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 129/197 (65%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN+DS+SKY G+CR+ + +   
Sbjct  20   WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRSTLLD  79

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P+A D  V AYLYAT+        +++S+SRE+W +ESNWIGYVAV++DA + A G
Sbjct  80   RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  139

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            +R IYV +RGT   LEW++V     V  + +L     G  G        +VM GW  +Y+
Sbjct  140  QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDIL---PEGHPGRGRS----RVMKGWYLIYS  192

Query  590  SKDPNSRFTTLSAREQL  640
            S D  S F+  SAR+Q+
Sbjct  193  STDERSPFSKYSARDQM  209



>sp|B8A8C9.1|PLA5_ORYSI RecName: Full=Phospholipase A1-II 5 [Oryza sativa Indica Group]
 gb|EEC71366.1| hypothetical protein OsI_03470 [Oryza sativa Indica Group]
Length=465

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 129/197 (65%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN+DS+S+Y GSCR+ + +   
Sbjct  20   WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSRYCGSCRFSRATLLD  79

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P+A D  V AYLYAT+        +++S+SRE+W +ESNWIGYVAV++DA + A G
Sbjct  80   RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  139

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            +R IYV +RGT   LEW++V     V  + +L     G  G        +VM GW  +Y+
Sbjct  140  QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDIL---PEGHPGRGRS----RVMKGWYLIYS  192

Query  590  SKDPNSRFTTLSAREQL  640
            S D  S F+  SAR+Q+
Sbjct  193  STDERSPFSKYSARDQM  209



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 127/200 (64%), Gaps = 10/200 (5%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W  L G  NWEGLLDPL+++LR  I+R G+  QA+YD+FN+ + SKYAGS RY K+ FF
Sbjct  12   NWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDFF  71

Query  227  HKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
             KV L       Y+V  +LYAT+ + +P AF+  SLSRE+W +ESN+IGYVAV  D    
Sbjct  72   TKVGLAMGKPYKYRVTKFLYATSGIDLPSAFMFKSLSREAWSKESNFIGYVAVAEDESVA  131

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            ALGRR+I + +RGT   LEW+N      VSA S++       K D  DD  PKV  GW +
Sbjct  132  ALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIV------GKSDGNDD--PKVHQGWYS  183

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS DP S F   SAR Q+
Sbjct  184  VYTSDDPKSPFNKTSARYQV  203



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL++ LR +I+  G+  QATYD+F+ +  S++AGS RY KR FF 
Sbjct  21   WRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKRDFFS  80

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+++ VP+AFL+  LSRE+W +ESNWIGYVAV +D    A
Sbjct  81   KVGLDNGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAVATDEGKAA  140

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR++ V +RGT   LEW++ F    VSA  +L        G   D   PKV  GW ++
Sbjct  141  LGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVL--------GKAND---PKVQKGWYSI  189

Query  584  YTSKDPNSRFTTLSAREQL  640
            Y S DP S F   SAR Q+
Sbjct  190  YNSSDPRSPFNKKSARHQV  208



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 135/206 (66%), Gaps = 15/206 (7%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S+AT   W +L G +NW+ LLDPL++ LR +I+  G+  QATYD+FN++  S +AGS RY
Sbjct  4    SIATR--WRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRY  61

Query  209  GKRSFFHKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             K +FF  + L   + Y+  +  +LYAT+++ VP+AF++ SLSRE+W RESNW+GYVAV 
Sbjct  62   SKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAVA  121

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D     LGRR+I + +RG+   LEWI+ F    VSA  +LR+ T+            KV
Sbjct  122  TDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDA-----------KV  170

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              GWL++YTS DP S + T SAR+Q+
Sbjct  171  HQGWLSIYTSDDPRSPYNTTSARQQV  196



>gb|EEE55280.1| hypothetical protein OsJ_03214 [Oryza sativa Japonica Group]
Length=647

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 129/197 (65%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +LLGS +W+GLLDPL+L+LR LIL CGD CQ TYDSFN+DS+SKY G+CR+ + +   
Sbjct  202  WPELLGSAHWDGLLDPLDLTLRRLILLCGDLCQVTYDSFNSDSHSKYCGTCRFSRSTLLD  261

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P+A D  V AYLYAT+        +++S+SRE+W +ESNWIGYVAV++DA + A G
Sbjct  262  RTQFPAAGDLSVAAYLYATSDATAFPGSMVYSMSREAWSKESNWIGYVAVSNDAAAAASG  321

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            +R IYV +RGT   LEW++V     V  + +L     G  G        +VM GW  +Y+
Sbjct  322  QRVIYVAWRGTIRSLEWVDVLKPDLVDHDDIL---PEGHPGRGRS----RVMKGWYLIYS  374

Query  590  SKDPNSRFTTLSAREQL  640
            S D  S F+  SAR+Q+
Sbjct  375  STDERSPFSKYSARDQM  391



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 134/205 (65%), Gaps = 15/205 (7%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S+AT   W +L G +NW+ LLDPL++ LR +I+  G+  QATYD+FN++  S +AGS RY
Sbjct  4    SIATR--WRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRY  61

Query  209  GKRSFFHKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVT  382
             K +FF  + L   + Y+  +  +LYAT+++ VP+AF++ SLSRE+W RESNW+GYVAV 
Sbjct  62   SKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAVA  121

Query  383  SDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            +D     LGRR+I + +RG+   LEWI+ F    VSA  +LR+ T+            KV
Sbjct  122  TDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDA-----------KV  170

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQ  637
              GWL++YTS DP S + T SAR+Q
Sbjct  171  HQGWLSIYTSDDPRSPYNTTSARQQ  195



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 129/200 (65%), Gaps = 15/200 (8%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G E W+ LLDPL++ LR  I+  G+  QATYD+F  +  SK+AGS RY KR FF 
Sbjct  8    WRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRYAKRDFFS  67

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L +A+ Y+  V  +LYAT+++ VPEAF++ SLSRE+W RESNW+GYVAV +D    A
Sbjct  68   KVGLVNANPYKYNVTKFLYATSRMDVPEAFIIKSLSREAWSRESNWMGYVAVATDEGKAA  127

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLL-RSITNGDKGDEEDDKVPKVMFGWLT  580
            LGRR+I + +RG+   LEWI+ F    VSA  +L R+I             P V  GWL+
Sbjct  128  LGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTID------------PFVHQGWLS  175

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS DP + F   SAR+Q+
Sbjct  176  IYTSDDPRAPFNRTSARDQV  195



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 131/205 (64%), Gaps = 15/205 (7%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY K+
Sbjct  46   SENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQ  105

Query  218  SFFHKVMLPSAD----DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
             FF K+ L         Y+V  +LYAT+++ VP+AF++ SLSRE+W +ESNWIGYVAV++
Sbjct  106  DFFAKIGLGKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVST  165

Query  386  DAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
            D  +  LGRR++ + +RGT   LEWI+ F    VSA  +         G+  D K+ +  
Sbjct  166  DEGAAELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIF--------GESSDVKIHQ--  215

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GW ++YTS D  S FT  S R Q+
Sbjct  216  -GWYSIYTSDDRRSPFTNNSVRNQV  239



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ +W+GLLDPL+  LR  I+  G+  QATYDSFN +  S+YAGSC Y K+  F 
Sbjct  8    WKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLYAKKDLFA  67

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y+V  YLYAT+ + +P+AF++ S SRE+W +ESNW+GYVAV +D    A
Sbjct  68   KVGLQNGNPFKYRVTKYLYATSSIQLPDAFIVKSFSREAWSKESNWMGYVAVATDEGKVA  127

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA  +            E+D  PKV  GW ++
Sbjct  128  LGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIF----------TENDDDPKVHQGWYSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT+ D  S F  +SAR+Q+
Sbjct  178  YTTDDSRSPFNKISARDQV  196



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G +NW+ LLDPL++ LR  IL  GD  QATYDSFN++  SK+AG   + +++ F 
Sbjct  9    WRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLFS  68

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L  A+ Y+  +  +LYAT+ + V EAFLL SLSRE+W++ESNWIGY+AV +D    A
Sbjct  69   RVGLAIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKAA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    V A+ L         G   D KV K   GWL++
Sbjct  129  LGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLF--------GASNDSKVHK---GWLSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+D  S F T SAR+Q+
Sbjct  178  YTSQDARSPFNTNSARQQV  196



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 122/199 (61%), Gaps = 11/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL++ LR  ++  G+  QA YD+FN +  SKYAG   Y K+ FF 
Sbjct  27   WRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKYAGDSIYAKKDFFS  86

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   + Y+  V  + YAT+++ VPEAF++  LSRE+W +ESNW+GYVAV +D     
Sbjct  87   KVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAV  146

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RG+   LEW+N      VSAE +         GD  DD  PKV  GW ++
Sbjct  147  LGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIF-------GGDRTDD--PKVHQGWYSI  197

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR+Q+
Sbjct  198  YTSDDQRSPFNKTSARDQV  216



>ref|XP_011462291.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-IIgamma-like 
[Fragaria vesca subsp. vesca]
Length=410

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 10/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NWEGLLDPL++ LR  I+  G+  QATYD+FN +  SK+AGS RY ++SFF 
Sbjct  14   WKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSSRYARKSFFS  73

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L   +   Y V  ++YAT+++ VPEAF++ SLSRE+W +E NWIGYV V +D  +  
Sbjct  74   RVGLEKGNAFRYNVTKFVYATSQIQVPEAFIVKSLSREAWSKELNWIGYVVVATDEGNVL  133

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA ++L        G + +    KV  GW  +
Sbjct  134  LGRRDIVIAWRGTVRSLEWVNDLQFNMVSASNIL--------GHDNNLADAKVHQGWYXI  185

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D +S F   SAR Q+
Sbjct  186  YTSDDSHSPFNKTSARNQV  204



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 122/199 (61%), Gaps = 11/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL++ LR  ++  G+  QA YD+FN +  SKYAG   Y K+ FF 
Sbjct  27   WRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKYAGDSIYAKKDFFS  86

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   + Y+  V  + YAT+++ VPEAF++  LSRE+W +ESNW+GYVAV +D     
Sbjct  87   KVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWMGYVAVATDEGKAV  146

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RG+   LEW+N      VSAE +         GD  DD  PKV  GW ++
Sbjct  147  LGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIF-------GGDRTDD--PKVHQGWYSI  197

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR+Q+
Sbjct  198  YTSDDQRSPFNKTSARDQV  216



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 131/208 (63%), Gaps = 15/208 (7%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S  +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY
Sbjct  43   SGKSENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRY  102

Query  209  GKRSFFHKVMLPSAD----DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVA  376
             K+ FF K+ L         Y+V  +LYAT+++ VP+AF++ SLSRE+W +ESNWIGYVA
Sbjct  103  SKQDFFAKIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVA  162

Query  377  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVP  556
            V +D  +  LGRR++ + +RGT   LEW++ F    VSA  +         G+  D K+ 
Sbjct  163  VGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIF--------GESSDVKIH  214

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +   GW ++YTS D  S FT  S R Q+
Sbjct  215  Q---GWYSIYTSDDRRSPFTNNSVRNQV  239



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 130/205 (63%), Gaps = 15/205 (7%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            +E  W QL+GS+NW+GLL+PL++ LR  ++  G   QATYD+FN +  SK+AGS RY K+
Sbjct  40   SENNWKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQ  99

Query  218  SFFHKVMLPSAD----DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
             FF K+ L         Y+V  +LYAT+++ VP+AF++ SLSRE+W +ESNWIGYVAV +
Sbjct  100  DFFAKIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAVGT  159

Query  386  DAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
            D  +  LGRR++ + +RGT   LEW++ F    VSA  +         G+  D K+ +  
Sbjct  160  DEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIF--------GESSDVKIHQ--  209

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GW ++YTS D  S FT  S R Q+
Sbjct  210  -GWYSIYTSDDRRSPFTNNSVRNQV  233



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 126/198 (64%), Gaps = 11/198 (6%)
 Frame = +2

Query  53   HQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFHK  232
             +L G +N +GL DPL++ LR  IL  G+  QATYD+F  +  S+YAG CRY +R FF K
Sbjct  10   RELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCRYARRDFFDK  69

Query  233  VMLPSADD--YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            V   +     Y+V  + YAT+ + VPEAFL+ SLSRE+W +ESNW+GYVAV +D   K L
Sbjct  70   VATSTDQQSLYRVTKFFYATSSIDVPEAFLIKSLSREAWSKESNWMGYVAVATDEGKKVL  129

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR++ V +RGT   LEWIN      VSA ++L   ++G+         P+V  GWL++Y
Sbjct  130  GRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGN---------PQVHRGWLSIY  180

Query  587  TSKDPNSRFTTLSAREQL  640
            TS DP S +   SAR+Q+
Sbjct  181  TSNDPRSPYNKDSARDQV  198



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 124/200 (62%), Gaps = 14/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGL+DPLN  LR  I+  G+  QA+YD+FN++  SK AG+ RY K + F 
Sbjct  16   WMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSKNNLFT  75

Query  230  KVMLPSADD---YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L    +   Y+V  YLYAT+ + VPEAF++ SLSRESW +ESNWIG++AV +D    
Sbjct  76   KVGLDKDHNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGKI  135

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            ALGRREI + +RGT   L+W+N      VSA  + R  T+           P++  GW +
Sbjct  136  ALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTD-----------PQIHRGWYS  184

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS+DP S F   S R+Q+
Sbjct  185  IYTSEDPRSPFNNTSVRDQV  204



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ NWEGLLDPL+  LR  ++  G+  QA  D+FNND  SKYAG  RY K++ F 
Sbjct  12   WRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRYSKKNLFS  71

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV +  ++   Y+V  Y+YAT+ + VPEAF++ SLS E+W +ESNWIG+VAV +D    A
Sbjct  72   KVGIEISNPFKYEVTKYVYATSSIQVPEAFIIKSLSGEAWSKESNWIGFVAVATDEGEVA  131

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +R T   +EW N F    VSA ++      G+  D      PKV  GW ++
Sbjct  132  LGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIF-----GENSD------PKVHHGWYSM  180

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F   SAR+Q+
Sbjct  181  YTSNDPRSLFNKASARDQV  199



>gb|KJB69607.1| hypothetical protein B456_011G033600 [Gossypium raimondii]
Length=417

