BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF031A16

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085122.1|  PREDICTED: eukaryotic translation initiation...    280   5e-86   Sesamum indicum [beniseed]
gb|EYU40305.1|  hypothetical protein MIMGU_mgv1a002098mg                273   2e-83   Erythranthe guttata [common monkey flower]
emb|CAN76773.1|  hypothetical protein VITISV_017587                     269   7e-82   Vitis vinifera
ref|XP_002285591.1|  PREDICTED: eukaryotic translation initiation...    269   8e-82   Vitis vinifera
emb|CDP20278.1|  unnamed protein product                                268   3e-81   Coffea canephora [robusta coffee]
ref|XP_009595023.1|  PREDICTED: eukaryotic translation initiation...    267   5e-81   Nicotiana tomentosiformis
ref|XP_006483512.1|  PREDICTED: eukaryotic translation initiation...    266   2e-80   Citrus sinensis [apfelsine]
ref|XP_003529057.1|  PREDICTED: eukaryotic translation initiation...    266   2e-80   Glycine max [soybeans]
ref|XP_007136910.1|  hypothetical protein PHAVU_009G0841000g            262   2e-80   Phaseolus vulgaris [French bean]
ref|XP_010108292.1|  Eukaryotic translation initiation factor 3 s...    265   5e-80   Morus notabilis
gb|KHN42137.1|  Eukaryotic translation initiation factor 3 subunit B    265   5e-80   Glycine soja [wild soybean]
sp|P56821.1|EIF3B_TOBAC  RecName: Full=Eukaryotic translation ini...    264   8e-80   Nicotiana tabacum [American tobacco]
ref|XP_008388785.1|  PREDICTED: eukaryotic translation initiation...    264   1e-79   Malus domestica [apple tree]
gb|KHN25084.1|  Eukaryotic translation initiation factor 3 subunit B    263   2e-79   Glycine soja [wild soybean]
ref|XP_007208057.1|  hypothetical protein PRUPE_ppa002067mg             262   4e-79   Prunus persica
ref|XP_003522102.1|  PREDICTED: eukaryotic translation initiation...    261   7e-79   Glycine max [soybeans]
ref|XP_008218420.1|  PREDICTED: eukaryotic translation initiation...    260   2e-78   Prunus mume [ume]
ref|XP_006354613.1|  PREDICTED: eukaryotic translation initiation...    260   3e-78   Solanum tuberosum [potatoes]
gb|KJB32894.1|  hypothetical protein B456_005G267000                    258   1e-77   Gossypium raimondii
gb|KHF99557.1|  Eukaryotic translation initiation factor 3 subunit B    258   2e-77   Gossypium arboreum [tree cotton]
ref|XP_007136908.1|  hypothetical protein PHAVU_009G084000g             258   2e-77   Phaseolus vulgaris [French bean]
ref|XP_009346830.1|  PREDICTED: eukaryotic translation initiation...    258   2e-77   Pyrus x bretschneideri [bai li]
gb|KGN44408.1|  hypothetical protein Csa_7G281370                       255   2e-76   Cucumis sativus [cucumbers]
ref|XP_004150392.1|  PREDICTED: eukaryotic translation initiation...    255   2e-76   
ref|XP_008461500.1|  PREDICTED: eukaryotic translation initiation...    255   2e-76   Cucumis melo [Oriental melon]
gb|KDP33486.1|  hypothetical protein JCGZ_07057                         255   2e-76   Jatropha curcas
ref|XP_007041117.1|  Translation initiation factor 3B1 isoform 2        252   3e-76   
ref|XP_004160247.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    254   5e-76   
gb|EPS67275.1|  hypothetical protein M569_07499                         253   7e-76   Genlisea aurea
gb|AIU34463.1|  putative eukaryotic translation initiation factor...    253   1e-75   Taraxacum brevicorniculatum
ref|XP_009337980.1|  PREDICTED: eukaryotic translation initiation...    253   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_004229693.1|  PREDICTED: eukaryotic translation initiation...    253   1e-75   Solanum lycopersicum
ref|XP_009784422.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    253   1e-75   Nicotiana sylvestris
gb|KCW52938.1|  hypothetical protein EUGRSUZ_J02249                     250   1e-75   Eucalyptus grandis [rose gum]
ref|XP_007041116.1|  Translation initiation factor 3B1 isoform 1        253   1e-75   
gb|KJB47937.1|  hypothetical protein B456_008G047600                    250   2e-75   Gossypium raimondii
ref|XP_008345739.1|  PREDICTED: eukaryotic translation initiation...    252   4e-75   
gb|KHG06633.1|  Eukaryotic translation initiation factor 3 subuni...    251   4e-75   Gossypium arboreum [tree cotton]
gb|KGN44089.1|  hypothetical protein Csa_7G181640                       247   4e-75   Cucumis sativus [cucumbers]
gb|KCW52937.1|  hypothetical protein EUGRSUZ_J02249                     249   5e-75   Eucalyptus grandis [rose gum]
gb|KJB47936.1|  hypothetical protein B456_008G047600                    251   5e-75   Gossypium raimondii
ref|XP_004501412.1|  PREDICTED: eukaryotic translation initiation...    251   6e-75   
ref|XP_010933521.1|  PREDICTED: eukaryotic translation initiation...    251   8e-75   Elaeis guineensis
ref|XP_010033332.1|  PREDICTED: eukaryotic translation initiation...    250   1e-74   Eucalyptus grandis [rose gum]
ref|XP_002515389.1|  Eukaryotic translation initiation factor 3 s...    249   2e-74   Ricinus communis
ref|XP_008447809.1|  PREDICTED: eukaryotic translation initiation...    249   3e-74   Cucumis melo [Oriental melon]
ref|XP_004139759.1|  PREDICTED: eukaryotic translation initiation...    248   1e-73   
ref|XP_008786288.1|  PREDICTED: eukaryotic translation initiation...    248   1e-73   Phoenix dactylifera
ref|XP_006371769.1|  Eukaryotic translation initiation factor 3 s...    247   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011036732.1|  PREDICTED: eukaryotic translation initiation...    247   2e-73   Populus euphratica
ref|XP_010525888.1|  PREDICTED: eukaryotic translation initiation...    245   7e-73   Tarenaya hassleriana [spider flower]
ref|XP_009381931.1|  PREDICTED: eukaryotic translation initiation...    245   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302144.1|  PREDICTED: eukaryotic translation initiation...    244   2e-72   Fragaria vesca subsp. vesca