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 124/199 (62%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G +NW  LLDPL++ LR  I+  G+  QA YD+FN +  SK+AGS  YGK+ FF 
Sbjct  26   WKDLSGQKNWGELLDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKFAGSSLYGKKDFFS  85

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
             V L   +   YQV  +LYAT+++ VPEAF++  +SRE+W++ESNWIGYVAV +D     
Sbjct  86   NVNLEKGNPYRYQVTKFLYATSQIQVPEAFIVKPISREAWNKESNWIGYVAVATDEGKAM  145

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEWI+ F    VS   +L        GD+  D   KV  GW ++
Sbjct  146  LGRRDIVIAWRGTVQTLEWIDDFEFNMVSPGKIL--------GDQRSD--VKVHEGWYSI  195

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S +   SAR+Q+
Sbjct  196  YTSDDPRSPYNKSSARDQV  214



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ NWEGLLDPL+  LR  ++R G+  QA  D+FN +  SKYAG+CRY K++FF 
Sbjct  49   WRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRYSKKNFFS  108

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +  +  ++   Y+V  Y+YAT+ + VPEA  + SLSRE+W +ESNW G+VAV +D    A
Sbjct  109  RTGIEISNPFKYEVTKYIYATSAVQVPEALFIKSLSREAWSKESNWAGFVAVATDKGKIA  168

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I +V+RG+   LEW N F    VSA  +      G+K D      PKV  GW ++
Sbjct  169  LGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIF-----GEKSD------PKVHHGWYSI  217

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR+Q+
Sbjct  218  YTSDDSRSLFNKESARDQV  236



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 124/201 (62%), Gaps = 15/201 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGL+DPL+ +LR  I+  G+  QA+YD+FN++  SK AG+ RY + +FF 
Sbjct  24   WMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSNKASKNAGNNRYSRNNFFT  83

Query  230  KVMLPSADD----YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            KV L    +    Y+V  YLYAT+ + VPEAF++ SLSRESW +ESNWIG++AV +D   
Sbjct  84   KVGLDKDHNNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIAVCTDEGK  143

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
             ALGRREI + +RGT   L+W+N      VSA  + R  T            P++  GW 
Sbjct  144  IALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTE-----------PQIHRGWY  192

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            ++YTS DP S F   S R+Q+
Sbjct  193  SIYTSDDPRSPFNNTSVRDQV  213



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 124/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +W+GL++PL++ LR  I+  G+  QA YD+F ++  SKYAG  RY KR+FF 
Sbjct  37   WRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEKVSKYAGCSRYAKRNFFS  96

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+ + +PEAF++ S SRE+W RESNWIGYVAV +D    A
Sbjct  97   KVGLMNGNAFTYSVTKFLYATSSIDLPEAFIIKSFSREAWSRESNWIGYVAVATDEGKAA  156

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N      VSA  +    T+           PKV  GW ++
Sbjct  157  LGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTD-----------PKVHQGWYSI  205

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S F   SAR Q+
Sbjct  206  YTSEDPLSPFNKSSARSQV  224



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 13/203 (6%)
 Frame = +2

Query  38   TEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKR  217
            T   W  L G+ NWEGLLDPL+  LR  ++R G+  QA  D+FN +  SKYAGSCRY K+
Sbjct  47   TAERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCRYSKK  106

Query  218  SFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            + F +  +  ++   Y+V  Y+YAT+ + VP+A  + SLSRE+W +ESNW+G+VAV +D 
Sbjct  107  NLFSRTGIEISNPFKYEVTKYIYATSSVQVPDALFIKSLSREAWSKESNWVGFVAVATDK  166

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
               ALGRR+I +V+RG+   +EW N F    VS+  +      G+K D      PKV  G
Sbjct  167  GKIALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIF-----GEKSD------PKVHHG  215

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            W ++YTS D  S F   SAR+Q+
Sbjct  216  WYSIYTSDDSRSPFNKGSARDQV  238



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 126/199 (63%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+ LL+PL++ LR  I+  G+  QATYD+FN+   SK+AGS  Y K  FF 
Sbjct  10   WKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSSLYAKNGFFS  69

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   + Y+  V  + YAT+++ +PEAF++ SLSRE+W +ESNW+GY+AV +D  +  
Sbjct  70   KVGLDKGNPYKYTVTKFFYATSQIQLPEAFIVKSLSREAWSKESNWMGYIAVATDEGTAV  129

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW++      VSA  LL     G+ G++     PKV  GW ++
Sbjct  130  LGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLL-----GESGND-----PKVHQGWHSV  179

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F   SAR+Q+
Sbjct  180  YTSDDPLSPFNKSSARDQV  198



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G +NW+ LLDPL++ LR  IL  GD  QATYDSFN++  SK+AG   + +++ F 
Sbjct  90   WRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSRKNLFS  149

Query  230  KVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L  A+ Y+  +  +LYAT+ + V EAFLL SLSRE+W++ESNWIGY+AV +D    A
Sbjct  150  RVGLSIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAVATDEGKAA  209

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    V A+ L         G   D KV K   GWL++
Sbjct  210  LGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLF--------GAANDSKVHK---GWLSI  258

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+D  S F   SAR+Q+
Sbjct  259  YTSQDARSPFNINSARQQV  277



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (63%), Gaps = 8/201 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NW+GLL PL++ LR  ++  G+  Q+TYD+FN+   SKY GS  Y K+ FF 
Sbjct  29   WKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIYSKKDFFS  88

Query  230  KVMLPSADD----YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVS  397
            KV L   ++    Y+V  YLYAT+ + VP+AF+L S SRE+W +ESN+IGYVAV  D   
Sbjct  89   KVGLVKGNNDPYKYRVTKYLYATSGIDVPDAFILKSSSREAWSKESNFIGYVAVAEDTAV  148

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
             +LGRR+I + +RG+   LEW+N      VSA  +   + +GD  D +  K  KV  GW 
Sbjct  149  ASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDV---VGDGDVADHDKAKA-KVHQGWY  204

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            ++YTS DP S F   SAR+Q+
Sbjct  205  SIYTSDDPRSPFNKTSARDQV  225



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W  LLDPL++ LR  I+  G+  QATYD+FNN+  SK+AGS  YGK  FF 
Sbjct  26   WKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKFAGSSLYGKEDFFS  85

Query  230  KVMLPSADDY--QVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   + Y  QV  +LYAT+++ +PEAF++ S SRE+W +ESNWIGYVAV +D     
Sbjct  86   KVNLEKGNPYRYQVTKFLYATSQIQLPEAFIVKSSSREAWSKESNWIGYVAVATDEGKDV  145

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEWIN      VS E +         G E  D   KV  GW ++
Sbjct  146  LGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIF--------GHERRD--IKVHEGWYSI  195

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+D  S +   SAR+Q+
Sbjct  196  YTSEDSRSPYNKSSARDQV  214



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 122/199 (61%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+GLLDPL++ LR  I+  G   QATYD+FN++  SKYAG+ RY K+ FF 
Sbjct  9    WRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSRYPKKDFFS  68

Query  230  KVMLPSADD--YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V+ +LYAT+K    EAFLL S S++SW ++SNWIGYVAV +DA  +A
Sbjct  69   KVGLENGNPFRYDVKKFLYATSKASDAEAFLLKSFSKDSWSKQSNWIGYVAVATDAGKEA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW+  F         L   I  GD          +V  G+ +L
Sbjct  129  LGRRDIVVAWRGTIQAAEWVKDFHFHL----DLAPEIFGGDSS-------AQVHHGFYSL  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS +P S+FT  SAR Q+
Sbjct  178  YTSSNPGSKFTDTSARNQV  196



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 128/210 (61%), Gaps = 16/210 (8%)
 Frame = +2

Query  29   SMATEP---TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGS  199
            SMA+ P    W  L G  +W+  L+PL+L LR  I+  G+  QATYD+FN ++ SKYAGS
Sbjct  21   SMASRPLGKRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGS  80

Query  200  CRYGKRSFFHKVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGY  370
              Y ++ FF KV L        YQV  +LY+T+++ VP++FL+  +SRE W +ESNWIGY
Sbjct  81   SIYSRQDFFSKVGLEKGHPYCKYQVTKFLYSTSQISVPDSFLVFPVSREGWTKESNWIGY  140

Query  371  VAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDK  550
            VAV +D   + LGRR+I V +RGT   LEWIN F    ++A+ +      GD GD     
Sbjct  141  VAVATDQGKQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIF-----GDNGDGV---  192

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
               V  GW ++YTS+D  S F   SAR+Q+
Sbjct  193  --GVHQGWYSIYTSEDERSPFNKASARDQV  220



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 121/204 (59%), Gaps = 10/204 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L GS+ WEGL DPL+  LR  IL  GD CQATYD+F +D  SKYAGS RYG   FF 
Sbjct  10   WRLLQGSQRWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHFFE  69

Query  230  KVML---PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
             + L   P+   Y +  ++YAT+ + VPEAF+  SLSRE   RESNW+GYVA  +D    
Sbjct  70   DLGLTKRPTEWGYSLSKFIYATSTIKVPEAFIRTSLSREGGSRESNWMGYVAHVTDTGKT  129

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKV----PKVMF  568
              GRR+I V +RGT   LEW+N F     S  +LL   T  D+   E DKV     +V  
Sbjct  130  QYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDR---ETDKVLRNDARVQR  186

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            GW  +YTS+D  S F   SAREQ+
Sbjct  187  GWFDIYTSEDSRSPFNKSSAREQV  210



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 124/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ +WEGLL+PL+  LR  ++  G+  QAT D+FN +  SKYAGSCRY K++   
Sbjct  34   WRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRYSKKNLLS  93

Query  230  K--VMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +  + +P+  +Y+V  Y+YAT+ + VPEA  + SLSRE+W +ESNW+G+VAV +D    A
Sbjct  94   RAGIEMPNPFNYEVTKYIYATSSVQVPEALFIKSLSREAWSKESNWVGFVAVATDEGKMA  153

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RG+   +EW N F    VSA  +      G K       +PKV  GW ++
Sbjct  154  LGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIF-----GQK------SIPKVHHGWYSV  202

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F   SAR+Q+
Sbjct  203  YTSSDSRSPFNKASARDQV  221



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 121/199 (61%), Gaps = 12/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ +WEGLLDPL+  LR  I+  G   QAT D+FN +  SKYAGSCRY K++   
Sbjct  45   WRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKISKYAGSCRYSKKNLLS  104

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V +  ++   Y+V  Y+YAT+ + VPEA ++ SLSRE+W +ESNW+G+VAV +D    A
Sbjct  105  QVGIEMSNPFKYEVTKYIYATSSVQVPEALIIKSLSREAWSKESNWVGFVAVATDEGKVA  164

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RG+   +EW N F    VSA  +                +PKV  GW ++
Sbjct  165  LGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIF----------GHQKSIPKVHHGWYSV  214

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S F+  SAR Q+
Sbjct  215  YTSNDSRSPFSKASARNQV  233



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 121/197 (61%), Gaps = 6/197 (3%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G ENW+GLL+PL+++LR  I++ G+  QATYD+F +D  SKYAGS RY K + F 
Sbjct  8    WEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRYSKENLFA  67

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L   + Y V  Y YAT+  P+PEAF++ S SRE+W +ESN++GYVAV +D     LG
Sbjct  68   KVGL-DPEMYHVTKYFYATSSFPLPEAFMVKSWSREAWSKESNFMGYVAVATDKGKAVLG  126

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT   LEW+N      V A  +      G          P V  GW ++YT
Sbjct  127  RRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVF-----GGGNSILPLFKPLVHQGWKSIYT  181

Query  590  SKDPNSRFTTLSAREQL  640
            S DP S F   SAR+Q+
Sbjct  182  SDDPKSPFNKASARDQV  198



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 121/204 (59%), Gaps = 10/204 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L GS+ WEGL DPL+  LR  IL  GD CQATYD+F +D  SKYAGS RYG   FF 
Sbjct  10   WRLLQGSQLWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSSRYGGPHFFD  69

Query  230  KVML---PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
             + L   P+   Y +  ++YAT+ + VPEAF+  SLSRE   RESNW+GYVA  +D    
Sbjct  70   DLGLTKRPTEWGYSLSKFIYATSTIKVPEAFITTSLSREGGSRESNWMGYVAHVTDTGKT  129

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKV----PKVMF  568
              GRR+I V +RGT   LEW+N F     S  +LL   T  D+   E DKV     +V  
Sbjct  130  QYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDR---ETDKVLRNDVRVQR  186

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            GW  +YTS+D  S F   SAREQ+
Sbjct  187  GWFDIYTSEDSRSPFNKSSAREQV  210



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 126/207 (61%), Gaps = 10/207 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S AT   W +L G+ +W GLLDPL++ LR  I+  G+  QATYD FN +  S +AG+C Y
Sbjct  26   SSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLY  85

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEA-FLLHSL--SRESWDRESNWIGYVAV  379
            G+      V + +A  Y V  ++YAT+ LPVP + F L  L  +RE+W RESNWIGYVAV
Sbjct  86   GRADLLPGVGVAAAGRYAVTRFVYATSALPVPGSDFPLLPLPETREAWTRESNWIGYVAV  145

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPK  559
             +D  +  LGRR++ V +RGT  DLEW N F   PVSA  +L S           + +  
Sbjct  146  ATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAA-------NPLAV  198

Query  560  VMFGWLTLYTSKDPNSRFTTLSAREQL  640
            V  G+L++YTS + +SRF   SAR+Q+
Sbjct  199  VHQGFLSVYTSSNADSRFNKASARDQV  225



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 11/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G +NW+ LLDPL++ LR  IL  G+  +ATYD+F  +  S+YAG CRY +R FF 
Sbjct  9    WRELNGKDNWKDLLDPLDIDLRRNILLYGEMAEATYDAFITEKKSRYAGDCRYARRDFFD  68

Query  230  KVMLPSADD--YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV + +     Y+V  + YAT+ + VP+AFL+ SLSRE+W +ESNW+GYVAV +D   K 
Sbjct  69   KVAISTGQHSLYRVTKFFYATSSIDVPDAFLIRSLSREAWSKESNWMGYVAVATDEGKKV  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR++ V +RGT   LEWIN      VSA  +L    +GD         P+V  GWL++
Sbjct  129  LGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGD---------PQVHRGWLSI  179

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S +   SAR Q+
Sbjct  180  YTSDDPRSPYNKDSARNQV  198