ref|XP_008784685.1|  PREDICTED: eukaryotic translation initiation...    244   3e-72   Phoenix dactylifera
ref|XP_010245655.1|  PREDICTED: eukaryotic translation initiation...    243   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010276277.1|  PREDICTED: eukaryotic translation initiation...    243   9e-72   Nelumbo nucifera [Indian lotus]
gb|KHN47647.1|  Eukaryotic translation initiation factor 3 subunit B    228   1e-71   Glycine soja [wild soybean]
emb|CAD29833.1|  translation initiation factor                          228   4e-71   Viscum album subsp. album
ref|XP_002308719.1|  Eukaryotic translation initiation factor 3 s...    241   5e-71   Populus trichocarpa [western balsam poplar]
gb|KDO67378.1|  hypothetical protein CISIN_1g005140mg                   240   5e-71   Citrus sinensis [apfelsine]
ref|XP_011031407.1|  PREDICTED: eukaryotic translation initiation...    240   6e-71   Populus euphratica
ref|XP_010675245.1|  PREDICTED: eukaryotic translation initiation...    240   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010495540.1|  PREDICTED: eukaryotic translation initiation...    231   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010919846.1|  PREDICTED: eukaryotic translation initiation...    239   2e-70   
gb|AIZ68196.1|  eukaryotic translation initiation factor 3 subuni...    238   7e-70   Ornithogalum longebracteatum [sea-onion]
gb|AES73491.2|  eukaryotic translation initiation factor 3 subunit B    237   1e-69   Medicago truncatula
ref|XP_010232157.1|  PREDICTED: eukaryotic translation initiation...    236   2e-69   Brachypodium distachyon [annual false brome]
ref|XP_003603240.1|  Eukaryotic translation initiation factor 3 s...    236   3e-69   
ref|XP_003578786.1|  PREDICTED: eukaryotic translation initiation...    236   3e-69   Brachypodium distachyon [annual false brome]
ref|NP_568498.1|  translation initiation factor 3 subunit B             235   5e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EMT20627.1|  Eukaryotic translation initiation factor 3 subunit B    234   9e-69   
dbj|BAJ85622.1|  predicted protein                                      234   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54123.1|  Eukaryotic translation initiation factor 3 subunit B    234   2e-68   Triticum urartu
ref|XP_010695357.1|  PREDICTED: eukaryotic translation initiation...    233   2e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010455107.1|  PREDICTED: eukaryotic translation initiation...    234   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002872264.1|  TIF3B1                                             233   3e-68   
gb|EMS45026.1|  Eukaryotic translation initiation factor 3 subunit B    233   3e-68   Triticum urartu
ref|XP_010421590.1|  PREDICTED: eukaryotic translation initiation...    233   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006287159.1|  hypothetical protein CARUB_v10000332mg             232   7e-68   Capsella rubella
gb|ABK25119.1|  unknown                                                 231   1e-67   Picea sitchensis
ref|XP_004983594.1|  PREDICTED: eukaryotic translation initiation...    229   7e-67   Setaria italica
ref|XP_009140599.1|  PREDICTED: eukaryotic translation initiation...    229   8e-67   Brassica rapa
ref|XP_008664809.1|  PREDICTED: uncharacterized protein LOC100216...    226   1e-65   
emb|CDY34755.1|  BnaA09g41220D                                          226   2e-65   Brassica napus [oilseed rape]
ref|XP_009117099.1|  PREDICTED: eukaryotic translation initiation...    225   2e-65   Brassica rapa
ref|XP_002464900.1|  hypothetical protein SORBIDRAFT_01g028520          225   2e-65   Sorghum bicolor [broomcorn]
emb|CDX76792.1|  BnaC08g33780D                                          224   8e-65   
gb|KFK32610.1|  hypothetical protein AALP_AA6G266400                    223   2e-64   Arabis alpina [alpine rockcress]
ref|NP_568477.1|  eukaryotic translation initiation factor 3B-2         223   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAF67758.1|AF255680_1  eIF3b                                         223   3e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36167.1|  BnaC04g37270D                                          222   3e-64   Brassica napus [oilseed rape]
ref|XP_009789485.1|  PREDICTED: eukaryotic translation initiation...    213   1e-63   Nicotiana sylvestris
ref|NP_001031954.1|  translation initiation factor 3 subunit B          221   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421436.1|  PREDICTED: eukaryotic translation initiation...    219   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010454917.1|  PREDICTED: eukaryotic translation initiation...    217   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009140598.1|  PREDICTED: eukaryotic translation initiation...    216   7e-62   Brassica rapa
ref|XP_006405042.1|  hypothetical protein EUTSA_v10000061mg             215   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_002874283.1|  TIF3B1                                             214   3e-61   
ref|XP_010493833.1|  PREDICTED: eukaryotic translation initiation...    212   2e-60   Camelina sativa [gold-of-pleasure]
gb|EEE51441.1|  hypothetical protein OsJ_32527                          208   3e-59   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065446.1|  Os10g0569200                                       209   3e-59   
gb|EEC67477.1|  hypothetical protein OsI_34716                          209   3e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_006662084.1|  PREDICTED: eukaryotic translation initiation...    206   3e-58   Oryza brachyantha
ref|XP_006855977.1|  hypothetical protein AMTR_s00037p00235640          201   1e-56   Amborella trichopoda
gb|KHN29662.1|  Eukaryotic translation initiation factor 3 subunit B    189   3e-55   Glycine soja [wild soybean]
ref|XP_001771510.1|  predicted protein                                  192   2e-53   
ref|XP_006495404.1|  PREDICTED: eukaryotic translation initiation...    177   8e-53   Citrus sinensis [apfelsine]
ref|XP_006450239.1|  hypothetical protein CICLE_v100076091mg            177   9e-53   
ref|XP_001770820.1|  predicted protein                                  190   2e-52   
ref|XP_006841801.1|  hypothetical protein AMTR_s00003p00268400          188   6e-52   Amborella trichopoda
ref|XP_002986150.1|  hypothetical protein SELMODRAFT_182220             179   2e-48   Selaginella moellendorffii
ref|XP_009784533.1|  PREDICTED: eukaryotic translation initiation...    165   7e-48   Nicotiana sylvestris
ref|XP_002984964.1|  hypothetical protein SELMODRAFT_446105             177   1e-47   Selaginella moellendorffii
gb|ABI14666.1|  eukaryotic translation initiation factor 3 subunit      156   9e-45   Aegiceras corniculatum
gb|EMT30161.1|  Callose synthase 3                                      170   1e-44   
ref|XP_006412558.1|  hypothetical protein EUTSA_v10027018mg             159   1e-41   
gb|EMT19614.1|  Eukaryotic translation initiation factor 3 subunit B    150   1e-38   
ref|XP_002505347.1|  eukaryotic translation initiation factor-lik...    151   1e-38   Micromonas commoda
gb|KIZ03095.1|  Eukaryotic translation initiation factor 3 subunit B    139   4e-37   Monoraphidium neglectum
ref|XP_007514980.1|  predicted protein                                  146   1e-36   Bathycoccus prasinos
ref|XP_001421305.1|  predicted protein                                  137   2e-33   Ostreococcus lucimarinus CCE9901
ref|XP_005648006.1|  eukaryotic initiation factor                       135   5e-33   Coccomyxa subellipsoidea C-169
ref|XP_008229535.1|  PREDICTED: eukaryotic translation initiation...    124   2e-31   
ref|XP_007209600.1|  hypothetical protein PRUPE_ppa011445mg             124   3e-31   
ref|XP_008229533.1|  PREDICTED: eukaryotic translation initiation...    124   9e-31   
ref|XP_008229534.1|  PREDICTED: eukaryotic translation initiation...    124   1e-30   Prunus mume [ume]
ref|XP_008229532.1|  PREDICTED: eukaryotic translation initiation...    123   1e-30   Prunus mume [ume]
ref|XP_003083330.1|  Translation initiation factor 3, subunit b (...    128   2e-30   
emb|CEG01790.1|  Eukaryotic translation initiation factor 3 subun...    128   2e-30   Ostreococcus tauri
ref|XP_009371884.1|  PREDICTED: eukaryotic translation initiation...    120   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009339401.1|  PREDICTED: eukaryotic translation initiation...    119   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_001691870.1|  eukaryotic initiation factor                       120   2e-27   Chlamydomonas reinhardtii
ref|XP_006287158.1|  hypothetical protein CARUB_v10000332mg             119   3e-27   
ref|XP_004301706.1|  PREDICTED: eukaryotic translation initiation...    111   4e-26   Fragaria vesca subsp. vesca
ref|XP_008364498.1|  PREDICTED: eukaryotic translation initiation...    111   4e-26   
ref|XP_010110499.1|  Eukaryotic translation initiation factor 3 s...    109   1e-25   Morus notabilis
ref|XP_003060268.1|  predicted protein                                  112   9e-25   Micromonas pusilla CCMP1545
ref|XP_005852304.1|  hypothetical protein CHLNCDRAFT_59481              108   1e-24   Chlorella variabilis
ref|XP_004341005.1|  eukaryotic translation initiation factor fam...    108   2e-23   Acanthamoeba castellanii str. Neff
ref|XP_009045450.1|  hypothetical protein LOTGIDRAFT_230249             105   3e-22   Lottia gigantea
ref|XP_002595784.1|  hypothetical protein BRAFLDRAFT_131352             104   6e-22   Branchiostoma floridae
ref|XP_002958408.1|  eukaryotic translation initiation factor 3b        104   6e-22   Volvox carteri f. nagariensis
ref|XP_005108064.1|  PREDICTED: eukaryotic translation initiation...    103   7e-22   Aplysia californica
ref|XP_002736509.1|  PREDICTED: eukaryotic translation initiation...    103   1e-21   Saccoglossus kowalevskii
gb|ELT99648.1|  hypothetical protein CAPTEDRAFT_163351                  103   1e-21   Capitella teleta
gb|KDD76724.1|  eukaryotic translation initiation factor eIF2A          101   6e-21   Helicosporidium sp. ATCC 50920
ref|XP_005829927.1|  translation initiation factor 3, subunit B         100   9e-21   Guillardia theta CCMP2712
ref|XP_011398773.1|  Eukaryotic translation initiation factor 3 s...  99.8    2e-20   Auxenochlorella protothecoides
gb|KHN36468.1|  Eukaryotic translation initiation factor 3 subunit B  92.4    2e-20   Glycine soja [wild soybean]
ref|XP_003729782.1|  PREDICTED: eukaryotic translation initiation...  98.2    8e-20   
ref|XP_796053.3|  PREDICTED: eukaryotic translation initiation fa...  98.2    8e-20   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001652847.1|  AAEL007718-PA                                    97.4    1e-19   
ref|XP_011348022.1|  PREDICTED: eukaryotic translation initiation...  97.4    1e-19   Ooceraea biroi
ref|XP_001843846.1|  eukaryotic translation initiation factor 3 s...  96.3    3e-19   Culex quinquefasciatus
ref|XP_007247954.1|  PREDICTED: eukaryotic translation initiation...  95.9    4e-19   
ref|XP_011432969.1|  PREDICTED: eukaryotic translation initiation...  95.9    4e-19   Crassostrea gigas
ref|XP_011270842.1|  hypothetical protein CAOG_09132                  95.9    4e-19   Capsaspora owczarzaki ATCC 30864
ref|XP_011066137.1|  PREDICTED: eukaryotic translation initiation...  95.9    5e-19   Acromyrmex echinatior
gb|KHN02147.1|  Eukaryotic translation initiation factor 3 subunit B  88.6    6e-19   Glycine soja [wild soybean]
gb|KDQ19939.1|  hypothetical protein BOTBODRAFT_152536                95.5    7e-19   Botryobasidium botryosum FD-172 SS1
emb|CCG80846.1|  Eukaryotic translation initiation factor 3 subun...  95.1    9e-19   Taphrina deformans PYCC 5710
emb|CBJ29502.1|  eukaryotic initiation factor 3b                      94.7    1e-18   Ectocarpus siliculosus