>gb|KJB57431.1| hypothetical protein B456_009G163800 [Gossypium raimondii]
Length=386

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 115/199 (58%), Gaps = 27/199 (14%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G  NW  LLDPL++ LR  +   G+  QATYD+FN +  SKYAGS  YGK+ FF+
Sbjct  10   WKQLSGQNNWGELLDPLDIDLRRYLTHYGEMAQATYDAFNTEKASKYAGSSLYGKKDFFY  69

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
             V L   +   YQV  + YAT+++ VPEAFL+  +SRE+W +ESNWIGYVAV +D     
Sbjct  70   NVGLEKGNPYKYQVTKFFYATSQIRVPEAFLVKPMSREAWSKESNWIGYVAVATDEGKDV  129

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEWI                         +D +   V  GW ++
Sbjct  130  LGRRDIAIAWRGTVETLEWI-------------------------DDVEFKLVHEGWYSI  164

Query  584  YTSKDPNSRFTTLSAREQL  640
            Y S+DP S +   SAR+Q+
Sbjct  165  YISEDPRSPYNKTSARDQV  183



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 123/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+  WEGLLDPL+L LR  I+  G+  QA YD+FN++  SKYAGS RY K + F 
Sbjct  32   WKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSEKASKYAGSSRYAKENLFS  91

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV +  A+   Y+V  Y YAT+   VP+AF+L S SRE+W RESNWIGYVAV +D    A
Sbjct  92   KVGIEQANPFKYRVTKYFYATSSTKVPDAFILKSWSREAWSRESNWIGYVAVATDEGKSA  151

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    VSA  +         G++E    P V  GW ++
Sbjct  152  LGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIF-------GGNDE----PNVHLGWYSI  200

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F   SAR Q+
Sbjct  201  YTSDDPRSPFNKTSARNQV  219



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 124/205 (60%), Gaps = 20/205 (10%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W QL G ENW+GLL+PL+ +LR  I++ G+  QATYD+F ++  SKYAGS RY K + F
Sbjct  7    NWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRYSKENLF  66

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             +V L   + Y +  Y YAT+  P+PEAF++ S SRE+W +ESN++G+VAV +D     L
Sbjct  67   KRVGL-DPEMYHITKYFYATSSFPLPEAFMIRSWSREAWSKESNFMGFVAVATDKGKAVL  125

Query  407  GRREIYVVFRGTTTDLEWIN--VFIAKPV-----SAESLLRSITNGDKGDEEDDKVPKVM  565
            GRR+I + +RGT   LEW+N   F+  P      +  S+L  +             P V 
Sbjct  126  GRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLK------------PLVH  173

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GW ++YTS DP S F   SAR+Q+
Sbjct  174  QGWNSVYTSDDPRSPFNKASARDQV  198



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+GLL PL+  LR  I+  G+  QATYD+FN+++ SKYAGS  Y ++ FF 
Sbjct  9    WRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSRQDFFS  68

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L   +    YQV  +LYAT+++ VP++FL+  +SRE   +ESNW+GYVAVT+D  ++
Sbjct  69   KVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTE  128

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEWIN F    V A+++            E  K  +V  GW +
Sbjct  129  LLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIF----------GEKSKGVQVHQGWYS  178

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS D  S F   SAR+Q+
Sbjct  179  IYTSSDERSPFNKSSARDQV  198



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+GLL PL+  LR  I+  G+  QATYD+FN+++ SKYAGS  Y ++ FF 
Sbjct  9    WRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSRQDFFS  68

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L   +    YQV  +LYAT+++ VP++FL+  +SRE   +ESNW+GYVAVT+D  ++
Sbjct  69   KVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAVTTDEGTE  128

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEWIN F    V A+++            E  K  +V  GW +
Sbjct  129  LLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIF----------GEKSKGVQVHQGWYS  178

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS D  S F   SAR+Q+
Sbjct  179  IYTSSDERSPFNKSSARDQV  198



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 129/199 (65%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G +NWEGLLDPL+L LR L+L  GD  QA YD+FN++  SKYAGSCRY KR FF 
Sbjct  10   WRILQGRDNWEGLLDPLDLDLRRLLLLYGDMAQAAYDAFNHERVSKYAGSCRYAKRDFFS  69

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +  +Y +  ++YAT+ + VPEAFL+ SLSRE+W +ESNW+G+VAV +D   K 
Sbjct  70   KVNLVNGNPFEYTITKFIYATSSVQVPEAFLIRSLSREAWSKESNWMGFVAVATDNGKKQ  129

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR++ + +RGT   LEW+  F    VSA  +         G  +D KV +   GW ++
Sbjct  130  LGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPI--------SGGGDDAKVHR---GWFSI  178

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S +   SAREQ+
Sbjct  179  YTSDDSKSPYNNTSAREQV  197



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 126/200 (63%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  44   WKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYARKDFFA  103

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  104  KVCLEKAHPYTKYKVTKFLYATSEVHVPESFLLFPISREGWTKESNWMGYVAVTDDQGTA  163

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I VV+RG+   LEW+N F    V+A+ +      G+K D+      ++  GW +
Sbjct  164  LLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIF-----GEKNDQ-----VQIHQGWYS  213

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AREQ+
Sbjct  214  IYMSQDDRSPFTKANAREQV  233



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+ LLDPL+  LRH I+  G+  QATYDSFN    SKYAGS  Y K  FF+
Sbjct  9    WKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSLYAKDEFFN  68

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L   +   Y+V  +LYAT+++ + EAF++ SLSRE+W +ESNW+G+VAV++D    A
Sbjct  69   RVHLEKGNPFKYRVTKFLYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGKVA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    VSA  +L     G+ G+      PKV  GW ++
Sbjct  129  LGRRDIVIAWRGTIQILEWVNDFEFNLVSASKIL-----GESGN------PKVHQGWYSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S +   SAR+Q+
Sbjct  178  YTSDDSRSPYNKNSARDQV  196



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 125/200 (63%), Gaps = 10/200 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G+ NW+GLLDPL+L LR  I+  G   QATYD+FN++  SKYAGS RY K +   
Sbjct  30   WKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSSRYSKDNLLS  89

Query  230  KVMLPSAD--DYQVEAYLYATAKL-PVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV +  A+   Y+V  Y+YAT+ L  VP+AF+L S SRE+W +ESNWIGYVAV +D    
Sbjct  90   KVGVDKANPFKYRVTKYVYATSSLTEVPDAFILRSWSREAWTKESNWIGYVAVATDEGKL  149

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            ALGRR+I + +RGT   LEWIN F    V A  +  +  +G       D  P+V  GW +
Sbjct  150  ALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDG-------DDQPRVHLGWYS  202

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS DP S F   SAR Q+
Sbjct  203  IYTSDDPRSPFNKTSARNQV  222



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 126/204 (62%), Gaps = 13/204 (6%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            + +  W  L G  +W+ LLDPL+  LR  I+  G+  QATYDSFN    SKYAGS  Y K
Sbjct  21   SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKYAGSSLYAK  80

Query  215  RSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
              FF KV L   +   Y+V  +LYAT+++ +PEAF++ SLSRE+W +ESNWIG+VAV +D
Sbjct  81   DDFFSKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATD  140

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                 LGRR+I + +RGT   LEW+N F    VSA  +L     G+ GD      PKV  
Sbjct  141  EGKTTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKIL-----GESGD------PKVHQ  189

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            GW ++YTS D  S++   SAR+Q+
Sbjct  190  GWYSIYTSDDSRSQYNKNSARDQV  213



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 126/200 (63%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  39   WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  99   KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+ +      G+K D+      ++  GW +
Sbjct  159  LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIF-----GEKNDQ-----VQIHQGWYS  208

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT ++AR+Q+
Sbjct  209  IYMSQDERSPFTKVNARDQV  228



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 117/199 (59%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NW+GLLDPL++ LR  I+  G   QATYD FN++  S  AG+ RY KR FF 
Sbjct  8    WRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRYSKREFFG  67

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   Y V  +LYAT+K    E FLL S S+++W  +SNWIGYVAV +D   +A
Sbjct  68   KVGLENGNPFKYLVTKFLYATSKASDSEKFLLRSFSKDAWSLQSNWIGYVAVATDEGKEA  127

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW+  F      A  +      GD    E      +  G+ +L
Sbjct  128  LGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIF-----GDAASAE------LHHGFYSL  176

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTSK+P S+FT  SAR Q+
Sbjct  177  YTSKNPGSKFTNTSARNQV  195



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 126/200 (63%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN +++S++AG+  Y ++ FF 
Sbjct  22   WRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGASIYSRKDFFA  81

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  82   KVGLEKAHPYTKYKVTKFLYATSEIHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  141

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+ +      G+K D+      ++  GW +
Sbjct  142  LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIF-----GEKNDQ-----VQIHQGWYS  191

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AR+Q+
Sbjct  192  IYMSQDERSPFTKANARDQV  211



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 125/200 (63%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  39   WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  99   KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+ +      G+K D+      ++  GW +
Sbjct  159  LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIF-----GEKNDQ-----VQIHQGWYS  208

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AR+Q+
Sbjct  209  IYMSQDERSPFTKANARDQV  228



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  21   WRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGASIYSRKDFFA  80

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A+    Y+V  +LYAT+++ VP++FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  81   KVGLEKANPYTKYKVTKFLYATSQIHVPDSFLLFPVSREGWTKESNWMGYVAVTDDQGTA  140

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V A+ +           E++DKV ++  GW +
Sbjct  141  VLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIF---------GEKNDKV-QIHQGWYS  190

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S D  S F   +AR+Q+
Sbjct  191  IYMSDDQRSPFNKANARDQV  210



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 10/207 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S  T   W +L G+ +W GLLDPL++ LR  ++  G+  QA  D FN++  S +AG+C Y
Sbjct  25   SPTTAVRWRELHGNNSWNGLLDPLDIDLRKSVIAYGELAQAAQDGFNHERRSPHAGACLY  84

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFL---LHSLSRESWDRESNWIGYVAV  379
            G+      V + +A  Y V  + YAT+ +PVPE+ L   L  L   +W RESNWIGYVAV
Sbjct  85   GRSDLLAGVGVAAAGSYAVTKFFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGYVAV  144

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPK  559
             +D     LGRR+I V +RGT TDLEW N F   PVSA  +L S           + +  
Sbjct  145  ATDEGVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSAAPVLGS-------SAAANPLAM  197

Query  560  VMFGWLTLYTSKDPNSRFTTLSAREQL  640
            V  G+L++YTS + NS++   SAR+Q+
Sbjct  198  VHQGFLSVYTSSNANSKYNKASARDQV  224



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 125/209 (60%), Gaps = 19/209 (9%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W QL G  NWEGLLDPL++ LR  I++ G+    TYD+F ++  SKYAG+ RY
Sbjct  3    SMAEK--WEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               + F +  L     Y+V  Y YAT+ +P+P AFL+ SLSRE+W++ESN++GY+AV +D
Sbjct  61   SMENLFTRAGLDPLK-YKVTKYFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWIN----VFIAKP-VSAESLLRSITNGDKGDEEDDKV  553
                ALGRR+I + +RGT   LEW+N    + I  P V  +  L  +             
Sbjct  120  EGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQ-----------  168

Query  554  PKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            P V  G+  +YTS+DP S F   SAR+Q+
Sbjct  169  PLVHHGFYNIYTSEDPRSMFNQASARDQV  197



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NW+ LLDPL+  LRH I+  G+  QATYDSFN    SKYAG   Y K  FF+
Sbjct  9    WKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSLYAKDEFFN  68

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L   +   Y+V  ++YAT+++ + EAF++ SLSRE+W +ESNW+G+VAV++D    A
Sbjct  69   RVHLEKGNPFKYRVTKFVYATSQVHISEAFIIKSLSREAWSKESNWMGFVAVSTDEGKVA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    VSA  +L     G+ G+      PKV  GW ++
Sbjct  129  LGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKIL-----GESGN------PKVHQGWYSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S +   SAR+Q+
Sbjct  178  YTSDDSRSPYNKNSARDQV  196



>ref|XP_010557126.1| PREDICTED: phospholipase A1-IIbeta isoform X2 [Tarenaya hassleriana]
Length=327

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 113/199 (57%), Gaps = 10/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GLLDPL+  LR  I+  G+  + TYD+FN+D  SKYAG   + K   F 
Sbjct  9    WKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKTELFA  68

Query  230  KVMLPSADDY--QVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +      + Y  +V  + YAT+ + +P +F++ SLSRE+W +ESNW+GY+AV +D   + 
Sbjct  69   RTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAVATDEGKEK  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW N F      A  L      G K        P++  GWL L
Sbjct  129  LGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHK--------PQIASGWLAL  180

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT+ DP S F   SAREQ+
Sbjct  181  YTTDDPRSPFNKTSAREQV  199



>ref|XP_009137120.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=349

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 124/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  37   WRDLNGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  96

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  LSRE   +ESNW+GYVAVT D  + 
Sbjct  97   KVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPLSREGCTKESNWMGYVAVTDDQGTA  156

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+++      G+K D+      ++  GW +
Sbjct  157  VLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIF-----GEKNDQ-----VQIHQGWYS  206

Query  581  LYTSKDPNSRFTTLSAREQ  637
            +Y S+D  S F+  +AR+Q
Sbjct  207  IYMSEDERSPFSKANARDQ  225



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 122/208 (59%), Gaps = 4/208 (2%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S AT   W +L G+ +W GLLDPL++ LR  I+  G+  QATYD FN +  S +AG+C Y
Sbjct  37   SSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACLY  96

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEA-FLLHSL--SRESWDRESNWIGYVAV  379
            G+      V + +A  Y V  ++YAT+ LPVP + F L  L  +RE+W RESNWIGYVAV
Sbjct  97   GRADLLPGVGVAAAGRYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVAV  156

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPK  559
             +D  +  LGRR++ V +RGT  DLEW N F   PVSA  +L S    +           
Sbjct  157  ATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAVVHQGFLS  216

Query  560  V-MFGWLTLYTSKDPNSRFTTLSAREQL  640
            V     LTL TS + +SRF   SAR+Q+
Sbjct  217  VYQLSSLTLTTSCNADSRFNKASARDQV  244



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 123/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEGLLDPL+L LR  ++  G   QATYD+FN+++ SK+AGS RY K   F 
Sbjct  25   WKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYDTFNSENASKFAGSSRYAKNDLFS  84