ref|XP_006730091.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-18   Leptonychotes weddellii
ref|XP_011176217.1|  PREDICTED: eukaryotic translation initiation...  94.7    1e-18   Solenopsis invicta [imported red fire ant]
ref|NP_001277022.1|  eukaryotic translation initiation factor 3 s...  94.4    1e-18   Danio rerio [leopard danio]
ref|XP_008367810.1|  PREDICTED: eukaryotic translation initiation...  89.4    1e-18   
ref|XP_002092076.1|  GE11867                                          94.0    2e-18   Drosophila yakuba
ref|XP_010863060.1|  PREDICTED: eukaryotic translation initiation...  94.0    2e-18   Esox lucius
gb|AAP21880.1|  unknown                                               91.7    2e-18   Homo sapiens [man]
gb|EWM25691.1|  eukaryotic translation initiation factor 3            94.0    2e-18   Nannochloropsis gaditana
ref|XP_010225423.1|  PREDICTED: eukaryotic translation initiation...  87.8    2e-18   Tinamus guttatus
ref|XP_011254633.1|  PREDICTED: eukaryotic translation initiation...  93.6    3e-18   Camponotus floridanus
ref|XP_002049756.1|  GJ20575                                          92.8    5e-18   Drosophila virilis
ref|XP_001974524.1|  GG21791                                          92.8    5e-18   Drosophila erecta
ref|XP_006637297.1|  PREDICTED: eukaryotic translation initiation...  92.8    5e-18   Lepisosteus oculatus
gb|KDR10090.1|  Eukaryotic translation initiation factor 3 subunit B  92.4    7e-18   Zootermopsis nevadensis
gb|ELK09238.1|  Eukaryotic translation initiation factor 3 subunit B  92.0    8e-18   Pteropus alecto
ref|XP_004672764.1|  PREDICTED: eukaryotic translation initiation...  92.4    8e-18   Jaculus jaculus
ref|XP_004705943.1|  PREDICTED: eukaryotic translation initiation...  92.0    8e-18   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003416544.1|  PREDICTED: eukaryotic translation initiation...  92.4    8e-18   Loxodonta africana [African bush elephant]
ref|XP_004385981.1|  PREDICTED: eukaryotic translation initiation...  92.4    8e-18   Trichechus manatus latirostris
ref|XP_004629754.1|  PREDICTED: eukaryotic translation initiation...  92.4    9e-18   
ref|XP_004598208.1|  PREDICTED: eukaryotic translation initiation...  92.0    9e-18   
ref|XP_005397937.1|  PREDICTED: eukaryotic translation initiation...  92.4    9e-18   Chinchilla lanigera
ref|XP_007939402.1|  PREDICTED: eukaryotic translation initiation...  92.4    9e-18   Orycteropus afer afer
ref|XP_005340894.1|  PREDICTED: eukaryotic translation initiation...  92.0    9e-18   Ictidomys tridecemlineatus
ref|XP_010329908.1|  PREDICTED: eukaryotic translation initiation...  92.4    9e-18   Saimiri boliviensis boliviensis
ref|XP_005766982.1|  hypothetical protein EMIHUDRAFT_51173            91.7    9e-18   Emiliania huxleyi CCMP1516
ref|XP_003423811.1|  PREDICTED: eukaryotic translation initiation...  92.0    9e-18   Nasonia vitripennis
ref|XP_007379104.1|  translation initiation factor eIF-3b             92.0    9e-18   Punctularia strigosozonata HHB-11173 SS5
ref|XP_011376839.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   
ref|XP_003470101.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Cavia porcellus [guinea pig]
ref|XP_008971434.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  92.0    1e-17   
ref|XP_008048700.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Carlito syrichta
ref|XP_002744483.2|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Callithrix jacchus [common marmoset]
gb|EPQ18395.1|  Eukaryotic translation initiation factor 3 subunit B  92.0    1e-17   Myotis brandtii
ref|XP_006765559.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   
gb|EPY89345.1|  hypothetical protein CB1_000114010                    92.4    1e-17   Camelus ferus
ref|XP_005883424.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_003496346.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Cricetulus griseus [Chinese hamsters]
gb|EAL23952.1|  eukaryotic translation initiation factor 3, subun...  92.0    1e-17   Homo sapiens [man]
dbj|BAG62591.1|  unnamed protein product                              92.0    1e-17   Homo sapiens [man]
ref|XP_007094914.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Panthera tigris altaica
ref|XP_011288807.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_003697518.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Apis florea [dwarf honeybee]
ref|XP_004440982.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_393588.2|  PREDICTED: eukaryotic translation initiation fa...  91.7    1e-17   Apis mellifera [bee]
ref|XP_002155584.2|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Hydra vulgaris
ref|XP_006108329.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_006167965.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   
gb|ERE76540.1|  eukaryotic translation initiation factor 3 subunit B  92.0    1e-17   Cricetulus griseus [Chinese hamsters]
ref|XP_004688115.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Condylura cristata
ref|XP_010364964.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Rhinopithecus roxellana
ref|XP_005368038.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Microtus ochrogaster [prairie voles]
ref|XP_008564978.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005615263.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  91.7    1e-17   
ref|XP_006915964.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_005549077.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Macaca fascicularis [crab eating macaque]
ref|XP_003697519.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_004394188.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   
ref|NP_598677.1|  eukaryotic translation initiation factor 3 subu...  92.0    1e-17   Mus musculus [mouse]
gb|ELK28992.1|  Eukaryotic translation initiation factor 3 subunit B  90.9    1e-17   Myotis davidii
gb|ETN66698.1|  eukaryotic translation initiation factor 3 subunit 9  91.7    1e-17   Anopheles darlingi [American malaria mosquito]
ref|XP_005080033.1|  PREDICTED: eukaryotic translation initiation...  92.0    1e-17   Mesocricetus auratus [Syrian golden hamster]
ref|XP_536894.3|  PREDICTED: eukaryotic translation initiation fa...  92.0    1e-17   
dbj|BAG63448.1|  unnamed protein product                              91.7    1e-17   Homo sapiens [man]
ref|XP_008519592.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Equus przewalskii [Przewalski horse]
ref|NP_003742.2|  eukaryotic translation initiation factor 3 subu...  92.0    1e-17   Homo sapiens [man]
ref|XP_009200773.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  91.7    1e-17   
ref|XP_006450238.1|  hypothetical protein CICLE_v100076092mg          91.3    1e-17   
ref|XP_001086876.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
ref|XP_008696680.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Ursus maritimus [white bear]
ref|XP_005549076.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Macaca fascicularis [crab eating macaque]
gb|KHN29644.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    1e-17   Glycine soja [wild soybean]
ref|XP_006990812.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Peromyscus maniculatus bairdii
ref|NP_001026810.1|  eukaryotic translation initiation factor 3 s...  91.7    1e-17   Rattus norvegicus [brown rat]
gb|AAC99479.1|  eukaryotic translation initiation factor              91.7    1e-17   Homo sapiens [man]
ref|XP_003278760.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  92.0    1e-17   
ref|XP_002006089.1|  GI20840                                          91.7    1e-17   Drosophila mojavensis
ref|XP_010641158.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Fukomys damarensis [Damara mole rat]
ref|XP_003702862.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Megachile rotundata
ref|XP_007631404.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   
gb|AAH07175.1|  Eif3b protein                                         91.3    1e-17   Mus musculus [mouse]
gb|EAW87239.1|  eukaryotic translation initiation factor 3, subun...  91.7    1e-17   Homo sapiens [man]
ref|XP_006859850.1|  PREDICTED: eukaryotic translation initiation...  91.7    1e-17   Chrysochloris asiatica
ref|XP_004776427.1|  PREDICTED: eukaryotic translation initiation...  91.7    2e-17   
gb|AAB42010.1|  Prt1 homolog                                          91.7    2e-17   Homo sapiens [man]
ref|XP_004617310.1|  PREDICTED: eukaryotic translation initiation...  91.7    2e-17   Sorex araneus [Eurasian shrew]
ref|XP_009240769.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  91.7    2e-17   
ref|XP_003318263.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  91.7    2e-17   
ref|XP_004815751.1|  PREDICTED: eukaryotic translation initiation...  91.7    2e-17   
ref|XP_008849626.1|  PREDICTED: eukaryotic translation initiation...  91.7    2e-17   Nannospalax galili
ref|XP_001513573.2|  PREDICTED: eukaryotic translation initiation...  91.3    2e-17   
ref|XP_003761584.1|  PREDICTED: eukaryotic translation initiation...  91.3    2e-17   Sarcophilus harrisii
ref|XP_007498394.1|  PREDICTED: eukaryotic translation initiation...  91.3    2e-17   Monodelphis domestica
ref|XP_006611541.1|  PREDICTED: eukaryotic translation initiation...  91.3    2e-17   Apis dorsata [rock honeybee]
gb|AAH23767.1|  Eif3b protein                                         91.7    2e-17   Mus musculus [mouse]
ref|XP_008251049.1|  PREDICTED: eukaryotic translation initiation...  91.7    2e-17   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002034296.1|  GM21793                                          90.9    2e-17   Drosophila sechellia
ref|XP_006210499.1|  PREDICTED: eukaryotic translation initiation...  90.9    2e-17   
ref|XP_010830964.1|  PREDICTED: eukaryotic translation initiation...  90.9    2e-17   Bison bison bison
ref|XP_006046081.1|  PREDICTED: eukaryotic translation initiation...  91.3    2e-17   
ref|XP_002081927.1|  GD11284                                          90.9    2e-17   Drosophila simulans
dbj|BAN20592.1|  eukaryotic translation initiation factor 3 subun...  90.9    2e-17   Riptortus pedestris
ref|XP_007467476.1|  PREDICTED: eukaryotic translation initiation...  90.9    2e-17   Lipotes vexillifer [baiji]
ref|XP_011498180.1|  PREDICTED: eukaryotic translation initiation...  90.9    2e-17   Ceratosolen solmsi marchali
ref|XP_005698181.1|  PREDICTED: eukaryotic translation initiation...  90.5    2e-17   
ref|XP_007174714.1|  PREDICTED: eukaryotic translation initiation...  90.9    2e-17   
ref|XP_005887389.1|  PREDICTED: eukaryotic translation initiation...  90.5    3e-17   Bos mutus
ref|XP_006173591.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   
ref|XP_010997888.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   Camelus dromedarius [camel]
ref|NP_001095826.1|  eukaryotic translation initiation factor 3 s...  90.9    3e-17   Bos taurus [bovine]
ref|XP_010964806.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   Camelus bactrianus [camel]
dbj|BAM20397.1|  eukaryotic translation initiation factor 3 subun...  90.5    3e-17   Papilio polytes
gb|ELR62526.1|  Eukaryotic translation initiation factor 3 subunit B  91.3    3e-17   Bos mutus
ref|XP_004320350.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  90.9    3e-17   
ref|XP_007467475.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   Lipotes vexillifer [baiji]
gb|KFO25335.1|  Eukaryotic translation initiation factor 3 subunit B  91.3    3e-17   Fukomys damarensis [Damara mole rat]
ref|XP_003795497.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   
ref|XP_004269024.1|  PREDICTED: eukaryotic translation initiation...  90.9    3e-17   
ref|XP_001960748.1|  GF11342                                          90.5    3e-17   