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
             V +   +   Y+V  Y YAT+   VP+AF++ S SRE+W +ESNW+GYVAV +D    A
Sbjct  85   NVGMDKGNPFKYRVTKYFYATSSAQVPDAFIVPSWSREAWSKESNWMGYVAVATDEGKSA  144

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT  +LEW+N F    V A  +         G  +D   PKV FGW ++
Sbjct  145  LGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIF--------GGNDD---PKVHFGWHSI  193

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S F+  SAR Q+
Sbjct  194  YTSDDPKSPFSKNSARHQV  212



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  39   WRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  98

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  99   KVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYVAVTDDQGTA  158

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+ +      G+K D+      ++  GW  
Sbjct  159  LLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIF-----GEKNDQ-----VQIHQGWYL  208

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AR+Q+
Sbjct  209  IYMSQDERSPFTKANARDQV  228



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 126/207 (61%), Gaps = 13/207 (6%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            S      W  L G  +W+GLL PL+  LR  ++  G+  QA YD+FN ++ SK+AGS  Y
Sbjct  31   SRGIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSSIY  90

Query  209  GKRSFFHKVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAV  379
             ++ FF KV L  A     Y+V  +L+AT+++ VPE+FLL  +SRE   +ESNWIGYVAV
Sbjct  91   SRKDFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYVAV  150

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPK  559
            T D  + ALGRR+I V +RG+   LEW+N F    V+A+ +           E++D+V +
Sbjct  151  TDDQGTAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIF---------GEKNDQV-Q  200

Query  560  VMFGWLTLYTSKDPNSRFTTLSAREQL  640
            +  GW ++Y SKD  S F   +AR+Q+
Sbjct  201  IHQGWYSIYMSKDERSPFNKANARDQV  227



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 124/204 (61%), Gaps = 9/204 (4%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W  L G  NWEGLL+PL++ LR  I++ G+    TYD+F ++  SKYAG+ RY
Sbjct  3    SMAEK--WEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               + F +  L   + Y+V  Y YAT+ +P+P AFL+ SLSRE+W +ESN++GY+AV +D
Sbjct  61   SMENLFTRAGLDPLN-YKVTKYFYATSSIPLPSAFLVKSLSREAWSKESNFMGYIAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                ALGRR+I + +RGT   LEW+N      +    +      GD G     K P V  
Sbjct  120  EGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVF-----GDGGLLPLFK-PLVHH  173

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            G+  +YTS+DP S+F   SAR+Q+
Sbjct  174  GFYNIYTSEDPRSKFNQASARDQV  197



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 124/200 (62%), Gaps = 10/200 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +W+GLLDPL+L LR  I+  G+  QATYD FN +  S + G+C YG      
Sbjct  44   WRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACFYGHDDLLA  103

Query  230  KVMLPS-ADDYQVEAYLYATAKLPVPEAFLLHSLSR--ESWDRESNWIGYVAVTSDAVSK  400
             V +P  A++YQV  ++YAT+ LP+PE+FLL  L    + W RESNW+GYVAV +D  + 
Sbjct  104  GVGVPHHANNYQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAVATDEGAA  163

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            ALGRR+I V +RGT  +LEW+N     PV A  +L S  +        ++   V  G+L+
Sbjct  164  ALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAAS-------QNRFAVVHRGFLS  216

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +YTS + +S FT  SA+EQ+
Sbjct  217  VYTSSNKSSEFTKTSAKEQV  236



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 121/197 (61%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NWEGLL PL++ LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  5    WEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSMENLFT  64

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L   + Y+V  + YATA +P+P+AF++ S SRE+W +ESN++GY+AV +D    +LG
Sbjct  65   KVGL-DPNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVATDEGKVSLG  123

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT   +EW+N     PV A  +      GD G     K P V  G+  +YT
Sbjct  124  RRDIVINWRGTLQKMEWVNDLQFLPVPAPKVF-----GDGGLLPLFK-PLVHHGFYNVYT  177

Query  590  SKDPNSRFTTLSAREQL  640
            S    S+F   SAR+Q+
Sbjct  178  SASSRSQFNLTSARDQV  194



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+GLL PL+  LR  I+  G+  QA YD+FN ++ SKYAG+  Y ++ FF 
Sbjct  39   WRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGASIYSRKDFFA  98

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPEAFLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  99   KVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYVAVTDDQGTA  158

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I + +RG+   LEW++ F    V+A+ +      G+K ++      ++  GW +
Sbjct  159  VLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIF-----GEKYNQ-----VQIHQGWHS  208

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S F   +AR+Q+
Sbjct  209  IYMSEDERSHFNKANARDQV  228



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 122/200 (61%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  40   WRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFS  99

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  100  KVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPMSREGWTKESNWMGYVAVTDDQGTA  159

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW++ F    V+A  +      GD  D       ++  GW +
Sbjct  160  ILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIF-----GDNNDH-----VQIHQGWYS  209

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S F   +AR+Q+
Sbjct  210  IYMSQDERSHFNKANARDQV  229



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 124/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W G+L PL+  LR  ++  G+  QA YD+FN ++ SK+AG+  Y ++ FF 
Sbjct  37   WRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGASIYSRKDFFA  96

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  +LYAT+++ VPE+FLL  LSRE W +ESNW+GYVAVT +  + 
Sbjct  97   KVGLEKAHPYTKYKVTRFLYATSQIHVPESFLLFPLSREGWTKESNWMGYVAVTDNQGTA  156

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+N F    V+A+++      G+K D+      ++  GW +
Sbjct  157  VLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIF-----GEKNDQ-----VQIHQGWYS  206

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S F   +AR+Q+
Sbjct  207  IYMSEDERSPFNKANARDQV  226



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 130/205 (63%), Gaps = 11/205 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W QL G  NWEGLL+PL+L LR  I++ G+  + TYD+F +++ SKYAG+ RY
Sbjct  3    SMAEK--WEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRY  60

Query  209  GKRSFFHKVML-PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
               + F KV L PS   Y+V  + YAT+ +P+P AFL+ SLSRE+W++ESN++GY+AV +
Sbjct  61   SMENLFAKVGLDPS--KYRVTKFFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAVAT  118

Query  386  DAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
            D    ALGRR+I + +RGT   LEW+N      +    +      G+ G     K P V 
Sbjct  119  DEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVF-----GNGGLVPLFK-PLVH  172

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             G+ ++YT+++P S+F   S R+Q+
Sbjct  173  HGFYSIYTTENPRSKFNQYSVRDQV  197



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 124/204 (61%), Gaps = 13/204 (6%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            + +  W  L G  +W+ LLDPL+  LR  I+  G+  QATYD FN    SKYAGS  Y K
Sbjct  21   SIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKYAGSSLYAK  80

Query  215  RSFFHKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
              FF KV L   +   Y+V  +LYAT+++ +PEAF++ SLSRE+W +ESNWIG+VAV +D
Sbjct  81   DDFFTKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWIGFVAVATD  140

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                 LGRR+I + +RGT   LEW+N F    VSA  +L     G+ GD      PKV  
Sbjct  141  EGKTTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKIL-----GESGD------PKVHQ  189

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            GW ++YTS D  S +   SAR+Q+
Sbjct  190  GWYSIYTSDDSRSPYNKNSARDQV  213



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G ++W+ LLDPL++ LR  I+  G+  QATYD+FN +  SK+AGS  Y +R+ F 
Sbjct  9    WRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSRRNLFS  68

Query  230  KVML--PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L  P+   Y    YLYAT+++ VP AF+L  +  ++W ++SNWIG+VAV +D    A
Sbjct  69   QVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGKTA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RG+   +EW+  F     SA     S+  G+KG+      P     W+++
Sbjct  129  LGRRDIVVAWRGSVQIVEWLKDFDFPLASA-----SMIVGEKGN------PYAHRCWVSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP SRF   SAR+Q+
Sbjct  178  YTSHDPKSRFNKQSARDQV  196



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G ++W+ LLDPL++ LR  I+  G+  QATYD+FN +  SK+AGS  Y +R+ F 
Sbjct  9    WRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSRRNLFS  68

Query  230  KVML--PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V L  P+   Y    YLYAT+++ VP AF+L  +  ++W ++SNWIG+VAV +D    A
Sbjct  69   QVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAVATDEGKTA  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RG+   +EW+  F     SA     S+  G+KG+      P     W+++
Sbjct  129  LGRRDIVVAWRGSVQIVEWLKDFDFPLASA-----SMIVGEKGN------PYAHRCWVSI  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP SRF   SAR+Q+
Sbjct  178  YTSHDPKSRFNKQSARDQV  196



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 113/199 (57%), Gaps = 10/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GLLDPL+  LR  I+  G+  + TYD+FN+D  SKYAG   + K   F 
Sbjct  9    WKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKTELFA  68

Query  230  KVMLPSADDY--QVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +      + Y  +V  + YAT+ + +P +F++ SLSRE+W +ESNW+GY+AV +D   + 
Sbjct  69   RTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAVATDEGKEK  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW N F      A  L      G K        P++  GWL L
Sbjct  129  LGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHK--------PQIASGWLAL  180

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT+ DP S F   SAREQ+
Sbjct  181  YTTDDPRSPFNKTSAREQV  199



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (62%), Gaps = 9/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NWEGLL+PL++ LR  I++ G+  + TYD+F +D  SKYAG+ RY   + F 
Sbjct  5    WEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSMENLFS  64

Query  230  KVML-PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             V L PS   Y+V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GYVAV +D    +L
Sbjct  65   NVGLDPSK--YRVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYVAVATDEGKVSL  122

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT   LEW+N     P+    +      GD G     K P V  G+  +Y
Sbjct  123  GRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVF-----GDGGLLPLFK-PLVHHGFYNVY  176

Query  587  TSKDPNSRFTTLSAREQL  640
            TS+   S+F   SAR+Q+
Sbjct  177  TSESARSKFNKTSARDQV  194



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 122/213 (57%), Gaps = 11/213 (5%)
 Frame = +2

Query  2    VLKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSN  181
            VL +      +AT   W ++ G + W GLLDPLN+ LR  I+R G+  QAT D+F  D  
Sbjct  9    VLLAVTILTDVATAQRWREISGRDQWSGLLDPLNIELRREIIRYGELAQATSDAFIGDPA  68

Query  182  SKYAGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNW  361
            S YAG+ RYG  +FF+KV       Y+V  +LYAT+   + +AF+   +   +W  ESNW
Sbjct  69   SPYAGASRYGPGTFFYKVQAADPGAYRVTRFLYATSSARLRDAFMTRPVPAGAWSTESNW  128

Query  362  IGYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEE  541
            +GYVAV +D  ++ALGRR++ V +RGT   +EW +      V A  +   +  G +G   
Sbjct  129  MGYVAVATDGAARALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGV---VGPGGRG---  182

Query  542  DDKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
                  V  G+L+LYTSK+  SRF   SAREQ+
Sbjct  183  -----SVHRGFLSLYTSKNSTSRFNKQSAREQV  210



>ref|NP_001055438.1| Os05g0390000 [Oryza sativa Japonica Group]
 gb|AAT47444.1| putative lipase class 3 family protein, PF01764 [Oryza sativa 
Japonica Group]
 dbj|BAF17352.1| Os05g0390000 [Oryza sativa Japonica Group]
Length=478

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 121/198 (61%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F+ D +S+Y GSC+Y +R+FF 
Sbjct  126  WREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKYPRRAFFD  185

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV++D  +  L
Sbjct  186  RLGMPAAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTDEETARL  245

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT T LEW++  +         LR +   D+G    D+  KV  G++ LY
Sbjct  246  GRRDIAIAWRGTVTRLEWVSDLM-------DFLRPVA--DEGIPCPDREVKVESGFVDLY  296

Query  587  TSKDPNSRFTTLSAREQL  640
            T KDP  RF   SAREQ+
Sbjct  297  TDKDPTCRFCKYSAREQV  314



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 123/199 (62%), Gaps = 11/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G  NWEGLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8    WEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L     Y+V  + YAT+ +P+P+AF++ SLSRE+W +ESN++GY+AV +D    ALG
Sbjct  68   KVGLDPLK-YRVTKFFYATSSIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGKVALG  126

Query  410  RREIYVVFRGTTTDLEWIN--VFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR+I V +RGT   LEW+N   F+A P            GD G     K   V  G+  +
Sbjct  127  RRDIVVNWRGTMQKLEWVNDLQFLAVPGPK-------VFGDGGLLPLLKP-LVHHGFYNI  178

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT++D  S+F   SAR+Q+
Sbjct  179  YTTEDLRSQFNQASARDQV  197



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 120/199 (60%), Gaps = 9/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +W+GL+DPL+L LR  I+  G+  +ATYD FN +  S +AG+C YG      
Sbjct  17   WRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACIYGYSDLLA  76

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLS--RESWDRESNWIGYVAVTSDAVSKA  403
               + +A  Y+V  ++YAT+  P+P+AFL+  L+  ++ W RESN++GYVAV +D  + A
Sbjct  77   SSGVAAAGHYEVTRFIYATSGQPLPDAFLVRPLAALKDVWSRESNFMGYVAVATDEGAAA  136

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT   LEW+N     PV A  +L     G K     + +  V  G+L+L
Sbjct  137  LGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVL-----GKKA--AANPLAMVHMGFLSL  189

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS    S+F   SAR+Q+
Sbjct  190  YTSSHAGSKFNKTSARDQV  208



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 122/197 (62%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G +NWEGLL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8    WEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             V L     Y+V  + YAT+ +P+P+AF++ SLSRE+W +ESN++GYVAV +D    +LG
Sbjct  68   GVGLDPLK-YRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYVAVATDEGKVSLG  126

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT  +LEW+N F    V A  +      GD G     + P V  G+  +YT
Sbjct  127  RRDIVINWRGTMQNLEWVNDFQFLLVPAPKVF-----GDGGLLPLFQ-PLVHHGFYNIYT  180

Query  590  SKDPNSRFTTLSAREQL  640
            S+   S+F     R+Q+
Sbjct  181  SESSRSQFNKTCVRDQV  197



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 123/199 (62%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+ LLDPL++ LRH I+  G+  QA YD+FN    SK AGS  Y K +FF 
Sbjct  32   WKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSLYTKEAFFS  91

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L + +   YQV  +LYAT+++ +PEAF++ SLSRE+W +ESNW+GYVAV +D     
Sbjct  92   KVGLENGNPYKYQVTKFLYATSQIQLPEAFIIKSLSREAWSKESNWMGYVAVATDEGKAV  151