ref|XP_005953850.1|  PREDICTED: eukaryotic translation initiation...  90.5    3e-17   
ref|XP_002063421.1|  GK21404                                          90.5    3e-17   
ref|NP_611228.1|  eIF3-S9, isoform B                                  90.5    3e-17   
ref|XP_008154277.1|  PREDICTED: eukaryotic translation initiation...  90.5    3e-17   
gb|AAM52578.1|  AT09438p                                              90.5    3e-17   
ref|XP_004021376.1|  PREDICTED: eukaryotic translation initiation...  90.5    4e-17   
ref|XP_004892431.1|  PREDICTED: eukaryotic translation initiation...  90.1    4e-17   
emb|CEL56810.1|  Eukaryotic translation initiation factor 3 subun...  89.0    4e-17   
ref|XP_004840481.1|  PREDICTED: eukaryotic translation initiation...  90.1    4e-17   
ref|XP_007525166.1|  PREDICTED: eukaryotic translation initiation...  90.1    5e-17   
ref|XP_002016199.1|  GL11461                                          90.1    5e-17   
gb|ERZ94763.1|  hypothetical protein GLOINDRAFT_341583                90.1    5e-17   
gb|KFM63204.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    5e-17   
ref|XP_007861072.1|  translation initiation factor eIF-3b             90.1    5e-17   
gb|KFO81811.1|  Eukaryotic translation initiation factor 3 subunit B  89.0    5e-17   
gb|KFM12378.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    5e-17   
gb|KFW64358.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    6e-17   
gb|EHB07911.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    6e-17   
gb|KFQ68134.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    6e-17   
gb|KFP21771.1|  Eukaryotic translation initiation factor 3 subunit B  89.7    6e-17   
gb|KFV61445.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFQ49346.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFP46951.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFV97319.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFR12266.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|EOB00916.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFQ99849.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFV42036.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFP58302.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFO09109.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFV52129.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFW94620.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFZ66175.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KDQ30689.1|  hypothetical protein PLEOSDRAFT_1062676               90.1    6e-17   
gb|KFZ65624.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFP87618.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009578594.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
gb|KFW84435.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009090340.1|  PREDICTED: eukaryotic translation initiation...  89.7    6e-17   
gb|KFP96431.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFO92180.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009934823.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
gb|KFQ22872.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009808230.1|  PREDICTED: eukaryotic translation initiation...  89.7    6e-17   
ref|XP_009509726.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_010173760.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
gb|KFQ49488.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFU98606.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
gb|KFQ08173.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009284832.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_009698341.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_009476287.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_009080010.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_009959720.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_008926400.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
gb|KFQ18372.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    6e-17   
ref|XP_009644219.1|  PREDICTED: eukaryotic translation initiation...  89.4    6e-17   
ref|XP_009318344.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_008937388.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
gb|KFO59036.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
gb|KFV09322.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
ref|XP_009986913.1|  PREDICTED: eukaryotic translation initiation...  89.7    7e-17   
ref|XP_005487519.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_005229148.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009961250.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009566848.1|  PREDICTED: eukaryotic translation initiation...  89.0    7e-17   
ref|XP_010001646.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
gb|KFV75198.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
gb|KFU93921.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
ref|XP_009466192.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_004459096.1|  PREDICTED: eukaryotic translation initiation...  89.7    7e-17   
gb|KFV90979.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
ref|XP_003470094.1|  PREDICTED: eukaryotic translation initiation...  89.7    7e-17   
ref|XP_008631870.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009884341.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009862650.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_010074670.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_010012782.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_005504631.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_005020204.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
gb|EMC88506.1|  Eukaryotic translation initiation factor 3 subunit B  89.4    7e-17   
ref|XP_009688428.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009922320.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_010159954.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_003400822.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_009896080.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_010289877.1|  PREDICTED: eukaryotic translation initiation...  89.4    7e-17   
ref|XP_010390974.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_005438287.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_010568891.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_003642190.2|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_010718149.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_003400823.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_008551694.1|  PREDICTED: eukaryotic translation initiation...  89.4    8e-17   
ref|XP_002191028.2|  PREDICTED: eukaryotic translation initiation...  89.4    9e-17   
ref|XP_006034509.1|  PREDICTED: eukaryotic translation initiation...  89.4    9e-17   
ref|XP_005054707.1|  PREDICTED: eukaryotic translation initiation...  89.4    9e-17   
ref|XP_005420512.1|  PREDICTED: eukaryotic translation initiation...  89.4    9e-17   
ref|XP_010182788.1|  PREDICTED: eukaryotic translation initiation...  89.4    9e-17   
ref|XP_011144150.1|  PREDICTED: eukaryotic translation initiation...  89.0    9e-17   
ref|XP_007442220.1|  PREDICTED: eukaryotic translation initiation...  89.0    1e-16   
ref|XP_005523244.1|  PREDICTED: eukaryotic translation initiation...  89.4    1e-16   
ref|XP_011179376.1|  PREDICTED: eukaryotic translation initiation...  89.0    1e-16   
gb|KFP04537.1|  Eukaryotic translation initiation factor 3 subunit B  88.6    1e-16   
ref|XP_008496803.1|  PREDICTED: eukaryotic translation initiation...  88.6    1e-16   
ref|XP_006113006.1|  PREDICTED: eukaryotic translation initiation...  88.6    1e-16   
ref|XP_003871423.1|  Prt1 translation initiation factor eIF3          88.6    1e-16   
gb|KFH64958.1|  hypothetical protein MVEG_09686                       88.6    1e-16   
ref|XP_003833509.1|  similar to eukaryotic translation initiation...  88.6    2e-16   
ref|XP_001986041.1|  GH20755                                          88.2    2e-16   
ref|XP_009029697.1|  hypothetical protein HELRODRAFT_157973           88.2    2e-16   
gb|EHJ75157.1|  eukaryotic translation initiation factor 3 subunit B  87.8    2e-16   
ref|XP_001630617.1|  predicted protein                                87.8    2e-16   
ref|XP_007904268.1|  PREDICTED: eukaryotic translation initiation...  87.8    2e-16   
ref|XP_007714108.1|  hypothetical protein COCCADRAFT_100901           87.8    3e-16   
ref|XP_003226093.1|  PREDICTED: eukaryotic translation initiation...  88.2    3e-16   
emb|CEP14052.1|  hypothetical protein                                 87.8    3e-16   
ref|XP_011206533.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  87.8    3e-16   
gb|EFO22253.2|  Eif3s9 protein                                        87.8    3e-16   
gb|EPB87554.1|  hypothetical protein HMPREF1544_05645                 87.8    3e-16   
gb|KDO35278.1|  hypothetical protein SPRG_00125                       87.4    3e-16   
gb|ELU36463.1|  PRT1p                                                 87.4    3e-16   
ref|XP_005289179.1|  PREDICTED: eukaryotic translation initiation...  87.4    3e-16   
gb|KEP45722.1|  eukaryotic translation initiation factor 3 subunit B  87.4    3e-16   
ref|XP_008544236.1|  PREDICTED: eukaryotic translation initiation...  87.4    3e-16   
gb|EUC63755.1|  eukaryotic translation initiation factor 3 subunit B  87.4    3e-16   
emb|CDS14363.1|  hypothetical protein LRAMOSA06532                    87.4    4e-16   
ref|XP_505484.1|  YALI0F16115p                                        87.0    5e-16   
ref|XP_005145359.1|  PREDICTED: eukaryotic translation initiation...  87.0    5e-16   
ref|NP_001090004.1|  eukaryotic translation initiation factor 3 s...  86.7    5e-16   
ref|XP_320387.3|  AGAP012140-PA                                       86.7    5e-16   
gb|EMP30609.1|  Eukaryotic translation initiation factor 3 subunit B  86.7    7e-16   
ref|XP_008031612.1|  hypothetical protein SETTUDRAFT_166441           86.7    7e-16   
ref|XP_007692972.1|  hypothetical protein COCMIDRAFT_9628             86.7    7e-16   
ref|XP_007065442.1|  PREDICTED: eukaryotic translation initiation...  86.3    7e-16   
gb|EMD91216.1|  hypothetical protein COCHEDRAFT_1137760               86.7    7e-16   
ref|XP_001793927.1|  hypothetical protein SNOG_03359                  85.9    8e-16   
ref|NP_001037602.1|  eukaryotic translation initiation factor 3 s...  86.3    8e-16   
pdb|2NLW|A  Chain A, Solution Structure Of The Rrm Domain Of Huma...  80.5    8e-16   
ref|XP_009040894.1|  hypothetical protein AURANDRAFT_72539            86.3    9e-16   
ref|XP_003296342.1|  hypothetical protein PTT_06069                   86.3    9e-16   
gb|ABS57453.1|  eukaryotic initiation factor 3B                       83.6    1e-15   
gb|KJA29132.1|  hypothetical protein HYPSUDRAFT_127411                85.9    1e-15   
emb|CDH56823.1|  translation initiation factor eif-3b                 85.5    1e-15   
ref|XP_007702511.1|  hypothetical protein COCSADRAFT_95303            85.5    2e-15   
ref|XP_002109554.1|  hypothetical protein TRIADDRAFT_21889            85.5    2e-15   
ref|XP_005191842.1|  PREDICTED: eukaryotic translation initiation...  85.1    2e-15   
ref|XP_007842236.1|  eukaryotic translation initiation factor 3 s...  85.1    2e-15   
emb|CCE42005.1|  hypothetical protein CPAR2_805540                    85.1    2e-15   
ref|XP_972849.1|  PREDICTED: eukaryotic translation initiation fa...  85.1    2e-15   
dbj|GAN08844.1|  translation initiation factor eIF-3b                 85.1    2e-15   
ref|XP_001933045.1|  eukaryotic translation initiation factor 3 s...  84.7    3e-15   
ref|XP_011302520.1|  PREDICTED: eukaryotic translation initiation...  84.3    3e-15   