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEW+N F    V A  +         G+  D KV +   GW ++
Sbjct  152  LGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIF--------GESNDRKVHQ---GWYSV  200

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S +   SAR+Q+
Sbjct  201  YTSDDPRSPYNKSSARDQV  219



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 124/204 (61%), Gaps = 9/204 (4%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W +L G  NWEGLL+PL+L LR  I++ G+  QATYD+F ++  SKYAG+ RY
Sbjct  3    SMAEK--WEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               +FF KV L     Y V  + Y T+ +P+P+AF+  SLSRE+W +ESN++GY+AV +D
Sbjct  61   SMENFFTKVGL-DPSKYHVTKFFYGTSSIPLPDAFMTRSLSREAWSKESNFMGYIAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                ALGRR+I + +RGT   LEW+N      V A  +      GD G       P V  
Sbjct  120  EGKVALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVF-----GDGGLLPLFH-PLVHH  173

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            G+  +YT+++P S+F     R+Q+
Sbjct  174  GFHNIYTTENPRSQFNKTCVRDQV  197



>gb|EEC79153.1| hypothetical protein OsI_19824 [Oryza sativa Indica Group]
Length=574

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 121/198 (61%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F+ D +S+Y GSC+Y +R+FF 
Sbjct  123  WREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPSSRYCGSCKYPRRAFFD  182

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV++D  +  L
Sbjct  183  RLGMPDAARGYTVTRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTDEETARL  242

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT T LEW++  +         LR +   D+G    D+  KV  G++ LY
Sbjct  243  GRRDIAIAWRGTVTRLEWVSDLM-------DFLRPVA--DEGIPCPDREVKVESGFVDLY  293

Query  587  TSKDPNSRFTTLSAREQL  640
            T KDP  RF   SAREQ+
Sbjct  294  TDKDPTCRFCKYSAREQV  311



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 122/199 (61%), Gaps = 9/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +W+ LLDPL+  LR  ++  G+  QATYD FN++  S  AGSC +G      
Sbjct  47   WRELHGETSWKNLLDPLDPHLRATLIAYGELAQATYDGFNSERRSPNAGSCLHGHDDLLT  106

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSR--ESWDRESNWIGYVAVTSDAVSKA  403
               + S   Y+V  ++YAT+ +P+PE+FL   L    ++W R+SNWIGYVAV +D  ++A
Sbjct  107  ASSVSSPGHYKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVAVATDEGAEA  166

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT  +LEW+N     PVSA  +L S           +++  V  G+L++
Sbjct  167  LGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAG-------KNRLAVVHRGFLSV  219

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS + +S+FT  SAR+Q+
Sbjct  220  YTSSNKSSKFTKTSARDQV  238



>gb|ACG40994.1| triacylglycerol lipase [Zea mays]
Length=223

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 108/198 (55%), Gaps = 8/198 (4%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            +W +L G +NW+GLLDPL+  LR  ++R G   QAT D+F  D  S YAG+ RY   +F 
Sbjct  32   SWAELSGRDNWDGLLDPLDGDLRRAVIRYGKLAQATSDAFIGDPASPYAGASRYAPGAFL  91

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             +   P  D Y V  +LYAT+   VP  F+       +W  ESNW+GYVAV +DA    L
Sbjct  92   RRAQAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVARL  151

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I V +RGT   +EW N      V A  ++        G       P V  G+L++Y
Sbjct  152  GRRDIVVAWRGTKRAVEWANDLDITLVPAAGVV--------GPGPGWSQPAVHRGFLSVY  203

Query  587  TSKDPNSRFTTLSAREQL  640
             S++  SRF   SAREQ+
Sbjct  204  ASRNSTSRFNKQSAREQV  221



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 14/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  NWEG+LDPL++ LR  IL  G   QATYD+FN++  S +AG+CRY KR FF 
Sbjct  10   WRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNCRYAKRDFFS  69

Query  230  KVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L   +   Y+V  +LYAT+K    + F L   S++ W  ESNWIGYVAV +D    A
Sbjct  70   KVGLEHGNPFKYEVTEFLYATSKATASKQFALKLFSKDEWGMESNWIGYVAVATDEGKAA  129

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW+         A  + R            D   ++  G+ ++
Sbjct  130  LGRRDIVVAWRGTVQGSEWVQDLHIPLDPAPLIFR------------DARAELHNGFYSV  177

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS +P+S  T  SAR Q+
Sbjct  178  YTSNNPDSHITQTSARNQV  196



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 123/204 (60%), Gaps = 9/204 (4%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W QL G  NWEGLL+PL+L LR  +++ G+  QATYD+F  +  SK AG+ RY
Sbjct  3    SMAEK--WEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               + F +V L     Y+V  + YAT+ +P+P+   + SLS E+W +ESN++GYVAV +D
Sbjct  61   SMENLFTRVGLDPLK-YRVTKFFYATSSIPLPDGLFVRSLSLEAWSKESNFMGYVAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                 LGRR+I + +RGT   LEW+N F    V A  +      GD+G     + P V  
Sbjct  120  EGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVF-----GDRGLLHLLQ-PLVHH  173

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            G+  +YT+ +P S+F   SAR+Q+
Sbjct  174  GFYNIYTTNNPRSQFNHTSARDQV  197



>ref|XP_006655277.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Oryza 
brachyantha]
Length=440

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 118/198 (60%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F+ D  S+Y GSC+Y +R+FF 
Sbjct  9    WREIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDQASRYCGSCKYPRRAFFE  68

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV++D  +  L
Sbjct  69   RLGMPAAARGYAVSRYLYATSNFRFPNFFSQSRAGAKIWSQRANWIGYVAVSTDEETARL  128

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT   LEW++  +         LR +   D+G    D   KV  G++ LY
Sbjct  129  GRRDIAIAWRGTVPRLEWVSDLM-------DFLRPVA--DEGIPCPDPEVKVESGFVDLY  179

Query  587  TSKDPNSRFTTLSAREQL  640
            T KDP  RF   SAREQ+
Sbjct  180  TDKDPTCRFCKYSAREQV  197



>gb|AFW83434.1| hypothetical protein ZEAMMB73_348788 [Zea mays]
Length=226

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 108/197 (55%), Gaps = 8/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G +NW+GLLDPL+  LR  ++R G+  QAT D+F  D  S YAG+ RY   +F  
Sbjct  37   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P  D Y V  +LYAT+   VP  F+       +W  ESNW+GYVAV +DA    LG
Sbjct  97   RAQAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVARLG  156

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT   +EW N      V A  ++        G       P V  G+L++Y 
Sbjct  157  RRDIVVAWRGTKRAVEWANDLDITLVPAAGVV--------GPGPGWSQPAVHRGFLSVYA  208

Query  590  SKDPNSRFTTLSAREQL  640
            S++  SRF   SAREQ+
Sbjct  209  SRNSTSRFNKQSAREQV  225



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 119/199 (60%), Gaps = 14/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G ++W+GLLDPL++ LR  ++  G+  QA YD F     S++AG+  Y + +   
Sbjct  9    WRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPLYARSNILQ  68

Query  230  KVMLPSADD--YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            KV L    +  Y+V  + YAT+ + VP+AF++ SLSR++W ++SNW+GYVAV +D  +  
Sbjct  69   KVALSQGQERLYRVTKFFYATSGVQVPDAFIIKSLSRQAWSKDSNWMGYVAVATDEGAAQ  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR++ V +RGT   LEWIN      V A  +L S +            P V  GWL++
Sbjct  129  LGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGSSS------------PLVHRGWLSI  176

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS+DP S ++  SAR Q+
Sbjct  177  YTSEDPKSPYSKSSARNQV  195



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 125/212 (59%), Gaps = 11/212 (5%)
 Frame = +2

Query  5    LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNS  184
            + S   F ++A    W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S
Sbjct  1    MSSLRGFGNIARR--WRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRS  58

Query  185  KYAGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWI  364
            +YAGSC + ++ F  +V + + + Y++  ++YA   + +P+ F++  LS+ +W ++SNW+
Sbjct  59   RYAGSCLFRRKDFLSRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWM  118

Query  365  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEED  544
            G+VAV +D   + LGRR++ V +RGT   LEW++      V A  ++R  +  D      
Sbjct  119  GFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAND------  172

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
               P+V  GWL++YTS DP SR+   SAR Q+
Sbjct  173  ---PRVHGGWLSVYTSTDPGSRYNKQSARYQV  201



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 126/205 (61%), Gaps = 15/205 (7%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
             T   W +L G  NW+GLLDP +L LR  ++R G+  QATYD+FN++  S +AG  R+G+
Sbjct  7    GTAHRWRELHGQNNWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFGR  66

Query  215  RSFFHKVMLPS-ADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            R FF +V LP  A  Y+V  +LYAT+ + VPE F+L S+S     RESNWIGYVAV +D 
Sbjct  67   RRFFERVQLPDHAAAYRVTKFLYATSSVAVPEPFILRSVSLGRRCRESNWIGYVAVATDD  126

Query  392  VSKALGRREIYVVFRGTTTDLEWIN--VFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
               ALGRR+I V +RGTT  LEWIN   F+  P    SLL        GDE  +    V 
Sbjct  127  GKTALGRRDIVVAWRGTTQALEWINDMEFVMAP--PRSLL--------GDEASEAT--VH  174

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             GWL++YTS DP S     SAR+Q+
Sbjct  175  RGWLSMYTSSDPESSHNKDSARDQV  199



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 120/197 (61%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NW+GLL+PL+L LR  I+  G+  QATYD+F ++  SKYAG+ RY   +FF 
Sbjct  9    WEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASRYSMENFFT  68

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L     Y V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GY+AV +D    +LG
Sbjct  69   KVGL-DPKKYCVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYIAVATDEGKASLG  127

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT   LEW+N      V A  +      GD G       P V  G+  +YT
Sbjct  128  RRDIVINWRGTLQVLEWVNDLQFLLVPAPQVF-----GDGGLLPLFH-PLVHHGFHNIYT  181

Query  590  SKDPNSRFTTLSAREQL  640
            +++P S+F     R+Q+
Sbjct  182  TENPRSQFNKTCVRDQV  198



>ref|XP_004962195.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X2 [Setaria italica]
Length=583

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 117/198 (59%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D +S+Y GSC+Y +R FF 
Sbjct  114  WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV+ D  S  L
Sbjct  174  RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDEESARL  233

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT T LEW++  +         LR +   D+G    D   KV+ G+  LY
Sbjct  234  GRRDIAIAWRGTVTRLEWVSDLM-------DFLRPVA--DEGIPCPDPEVKVLAGFADLY  284

Query  587  TSKDPNSRFTTLSAREQL  640
            T KDP  RF   SAREQ+
Sbjct  285  TDKDPTCRFCKYSAREQV  302



>ref|XP_004962194.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like isoform 
X1 [Setaria italica]
Length=594

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 117/198 (59%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D +S+Y GSC+Y +R FF 
Sbjct  114  WREIHGRDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRDFFE  173

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YLYAT+    P  F       + W + +NWIGYVAV+ D  S  L
Sbjct  174  RLGMPEAARGYAVSRYLYATSNFRFPNFFPQSRAGAKIWSQSANWIGYVAVSGDEESARL  233

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT T LEW++  +         LR +   D+G    D   KV+ G+  LY
Sbjct  234  GRRDIAIAWRGTVTRLEWVSDLM-------DFLRPVA--DEGIPCPDPEVKVLAGFADLY  284

Query  587  TSKDPNSRFTTLSAREQL  640
            T KDP  RF   SAREQ+
Sbjct  285  TDKDPTCRFCKYSAREQV  302



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 118/197 (60%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NWEGLL PL++ LR  I+  G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  5    WEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSMENLFT  64

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L   + Y+V  + YATA +P+P+ F++ SLSRE+W +ESN++GY+AV +D    +LG
Sbjct  65   KVGL-DPNKYRVTKFFYATASIPLPDGFIVKSLSREAWSKESNFMGYIAVATDEGKVSLG  123

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT   LEW+N      V A  +      GD G     + P V  G+   YT
Sbjct  124  RRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVF-----GDGGLLPLFQ-PLVHHGFYNAYT  177

Query  590  SKDPNSRFTTLSAREQL  640
            S    S+F   SAR+Q+
Sbjct  178  SSSSRSQFNLTSARDQV  194



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 122/200 (61%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G+L PL+  LR  I+  G+  QA YD+FN ++ S++AG+  Y ++ FF 
Sbjct  23   WRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRKDFFA  82

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  ++YAT+ + VPE+FLL  +SRE W +ESNW+GYVAVT D  + 
Sbjct  83   KVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTA  142

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+  F    V+A  +           E +D+V ++  GW +
Sbjct  143  LLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIF---------GERNDQV-QIHQGWYS  192

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AR+Q+
Sbjct  193  IYMSQDERSPFTKTNARDQV  212



>ref|XP_009415331.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 114/204 (56%), Gaps = 28/204 (14%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P+W +LLGSE+W GLLDPL+ SLR  +L+CGD CQ T DSF  D +SKY G CRY  
Sbjct  7    AETPSWPELLGSEHWSGLLDPLDQSLRVFLLQCGDMCQVTGDSFIGDDHSKYRGMCRYRP  66

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +   +V  P A +Y V+ YLYA ++            +  +  +ESNW+GY+AV+ DA 
Sbjct  67   STLLDQVFFPYAANYDVKEYLYAMSQ------------NSSNKTKESNWMGYIAVSKDAY  114

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
            +K  GRREIYVV+RGT    EW   F    V  +   R +               VM GW
Sbjct  115  TKRTGRREIYVVWRGTGRPSEWCEDFTTGLVPLDPDKRDVM--------------VMQGW  160

Query  575  LTLYTSKDPNSRF--TTLSAREQL  640
              +YT KD +S+F     SAREQL
Sbjct  161  NDIYTLKDSDSQFPCNATSAREQL  184



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 119/200 (60%), Gaps = 10/200 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G+ +W GLLDPL++ LR  ++  G+  QATYD FN +  S + G+C +G      
Sbjct  16   WRELQGAGSWAGLLDPLDIDLRANLIAYGELTQATYDGFNQEKRSPHCGACVFGYSDLLA  75

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAF---LLHSLSRESWDRESNWIGYVAVTSDAVSK  400
                 +A  Y V  ++YAT+ LPVPEAF    L  L  ESW RESNW+GYVAV +DA   
Sbjct  76   SSGAAAAGSYSVTKFIYATSALPVPEAFLVLPLPDLLPESWSRESNWMGYVAVATDAGVA  135

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            ALGRR+I V +RGT  +LEW+N F   PVSA  +L S           +    V  G+L+
Sbjct  136  ALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAA-------AANPAALVHRGFLS  188

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S +P+S++   SAR+Q+
Sbjct  189  VYRSSNPDSKYNQSSARDQV  208



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 116/197 (59%), Gaps = 10/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  + G ++W GLLDP++  LR  ++R G+F QA YDSF+ D  S+Y GSC+Y +R FF+
Sbjct  90   WRVIHGRDDWAGLLDPIDPLLRTELIRYGEFVQACYDSFDYDKFSRYCGSCKYSRRQFFY  149

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + + SA  Y V  YLYAT+ + VP+ F    +   +W   +NWIGYV+V++D  +  LG
Sbjct  150  SLGMESAG-YDVTRYLYATSNVKVPKFFAKSVMGSRTWSERANWIGYVSVSNDETTARLG  208

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT T LEWI+ F+AK     S          G    D   KV  G++ LY 
Sbjct  209  RRDILIAWRGTVTRLEWIHDFMAKMQPVRS---------AGIPCPDTRVKVETGFVDLYI  259

Query  590  SKDPNSRFTTLSAREQL  640
             KD   RF   SAREQ+
Sbjct  260  EKDSTCRFCKYSAREQV  276



>ref|XP_002441042.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
 gb|EES19472.1| hypothetical protein SORBIDRAFT_09g019276 [Sorghum bicolor]
Length=478

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 120/198 (61%), Gaps = 10/198 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D +S+Y GSC+Y +R  F 
Sbjct  127  WREIHGCDDWAGLLDPMDPLLRSELIRYGELAQACYDAFDYDPSSRYCGSCKYPRRELFS  186

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
            ++ +P +A  Y V  YL+AT+ +  P  F         W + +NWIGYVAV++DA +  L
Sbjct  187  RLGMPDAARGYAVSRYLFATSNIRFPNFFPQSRAGARIWSQSANWIGYVAVSTDAETALL  246

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT T LEW++  +         LR +   ++G   DD   KV+ G++ LY
Sbjct  247  GRRDIAIAWRGTVTRLEWVSDLM-------DFLRPV--AEEGIPCDDPEVKVLAGFVDLY  297

Query  587  TSKDPNSRFTTLSAREQL  640
            T +DP  RF   SAR+Q+
Sbjct  298  TDRDPGCRFCKYSARQQV  315



>ref|XP_003518894.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Glycine 
max]
Length=513

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 120/209 (57%), Gaps = 16/209 (8%)
 Frame = +2

Query  20   HFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGS  199
            H + +  E  W Q+ G  +W GLL+P++  LR  ++R G+  QA YD+F+ D  SKY GS
Sbjct  84   HLERLPEE--WRQIHGESDWAGLLEPMDPLLRSEVIRYGEMAQACYDAFDFDPFSKYCGS  141

Query  200  CRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAV  379
            CR+ +RSFF  + +P    Y V  YLYATA + +P  F  HS   + W + +NW GYVAV
Sbjct  142  CRFTRRSFFSSLEMPHHLGYAVTRYLYATANINLPN-FFKHSRWSKMWSKHANWAGYVAV  200

Query  380  TSDAVSKALGRREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKV  553
            + DA +K LGRR+I + FRGT T LEW+   +   KP+S+            G    D  
Sbjct  201  SDDATTKLLGRRDITIAFRGTVTRLEWVADLMDFLKPISS-----------NGIPCPDHT  249

Query  554  PKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             KV  G+L LYT K+ +  +   SAREQ+
Sbjct  250  VKVESGFLDLYTDKEESCGYAKYSAREQV  278



>ref|XP_009415339.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 119/204 (58%), Gaps = 25/204 (12%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            A  P+W +LLGSE+W GLLDPL+ SLR  +L+CGD CQ T DSF +D +S Y G CRY  
Sbjct  7    ADTPSWPELLGSEHWSGLLDPLDQSLRVFLLQCGDMCQVTADSFISDDHSNYRGMCRYRP  66

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +    V  P A +Y V+ YLYA             S++  ++  ESNW+GY+AV+ DA 
Sbjct  67   STLLDDVFFPYAANYDVKEYLYAM------------SINWSNFTEESNWMGYIAVSKDAY  114

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
            +K  GRREIYVV+RGT    E+I          E L+ S+   D  D +D +  KV+ GW
Sbjct  115  TKRTGRREIYVVWRGTMRPSEFI----------EGLVISLVPFDP-DNQDVQDVKVVNGW  163

Query  575  LTLYTSKDPNSRF--TTLSAREQL  640
              +YT KD  S+F     SAREQL
Sbjct  164  NDIYTLKDSGSQFPCNATSAREQL  187



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 120/197 (61%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NW+GLL+PL+L LR  I++ G+  QATYD+F ++  SKYAG+ RY   +FF 
Sbjct  9    WEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSMENFFT  68

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L     Y V  Y YAT+ +P+P+AF+  S SRE+W +ESN++GY+AV +D    +LG
Sbjct  69   KVGL-DPKKYCVTKYFYATSSMPLPDAFITKSFSREAWSKESNFMGYIAVATDEGKASLG  127

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT   LEW+N      V A  +      GD G       P V  G+  +YT
Sbjct  128  RRDIVINWRGTLQVLEWVNDLQFLLVPAPKVF-----GDGGLLPLFH-PLVHHGFHNIYT  181

Query  590  SKDPNSRFTTLSAREQL  640
            +++P S+F     R+Q+
Sbjct  182  TENPRSQFNKTCVRDQV  198



>gb|AFK39140.1| unknown [Medicago truncatula]
Length=196

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 116/200 (58%), Gaps = 14/200 (7%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            TW +L G   W+GLL+PL++ LR  +L  G F QATYD FN +  SKYAG+CRY K+ FF
Sbjct  7    TWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSKKDFF  66

Query  227  HKVMLPSAD--DYQVEAYLYATAKLPVPEAFLLHSL-SRESWDRESNWIGYVAVTSDAVS  397
             KV L   +   Y V  YLYAT+K     AFLL S+ S+++W  E+NW+GYVAV +D   
Sbjct  67   SKVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAVATDEAK  126

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
            +ALGRR+I V +RGT    EW+  F      A  +      G K D +      +  G+ 
Sbjct  127  EALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIF-----GPKSDVQ------LHNGFY  175

Query  578  TLYTSKDPNSRFTTLSAREQ  637
            +LYTS + +      SAR+Q
Sbjct  176  SLYTSDNSSLPLADSSARKQ  195



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 119/201 (59%), Gaps = 14/201 (7%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            TW +L G   W+GLL+PL++ LR  +L  G F QATYD+FN +  SKYAG+CRY K+ FF
Sbjct  16   TWRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGNCRYSKKDFF  75

Query  227  HKVMLPSADDYQ--VEAYLYATAKLPVPEAFLLHSL-SRESWDRESNWIGYVAVTSDAVS  397
             KV L   + Y+  V  YLYAT+K     AFLL S+ S+++W  ESNWIGYVAV +D   
Sbjct  76   SKVYLEEGNPYKYSVTKYLYATSKASDSAAFLLTSIFSKDAWSLESNWIGYVAVATDEAK  135

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
            +ALGRR+I VV+RGT    EW+  F      A  +    +N            ++  G+ 
Sbjct  136  EALGRRDIVVVWRGTIQGSEWVQNFNIDLDPAPLIFGPKSN-----------VQIHNGFY  184

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            +LYTS++        SAR+Q+
Sbjct  185  SLYTSENSGLPSADSSARKQV  205



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 124/212 (58%), Gaps = 11/212 (5%)
 Frame = +2

Query  5    LKSFIHFQSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNS  184
            + S   F ++A    W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S
Sbjct  1    MSSLRGFGNIARR--WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRS  58

Query  185  KYAGSCRYGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWI  364
            +YAGSC + ++ F  +V + + + Y++  ++YA   + +P+ F++  LS+ +W ++SNW+
Sbjct  59   RYAGSCLFRRKDFLSRVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWM  118

Query  365  GYVAVTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEED  544
            G+VAV +D   + LGRR++ V +RGT   LEW++        A  ++R  +  D      
Sbjct  119  GFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSAND------  172

Query  545  DKVPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
               P+V  GWL++YTS DP SR+   SAR Q+
Sbjct  173  ---PRVHGGWLSVYTSTDPGSRYNEQSARYQV  201



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + ++ F  
Sbjct  14   WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFLS  73

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y++  ++YA   + +P+ F++  LS+ +W ++SNW+G+VAV +D   + LG
Sbjct  74   RVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLG  133

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR++ V +RGT   LEW++        A  ++R  +  D         P+V  GWL++YT
Sbjct  134  RRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADD---------PRVHGGWLSVYT  184

Query  590  SKDPNSRFTTLSAREQL  640
            S DP SR+   SAR Q+
Sbjct  185  STDPGSRYNKQSARYQV  201



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 115/203 (57%), Gaps = 13/203 (6%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
            +W +L G +NW+GLLDPL+  LR  ++R G+  QAT D+F  D  S YAG+ RY   +F 
Sbjct  35   SWAELSGRDNWDGLLDPLDADLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFL  94

Query  227  HKVMLPSADD---YQVEAYLYAT--AKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            H+   P   D   Y V  +LYAT  A++PVP+ F+       +W  ESNW+GYVAV +DA
Sbjct  95   HRTQAPGGSDPDAYAVTRFLYATSSARVPVPDTFITRPAPPGAWSAESNWMGYVAVATDA  154

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
             +  LGRR+I V +RGT   +EW +      V A  ++        G       P V  G
Sbjct  155  GAARLGRRDIVVAWRGTKRAVEWADDLDITLVPATGVV--------GPGPGWSQPAVHRG  206

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            +L++Y S++  SRF   SAREQ+
Sbjct  207  FLSVYASRNSTSRFNKQSAREQV  229



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 124/210 (59%), Gaps = 21/210 (10%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W +L G   WEGLL+PL++ LR  I++ G+    TYD+F  +  SKYAG+ RY
Sbjct  3    SMADK--WEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRY  60

Query  209  GKRSFFHKVML-PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
               + F K  L PS   Y+V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GY+AV +
Sbjct  61   SMENLFSKAGLDPSK--YRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVAT  118

Query  386  DAVSKALGRREIYVVFRGTTTDLEWIN----VFIAKP-VSAESLLRSITNGDKGDEEDDK  550
            D    +LGRR+I + +RGT   LEW+N    + I  P V  +  L  +T           
Sbjct  119  DEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQ----------  168

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             P V  G+  +YTS+   S+F   SAR+Q+
Sbjct  169  -PLVHHGFYNIYTSESERSKFNKTSARDQV  197



>ref|XP_010938535.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Elaeis 
guineensis]
Length=524

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 121/199 (61%), Gaps = 15/199 (8%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F+ D  S+Y GSCRY +R FF 
Sbjct  102  WREIHGRDHWAGLLDPMDPLLRSELIRYGEFAQACYDAFDYDPFSRYCGSCRYSRRKFFA  161

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + + +A  Y V  YLYAT+ + +P  F   +   +SW +++NWIGY+AV+ DA +  LG
Sbjct  162  SLGMDTA-GYDVTHYLYATSNINLPN-FFTKTRGPKSWSQKANWIGYIAVSDDATTALLG  219

Query  410  RREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR+I + +RGT T LEW+   +   +PV++E           G    D   KV  G++ L
Sbjct  220  RRDIVIAWRGTVTRLEWVADLMDFLRPVASE-----------GIPCPDPEVKVESGFVDL  268

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT KDP  RF   SAR+Q+
Sbjct  269  YTDKDPTCRFCKYSARQQV  287



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 121/202 (60%), Gaps = 7/202 (3%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
            +T   W +L G  NW+GLL+PL++ LR  I+  G+   ATYD+   +  SKYAG+ RY  
Sbjct  3    STAEKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRYSM  62

Query  215  RSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAV  394
             +FF KV L   + Y+V  + YATA +P+P+AF++ S SRE+W +ESN++GY+AV++D  
Sbjct  63   ENFFTKVGL-DPNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAVSTDEG  121

Query  395  SKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGW  574
              +LGRR+I + +RGT   +EW+N      + A  +      GD G     K P V  G+
Sbjct  122  KASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIF-----GDGGLLHLFK-PLVHHGF  175

Query  575  LTLYTSKDPNSRFTTLSAREQL  640
              +YTS    S+F   S R+Q+
Sbjct  176  YNVYTSASSRSQFNQTSVRDQV  197



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 123/198 (62%), Gaps = 11/198 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYG-KRSFF  226
            W +L G  NW+GLL+PL++ LR  I++ G+ CQA YD+F  ++ SKYAG+ RY  ++ FF
Sbjct  5    WEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSMEKPFF  64

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             +  L   + Y+V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GY+AV +D    +L
Sbjct  65   TRFGL-DPNKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATDEGKVSL  123

Query  407  GRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLY  586
            GRR+I + +RGT   LE+IN      V A  +      GD G  +    P V  G+  +Y
Sbjct  124  GRRDIVINWRGTQQKLEFINDLQFLLVPAPKVF-----GDGGLLQ----PLVHNGFYNVY  174

Query  587  TSKDPNSRFTTLSAREQL  640
            TS    S+F   SAR+Q+
Sbjct  175  TSASSRSQFNLTSARDQV  192



>ref|XP_008802654.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 123/199 (62%), Gaps = 15/199 (8%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YD+F+    S+Y GSCRY +R FF 
Sbjct  101  WREIHGRDDWTGLLDPMDPLLRSELIRYGEFAQACYDAFDYQPFSRYCGSCRYNRRQFFA  160

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + + +A DY+V  YLYAT+ + +P  F   +   ++W +++NWIGY+AV+ DA +  LG
Sbjct  161  SLGMDAA-DYEVAHYLYATSNINLPN-FFTTTRGGKTWSQKANWIGYIAVSDDAATARLG  218

Query  410  RREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR++ + +RGT T LEW+   +   +PV++E           G    D   KV  G++ L
Sbjct  219  RRDVVIAWRGTVTRLEWVADLMDFLRPVASE-----------GIPCPDPEVKVESGFIDL  267

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT KDP+ RF   SAR+Q+
Sbjct  268  YTDKDPSCRFCKYSARQQV  286



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 127/199 (64%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G + WEGLLDPL+L LR  ++  G+  QATYD+F  +  SKYAG  RY  ++ F 
Sbjct  10   WKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDSRYSMKNLFS  69

Query  230  KV--MLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +V  +L +   YQ   YLYAT+K+ VPE+F+L  LSR++W+RESNWIGY+AV +D   +A
Sbjct  70   EVGLVLNNPFVYQPVKYLYATSKIDVPESFILKPLSRDAWNRESNWIGYIAVATDQGKQA  129

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I + +RGT   LEWI  F     SA  ++        G E+D +V +   G+L++
Sbjct  130  LGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIV--------GVEKDAQVHQ---GFLSI  178

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS +P S+F   S REQ+
Sbjct  179  YTSDNPQSQFNKTSVREQI  197



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 126/203 (62%), Gaps = 17/203 (8%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W QL G  NWEGLL PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   S F
Sbjct  7    NWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMESLF  66

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
             KV L     Y+V  + YATA +P+P+AF++ SLSRE+W +ESN++GY+AV +D    AL
Sbjct  67   TKVGLDPLK-YRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAVATDEGKVAL  125

Query  407  GRREIYVVFRGTTTDLEWIN--VFIAKP---VSAESLLRSITNGDKGDEEDDKVPKVMFG  571
            GRR+I V +RGT   LEW+N   F+A P   V  +  L S+             P V  G
Sbjct  126  GRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQ-----------PLVHHG  174

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            +  +YT++DP S+F  +SAR+Q+
Sbjct  175  FYNIYTTEDPRSQFNQVSARDQV  197



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 119/197 (60%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  NW+GL+ PL + LR  I++ G+  QATYD+F  +  SKYAG+ RY   +FF 
Sbjct  8    WEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRYSNENFFT  67

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            KV L   + Y V  + YATA +P+P+AF+  S SRE+W +ESN++GYVAV +D    +LG
Sbjct  68   KVGL-DPNKYGVTKFFYATASIPLPDAFITRSFSREAWSKESNFMGYVAVATDEGKVSLG  126

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT   LEW+N      V A ++      G+ G     + P V  G+  +YT
Sbjct  127  RRDIVVAWRGTKQALEWVNDLQFLLVPAPNVF-----GNGGLLPLFQ-PLVHHGFYNIYT  180

Query  590  SKDPNSRFTTLSAREQL  640
            S+   S+F   S R+Q+
Sbjct  181  SESARSQFNQTSVRDQV  197



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 121/208 (58%), Gaps = 13/208 (6%)
 Frame = +2

Query  26   QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCR  205
            +S +    W  L G  +W GLL+PL+L LR  I+  G+  QA YD+FN+ + S+YAGS  
Sbjct  37   KSASIAQRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSCTESQYAGSSI  96

Query  206  YGKRSFFHKVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVA  376
            Y ++ FF KV + + +    YQV  +LYAT++  +P AF++   S + W ++SNWIGYVA
Sbjct  97   YSRQDFFSKVGIVNGNPYCKYQVTKFLYATSEARMPGAFMVFPASGQGWTKQSNWIGYVA  156

Query  377  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVP  556
            V ++  +  LGRR+I V +RGT    EWI+ F             + +G K      K  
Sbjct  157  VATNDGTAVLGRRDIVVAWRGTIETTEWIDDFDF----------GLVDGSKIFAGKSKPI  206

Query  557  KVMFGWLTLYTSKDPNSRFTTLSAREQL  640
            KV  GWL++YTS D  S+F  + AR+QL
Sbjct  207  KVHRGWLSIYTSYDTRSKFNKICARDQL  234



>gb|EMT04701.1| Lipase [Aegilops tauschii]
Length=373

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 114/199 (57%), Gaps = 11/199 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G  +WEGLL PL+L LR  ++  G+  QATYD+FN + +S +AG  R+G + FF 
Sbjct  20   WKELHGERSWEGLLRPLDLELRRTVIWYGEMAQATYDAFNYEKHSPHAGHSRFGSKRFFE  79

Query  230  KVMLPS-ADDYQVEAYLYATAKLP-VPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
             VMLP  A  Y++  +LYAT   P  P A  + S   +S  +ESNWIGYVAV +DA    
Sbjct  80   HVMLPGHAAAYRITRFLYATCSAPAAPAATFVRSCHPQSRSKESNWIGYVAVATDAGKAT  139

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR++ VV+RGT   LEWI       V  + +L  +T  +           V  GW ++
Sbjct  140  LGRRDVVVVWRGTIQALEWIKDLEFAMVHPKGILGEVTGAEA---------MVDRGWFSI  190

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS D  S    +SAR+Q+
Sbjct  191  YTSTDQASTHNKVSARKQV  209



>gb|AFW74936.1| hypothetical protein ZEAMMB73_664132 [Zea mays]
Length=401

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 104/165 (63%), Gaps = 3/165 (2%)
 Frame = +2

Query  26   QSMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCR  205
             S AT   W +L G+ +W GLLDPL++ LR  I+  G+  QATYD FN +  S +AG+C 
Sbjct  25   SSSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACL  84

Query  206  YGKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEA-FLLHSL--SRESWDRESNWIGYVA  376
            YG+      V + +A  Y V  ++YAT+ LPVP + F L  L  +RE+W RESNWIGYVA
Sbjct  85   YGRADLLPGVGVAAAGRYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGYVA  144

Query  377  VTSDAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRS  511
            V +D  +  LGRR++ V +RGT  DLEW N F   PVSA  +L S
Sbjct  145  VATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGS  189



>gb|KDP21366.1| hypothetical protein JCGZ_21837 [Jatropha curcas]
Length=500

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 119/197 (60%), Gaps = 11/197 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D  SKY GSCR+ +R FF 
Sbjct  80   WREIHGQDDWVGLLDPIDPILRTELIRYGEIAQACYDAFDYDPYSKYCGSCRFMRRRFFD  139

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + +     Y+V  YLYAT  + +P  F   S   + W R++NWIGYVAV++D  +K LG
Sbjct  140  SLGM-GHHGYEVSRYLYATTNIDLPN-FFKESRWPKVWSRKANWIGYVAVSNDETTKRLG  197

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT T LEWI   +         L+ I NG+K    D  V KV  G+L LYT
Sbjct  198  RRDIVIAWRGTVTRLEWIADLM-------DFLKPI-NGNKIPCPDPAV-KVESGFLDLYT  248

Query  590  SKDPNSRFTTLSAREQL  640
             KD N RF   SAREQ+
Sbjct  249  DKDENCRFCKFSAREQV  265



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 118/197 (60%), Gaps = 9/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GL+DPL+L LR  I+  G+  QATY   N +  S+YAGSC + +R F  
Sbjct  14   WKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y++  ++YA   + +P+ F++ SLS+ +W R+SNW+G+VAV +D   + LG
Sbjct  74   RVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKELLG  133

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR++ V +RGT   +EW++      V A  ++   +  +         P V  GWL++YT
Sbjct  134  RRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAAN---------PCVHGGWLSVYT  184

Query  590  SKDPNSRFTTLSAREQL  640
            S DP S++   SAR Q+
Sbjct  185  SADPGSQYNKESARHQV  201



>ref|XP_008450415.1| PREDICTED: phospholipase A1-Igamma3, chloroplastic [Cucumis melo]
Length=505

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 120/206 (58%), Gaps = 22/206 (11%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  + G  NWEGLLDPLNL LR  I+R G+F QA YDSF+ D +SKY G+C+Y    FF+
Sbjct  69   WRDIQGMNNWEGLLDPLNLHLRKEIIRYGEFSQACYDSFDFDPHSKYCGTCKYQASHFFN  128

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRES--------WDRESNWIGYVAVTS  385
            K+++P    Y +  YLYAT+ + +P  F   + +R+         W + +NW+GYVAV +
Sbjct  129  KLLMPDP-GYNITRYLYATSNINLPNFFKKSNFTRDESRNFSNRVWSQHANWMGYVAVAT  187

Query  386  DAVS-KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKV  562
            DA   K LGRR+I + +RGT T LEWI+         + +LR       G   DD   K+
Sbjct  188  DADEIKRLGRRDIVIAWRGTVTYLEWIH-------DLKDILRP-----AGFIPDDTSVKI  235

Query  563  MFGWLTLYTSKDPNSRFTTLSAREQL  640
              G+  LYT K+ N  ++  SAREQ+
Sbjct  236  ESGFYDLYTMKEENCNYSGFSAREQI  261



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 123/205 (60%), Gaps = 11/205 (5%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W +L G   WEGLL+PL++ LR  I++ G+  + TYD+F +D  SKYAG+ RY
Sbjct  3    SMAEK--WEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRY  60

Query  209  GKRSFFHKVML-PSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTS  385
               + F  V L PS   Y+V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GY+AV +
Sbjct  61   SMENLFSNVGLDPSK--YRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVAT  118

Query  386  DAVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVM  565
            D    +LGRR+I + +RGT   LEW+N      +    +      GD G     K P V 
Sbjct  119  DEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVF-----GDGGLLPLFK-PLVH  172

Query  566  FGWLTLYTSKDPNSRFTTLSAREQL  640
             G+  +YTS+   S F   SAR+Q+
Sbjct  173  HGFYNVYTSESARSNFNKKSARDQV  197



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 120/200 (60%), Gaps = 13/200 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W  L G  +W+G L PL+  LR  I+  G+  QA YD+FN ++ S++AG+  Y ++ FF 
Sbjct  23   WRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGASIYSRKDFFA  82

Query  230  KVMLPSAD---DYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSK  400
            KV L  A     Y+V  ++YAT+ + VPE+FLL  +SRE W +ESNW GYVAVT D  + 
Sbjct  83   KVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWXGYVAVTDDQGTA  142

Query  401  ALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
             LGRR+I V +RG+   LEW+  F    V+A  +           E +D+V ++  GW +
Sbjct  143  LLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIF---------GERNDQV-QIHQGWYS  192

Query  581  LYTSKDPNSRFTTLSAREQL  640
            +Y S+D  S FT  +AR+Q+
Sbjct  193  IYXSQDERSPFTKTNARDQV  212



>ref|XP_003566295.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Brachypodium 
distachyon]
Length=537

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 121/201 (60%), Gaps = 14/201 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D  S+Y GSC+Y +R+FF 
Sbjct  105  WREIHGCDDWAGLLDPMDPQLRSELIRYGELAQACYDAFDYDLASRYCGSCKYPRRAFFD  164

Query  230  KVMLP-SADDYQVEAYLYATAKLPVPEAFLLHSLSR---ESWDRESNWIGYVAVTSDAVS  397
            ++ +P +A  Y V  YLYAT+    P  F     SR   + W + +NWIGYVAV++D  S
Sbjct  165  RLGMPDAARGYAVSRYLYATSNFRFPN-FFPSQQSRADAKVWSQRANWIGYVAVSTDEES  223

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
              LGRR++ + +RGT T LEW++  +         LR +   D+G    D   KV  G++
Sbjct  224  ARLGRRDVAIAWRGTITRLEWVSDLM-------DFLRPVA--DEGIPCPDPEVKVESGFV  274

Query  578  TLYTSKDPNSRFTTLSAREQL  640
             LYT KDP+ RF   SAREQ+
Sbjct  275  DLYTDKDPSCRFCKYSAREQV  295



>ref|XP_009384367.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 114/197 (58%), Gaps = 10/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R G+F QA YDSF+ D  S+Y GSC+Y +R FF 
Sbjct  92   WSEIHGRDDWAGLLDPMDPLLRSELIRYGEFAQACYDSFDYDPFSRYCGSCKYNRRRFFS  151

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + L     Y+V  YLYAT+ + +P  F       + W + +NW+GYVAV+ D  +  LG
Sbjct  152  SLGL-EGIGYEVTRYLYATSNINLPNFFTKSRAGAKIWSQRANWMGYVAVSDDETTARLG  210

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT T LEWI   +         LR +T+   G    D   KV  G+  LYT
Sbjct  211  RRDIVVAWRGTVTRLEWIADLM-------DFLRPVTS--VGIPCPDPSVKVESGFAELYT  261

Query  590  SKDPNSRFTTLSAREQL  640
             KDP  RF   SAREQL
Sbjct  262  DKDPTCRFCKYSAREQL  278



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 117/199 (59%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GL+DPL+L LR  I+  G+  QA Y   N +  S+YAGSC + +R F  
Sbjct  14   WKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y++  ++YA   + +P+ F++ SLS+ +W R+SNW+G+VAV +D   + LG
Sbjct  74   RVDVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLG  133

Query  410  RREIYVVFRGTTTDLEWINVFIAK--PVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR++ V +RGT   +EW++       P S   L  S TN           P V  GWL++
Sbjct  134  RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATN-----------PCVHGGWLSV  182

Query  584  YTSKDPNSRFTTLSAREQL  640
            YTS DP S++   SAR Q+
Sbjct  183  YTSADPGSQYNKESARHQV  201



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 120/197 (61%), Gaps = 7/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W QL G +NWE LL+PL+L LR  I++ G+  QATYD+F  +  SKYAG+ RY   + F 
Sbjct  8    WEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSMENLFT  67

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             V       Y+V  + YAT+ +P+P+AF++ SLSRE+W +ESN++GY+AV +D    +LG
Sbjct  68   GVGHDPLK-YRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYIAVATDEGKVSLG  126

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I + +RGT  +LEW+N F    V A  +      GD G     + P V  G+  +YT
Sbjct  127  RRDIVINWRGTMQNLEWVNDFQFLLVPAPKVF-----GDGGLLPLFQ-PLVHHGFYNIYT  180

Query  590  SKDPNSRFTTLSAREQL  640
            S+   S+F     R+Q+
Sbjct  181  SESSRSQFNKTCVRDQV  197



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 116/199 (58%), Gaps = 13/199 (7%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +R F  
Sbjct  14   WRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNRRDFLS  73

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + D Y++  ++YA   + +P+ F++ SLS+ +W R+SNW+G+VAV +D   + LG
Sbjct  74   RVDVSNPDLYEITKFVYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAVATDEGKEVLG  133

Query  410  RREIYVVFRGTTTDLEWINVFIAK--PVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR++ V +RGT   +EW++       P S   L  S  N           P V  GWL++
Sbjct  134  RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSAIN-----------PCVHGGWLSV  182

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT+ DP S++   SAR Q+
Sbjct  183  YTTADPGSQYNQESARHQV  201



>ref|XP_011079989.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X2 
[Sesamum indicum]
Length=435

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 122/197 (62%), Gaps = 11/197 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++LG ++W GLLDP++  LR+ ++R G   QA YD+F+ D  SKY GSCR+ +R FF 
Sbjct  89   WSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFTRREFFE  148

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            ++ +  A  Y +  YLYAT+ + +P  F  +S   + W + +NWIGY+AV++D  SK LG
Sbjct  149  RLGMAEA-GYDITRYLYATSNINLPN-FFKNSRWPKVWSKNANWIGYIAVSNDETSKKLG  206

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT T LEW+   +         LR I++ DK    D  V +V  G+L LYT
Sbjct  207  RRDICVAWRGTVTRLEWVADLM-------DFLRPISS-DKIPSPDPTV-RVESGFLDLYT  257

Query  590  SKDPNSRFTTLSAREQL  640
             KD + ++   SAREQ+
Sbjct  258  DKDESCKYCKFSAREQI  274



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 119/203 (59%), Gaps = 11/203 (5%)
 Frame = +2

Query  35   ATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGK  214
             T   W +L G  +W+GLLDP +L LR  ++R G+  QATYD+FN++  S +AG  R+  
Sbjct  10   GTARRWRELHGESDWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFAA  69

Query  215  RSFFHKVMLPS-ADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDA  391
            R FF +  LP  +  Y+V  ++YAT+ + VPE  +L S SR    RESNWIGYVAV +D 
Sbjct  70   RRFFERAQLPGHSAAYRVARFVYATSCVAVPEPLILRSASRARRCRESNWIGYVAVATDE  129

Query  392  VSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFG  571
               ALGRR+I V +RGT   LEWI       V  + LLR        D+  D +  V  G
Sbjct  130  GKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLR--------DKASDAM--VHRG  179

Query  572  WLTLYTSKDPNSRFTTLSAREQL  640
            WL++YTS+D  S     SAR+Q+
Sbjct  180  WLSMYTSRDSESSHNKDSARDQV  202



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + ++ F  
Sbjct  417  WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRRKDFLS  476

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y++  ++YA   + +P+ F++  LS+ +W ++SNW+G+VAV +D   + LG
Sbjct  477  RVDVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAVATDEGKEVLG  536

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR++ V +RGT   LEW++      V A  ++R  +  D         P+V  GWL++YT
Sbjct  537  RRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHD---------PRVHGGWLSVYT  587

Query  590  SKDPNSRFTTLSAREQL  640
            S DP SR+   SAR Q+
Sbjct  588  STDPGSRYNKQSARYQV  604



>ref|XP_010679169.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 121/199 (61%), Gaps = 15/199 (8%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G + W GLLDP++  LR  ++R G+  QA YD F+ D  SKY GSC+Y + SFF 
Sbjct  130  WREIHGEDEWVGLLDPMDSLLRAELIRYGEMAQACYDGFDFDPFSKYCGSCKYPRHSFFK  189

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + +  A  Y+V  YLYAT+ + +P  F  +S   + W + +NWIGYVAV++D +SK LG
Sbjct  190  GLEM-EAHGYEVTRYLYATSNINLPN-FFKNSRWPKVWSKNANWIGYVAVSNDEMSKRLG  247

Query  410  RREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR+I + +RGT T LEW++  +   +PVS E++              D+  K   G+L L
Sbjct  248  RRDIIISWRGTVTRLEWVHDLMDFLRPVSDENI-----------PCPDRSVKAESGFLDL  296

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT KDPN ++   SAREQ+
Sbjct  297  YTDKDPNCKYCKFSAREQI  315



>ref|XP_011042425.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like isoform 
X2 [Populus euphratica]
Length=435

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 118/200 (59%), Gaps = 15/200 (8%)
 Frame = +2

Query  47   TWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFF  226
             W ++ G ++W GLLDP++  LR  ++R G+  QA YD+F+ D  SKY GSCR+ +R F 
Sbjct  93   VWREIQGQDDWVGLLDPMDPLLRSELIRYGEMAQACYDAFDFDPFSKYCGSCRFIRRRFL  152

Query  227  HKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKAL  406
              + + +   Y+V  YLYAT+ + +P  F   S   + W  ++NWIGYVAV+ D  +K L
Sbjct  153  ESLGM-AHHGYEVTRYLYATSNIDLPN-FFKKSRWPKVWSNKANWIGYVAVSDDETTKCL  210

Query  407  GRREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLT  580
            GRR+I + +RGT T LEWI+  +   KP++A  +              D   KV +G+L 
Sbjct  211  GRRDISIAWRGTVTHLEWISDLMDFLKPINANKI-----------PCPDPTVKVEYGFLD  259

Query  581  LYTSKDPNSRFTTLSAREQL  640
            LYT KD N RF   SAREQ+
Sbjct  260  LYTDKDENCRFCKYSAREQI  279



>ref|XP_010278159.1| PREDICTED: phospholipase A1-Igamma1, chloroplastic-like [Nelumbo 
nucifera]
Length=525

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 117/199 (59%), Gaps = 15/199 (8%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++ G ++W GLLDP++  LR  ++R GD  QA YD+F+ DS SKY GSCR+ +R FF 
Sbjct  106  WREIQGQDDWAGLLDPMDPLLRSELIRYGDMAQACYDAFDFDSFSKYCGSCRFTRRKFFD  165

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
             + L S   Y V  YLY+TA + +P  F   S   + W R +NW+GYVAV++D  S  LG
Sbjct  166  CLGLTSL-GYDVSRYLYSTANINLPN-FFKKSRWPKVWSRNANWMGYVAVSNDDTSARLG  223

Query  410  RREIYVVFRGTTTDLEWINVFI--AKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            RR+I V +RGT T LEW+   +   +PVSA+ +     N            KV  G+L L
Sbjct  224  RRDIAVAWRGTVTRLEWVADLMDFLRPVSADKIPCPDPNA-----------KVESGFLDL  272

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT KD   RF   SAREQ+
Sbjct  273  YTDKDDKCRFCKFSAREQV  291



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 121/204 (59%), Gaps = 9/204 (4%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W +L G   WEGLL+PL++ LR  I++ G+    TYD+F ++  SKYAG+ RY
Sbjct  3    SMAEK--WEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               + F K  L     Y+V  Y YAT+ +P+P+AF+  SLSRE+W +ESN++GY+AV +D
Sbjct  61   SMENLFSKAGL-DPTKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMF  568
                +LGRR+I + +RGT   LEW+N      +    +      GD G     K P V  
Sbjct  120  EGKASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVF-----GDGGLLPLFK-PLVHH  173

Query  569  GWLTLYTSKDPNSRFTTLSAREQL  640
            G+  +YTS+   S++   SAR+Q+
Sbjct  174  GFYNVYTSESARSKYNQASARDQV  197



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 108/197 (55%), Gaps = 8/197 (4%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G +NW+GLLDPL+  LR  ++R G+  QAT D+F  D  S YAG+ RY   +F  
Sbjct  37   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +   P  D Y V  +LYAT+   VP  F+       +W  ESNW+GYVAV +DA    LG
Sbjct  97   RAQAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAVATDAGVARLG  156

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT   +EW N      V A  ++        G       P V  G+L++Y 
Sbjct  157  RRDIVVAWRGTKRAVEWANDLDITLVPAAGVV--------GPGPGWSQPAVHRGFLSVYA  208

Query  590  SKDPNSRFTTLSAREQL  640
            S++  SRF   SAREQ+
Sbjct  209  SRNSTSRFNKQSAREQV  225



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GLLDPL++ LR+ I+  G+  QA Y   N +  S+YAGSC + ++ F  
Sbjct  14   WRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSRKDFLS  73

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y +  ++YA   + +P+AF++ S S+ +W ++SNW+G+VAV +D   + LG
Sbjct  74   RVDVSNPNLYVITKFIYAMCTVSLPDAFMIKSWSKAAWSKQSNWMGFVAVATDEGKEVLG  133

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR++ V +RGT   +EW++      V A  ++R       G  +D   P V  GWL++YT
Sbjct  134  RRDVVVAWRGTIRMVEWMDDLDISLVPASEIVR------PGSADD---PCVHGGWLSVYT  184

Query  590  SKDPNSRFTTLSAREQL  640
            S DP S++   SAR Q+
Sbjct  185  SADPESQYNKQSARYQV  201



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 119/197 (60%), Gaps = 9/197 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G+  W+GLLDPL++ LR  I+  G+  QA Y   N +  S+YAGSC + +  F  
Sbjct  611  WRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRREDFLS  670

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            +V + + + Y++  ++YA   + +P+ F++ SLS+ +W ++SNW+G+VAV +D   + LG
Sbjct  671  RVDVSNPNLYEITKFIYAMCTVSLPDGFMIKSLSKAAWSKQSNWMGFVAVATDEGKEVLG  730

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR++ V +RGT   LEW++      V A  ++R       G  +D   P V  GWL++YT
Sbjct  731  RRDVVVAWRGTIRILEWMDDLDISLVPASEIVR------PGSADD---PCVHGGWLSVYT  781

Query  590  SKDPNSRFTTLSAREQL  640
            S DP SR+   SAR Q+
Sbjct  782  STDPGSRYNKQSARYQV  798



>ref|XP_011079988.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic isoform X1 
[Sesamum indicum]
Length=509

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 122/197 (62%), Gaps = 11/197 (6%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W ++LG ++W GLLDP++  LR+ ++R G   QA YD+F+ D  SKY GSCR+ +R FF 
Sbjct  89   WSEMLGEDDWAGLLDPMDPLLRNELIRYGVMAQACYDAFDFDPYSKYCGSCRFTRREFFE  148

Query  230  KVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKALG  409
            ++ +  A  Y +  YLYAT+ + +P  F  +S   + W + +NWIGY+AV++D  SK LG
Sbjct  149  RLGMAEA-GYDITRYLYATSNINLPN-FFKNSRWPKVWSKNANWIGYIAVSNDETSKKLG  206

Query  410  RREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTLYT  589
            RR+I V +RGT T LEW+   +         LR I++ DK    D  V +V  G+L LYT
Sbjct  207  RRDICVAWRGTVTRLEWVADLM-------DFLRPISS-DKIPSPDPTV-RVESGFLDLYT  257

Query  590  SKDPNSRFTTLSAREQL  640
             KD + ++   SAREQ+
Sbjct  258  DKDESCKYCKFSAREQI  274



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 120/210 (57%), Gaps = 21/210 (10%)
 Frame = +2

Query  29   SMATEPTWHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRY  208
            SMA +  W +L G  NW GLL+PL + LR  I+  G+  QATYD+F  +  SKYAG+ RY
Sbjct  3    SMAEK--WEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRY  60

Query  209  GKRSFFHKVMLPSADDYQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSD  388
               +FF KV L   + Y+V  + YAT+ +P+P+ F++ S SRE+W +ESN++GY+AV +D
Sbjct  61   SMENFFTKVGL-DPNKYRVTKFFYATSSIPLPDGFIVKSFSREAWSKESNFMGYIAVATD  119

Query  389  AVSKALGRREIYVVFRGTTTDLEWIN----VFIAKP--VSAESLLRSITNGDKGDEEDDK  550
                +LGRR+I V +RGT   +EW+N    + I  P    A  LL               
Sbjct  120  EGKASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFK-----------  168

Query  551  VPKVMFGWLTLYTSKDPNSRFTTLSAREQL  640
             P V  G+  +YTS    S+F   S R+Q+
Sbjct  169  -PLVHHGFYNVYTSASSRSQFNKTSVRDQV  197



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 115/199 (58%), Gaps = 10/199 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G   W+GLL+PL+  LR  I+  G+  Q  YD+FN D  S+YAG C Y KR  F 
Sbjct  9    WKELSGVNKWQGLLEPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSRYAGDCYYSKRQIFA  68

Query  230  KVMLPSADD--YQVEAYLYATAKLPVPEAFLLHSLSRESWDRESNWIGYVAVTSDAVSKA  403
            +     A+   Y V  Y+YATA L +P  F++ SLS+++   ++NW+GY+AV +D     
Sbjct  69   RTGFLKANPFRYNVTKYIYATASLKLPICFIVKSLSKDASRVQTNWMGYIAVATDEGKAM  128

Query  404  LGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWLTL  583
            LGRR+I V +RGT    EW N F     SA S+   +T       +   VP+V  GWL +
Sbjct  129  LGRRDIVVAWRGTLQPYEWANDFDFPLESAISVF-PVT-------DPKVVPRVGSGWLDV  180

Query  584  YTSKDPNSRFTTLSAREQL  640
            YT+ D NS + T SAREQ+
Sbjct  181  YTASDSNSPYDTTSAREQV  199



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 120/201 (60%), Gaps = 11/201 (5%)
 Frame = +2

Query  50   WHQLLGSENWEGLLDPLNLSLRHLILRCGDFCQATYDSFNNDSNSKYAGSCRYGKRSFFH  229
            W +L G+++W GLLDPL++ LR  ++  G+  QATYD FN +  S +AG+C +G  +   
Sbjct  10   WRELQGADSWSGLLDPLDIDLRANLIAYGELTQATYDGFNQERRSPHAGACVFGYSNLLA  69

Query  230  KVMLPSADDYQVEAYLYATAKLP-VPEAF---LLHSLSRESWDRESNWIGYVAVTSDAVS  397
                 +A  Y V  ++YAT+ LP VPEAF    L  L  ESW RESNW+GYVAV +D   
Sbjct  70   GSGAAAAGSYAVTRFIYATSALPGVPEAFLLLPLPDLLPESWSRESNWMGYVAVATDDGV  129

Query  398  KALGRREIYVVFRGTTTDLEWINVFIAKPVSAESLLRSITNGDKGDEEDDKVPKVMFGWL  577
             ALGRR+I V +RGT   LEW+N F   PVSA  +L             +    V  G+L
Sbjct  130  AALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAA-------NPFALVHRGFL  182

Query  578  TLYTSKDPNSRFTTLSAREQL  640
            ++YTS +P+S++   SAR+Q+
Sbjct  183  SVYTSSNPDSKYNQTSARDQV  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750