emb|CCJ28370.1|  unnamed protein product                              84.7    3e-15   
gb|KIM48103.1|  hypothetical protein M413DRAFT_439812                 84.3    3e-15   
emb|CCM03363.1|  predicted protein                                    84.3    4e-15   
gb|KDR85099.1|  hypothetical protein GALMADRAFT_233724                84.3    4e-15   
ref|XP_007304673.1|  translation initiation factor eIF-3b             84.3    4e-15   
emb|CEI87545.1|  Putative Eukaryotic translation initiation facto...  84.0    4e-15   
emb|CEG64275.1|  Putative Eukaryotic translation initiation facto...  84.0    5e-15   
gb|KFD48737.1|  hypothetical protein M513_10367                       84.0    5e-15   
gb|ENN71245.1|  hypothetical protein YQE_12172                        84.0    5e-15   
emb|CDP95155.1|  Protein BM-EIF-3.B, isoform c                        83.6    7e-15   
gb|KII93546.1|  hypothetical protein PLICRDRAFT_121832                82.8    1e-14   
gb|KDQ52424.1|  hypothetical protein JAAARDRAFT_162852                82.8    1e-14   
emb|CDW61058.1|  eukaryotic translation initiation factor 3           82.8    1e-14   
ref|XP_002429331.1|  eukaryotic translation initiation factor 3 s...  82.4    1e-14   
emb|CDM27438.1|  Translation initiation factor eIF-3b                 82.4    2e-14   
gb|KEQ91035.1|  hypothetical protein AUEXF2481DRAFT_44426             82.0    2e-14   
gb|EKV09808.1|  Eukaryotic translation initiation factor 3 subunit B  82.0    2e-14   
ref|XP_001895731.1|  hypothetical protein Bm1_21385                   78.6    2e-14   
ref|XP_005536661.1|  eukaryotic translation initiation factor eIF...  81.6    3e-14   
gb|EJT99885.1|  translation initiation factor eIF-3b                  81.3    4e-14   
gb|EYE93715.1|  eukaryotic translation initiation factor 3 subuni...  81.3    4e-14   
ref|XP_009541253.1|  hypothetical protein HETIRDRAFT_244887           81.6    4e-14   
ref|XP_008719337.1|  eukaryotic translation initiation factor 3 s...  80.9    5e-14   
ref|XP_003141817.1|  Eif3s9 protein                                   80.9    5e-14   
gb|KDN39227.1|  hypothetical protein RSAG8_08998                      80.9    6e-14   
gb|EFX65461.1|  hypothetical protein DAPPUDRAFT_303630                80.9    6e-14   
ref|XP_002566119.1|  Pc22g22240                                       80.9    6e-14   
ref|XP_001269939.1|  eukaryotic translation initiation factor 3 s...  80.9    6e-14   
gb|KIM85337.1|  hypothetical protein PILCRDRAFT_66422                 80.5    7e-14   
gb|EMG47628.1|  hypothetical protein G210_1962                        80.5    7e-14   
ref|XP_001944064.2|  PREDICTED: eukaryotic translation initiation...  80.1    8e-14   
gb|KGO77740.1|  Translation initiation factor eIF-3b                  80.1    9e-14   
gb|KGO46832.1|  Translation initiation factor eIF-3b                  80.1    9e-14   
gb|KEQ63237.1|  translation initiation factor eIF-3b                  80.1    9e-14   
ref|XP_002550806.1|  hypothetical protein CTRG_05104                  80.1    1e-13   
ref|XP_007763368.1|  translation initiation factor eIF-3b             80.1    1e-13   
gb|KIW84565.1|  eukaryotic translation initiation factor 3 subunit B  80.1    1e-13   
gb|KIW30636.1|  eukaryotic translation initiation factor 3 subunit B  79.7    1e-13   
gb|KIW72640.1|  hypothetical protein PV04_00820                       79.7    1e-13   
ref|XP_005846168.1|  hypothetical protein CHLNCDRAFT_136163           79.7    1e-13   
gb|KEQ70659.1|  translation initiation factor eIF-3b                  79.7    1e-13   
ref|XP_007392483.1|  hypothetical protein PHACADRAFT_181869           79.7    1e-13   
ref|XP_007129565.1|  PREDICTED: eukaryotic translation initiation...  79.3    2e-13   
gb|EJW84691.1|  eukaryotic translation initiation factor 3 subunit B  79.3    2e-13   
gb|EIE86217.1|  hypothetical protein RO3G_10928                       79.3    2e-13   
gb|KIV78458.1|  hypothetical protein PV11_10176                       79.3    2e-13   
dbj|GAA83553.1|  eukaryotic translation initiation factor 3 subun...  79.0    2e-13   
gb|KIK40009.1|  hypothetical protein CY34DRAFT_24988                  79.0    2e-13   
gb|KIV94558.1|  hypothetical protein PV10_02313                       79.0    2e-13   
gb|KIX00153.1|  eukaryotic translation initiation factor 3 subunit B  78.2    4e-13   
gb|KIW50751.1|  hypothetical protein PV05_09539                       78.2    4e-13   
ref|XP_003038935.1|  hypothetical protein SCHCODRAFT_65071            78.2    4e-13   
ref|XP_007265497.1|  translation initiation factor eIF-3b             78.2    4e-13   
ref|XP_005703598.1|  translation initiation factor eIF-3 subunit 9    78.2    4e-13   
ref|XP_001389047.1|  eukaryotic translation initiation factor 3 s...  78.2    4e-13   
gb|EHA26523.1|  hypothetical protein ASPNIDRAFT_55391                 77.8    5e-13   
ref|XP_008722846.1|  hypothetical protein G647_01223                  78.2    5e-13   
ref|XP_001817900.1|  eukaryotic translation initiation factor 3 s...  77.8    5e-13   
ref|XP_007720700.1|  eukaryotic translation initiation factor 3 s...  77.8    5e-13   
ref|XP_001265448.1|  eukaryotic translation initiation factor 3 s...  77.8    5e-13   
ref|XP_639023.2|  RNA-binding region RNP-1 domain-containing protein  77.4    6e-13   
gb|ELV11016.1|  Eukaryotic translation initiation factor 3 subunit B  76.6    6e-13   
ref|XP_749953.1|  eukaryotic translation initiation factor 3 subu...  77.8    6e-13   
gb|KEY67049.1|  hypothetical protein S7711_04729                      77.0    9e-13   
gb|AAH09986.1|  EIF3B protein                                         77.0    9e-13   
gb|KIW42383.1|  eukaryotic translation initiation factor 3 subunit B  77.0    9e-13   



>ref|XP_011085122.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Sesamum indicum]
Length=715

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ MSME+I ATAARLN+DLS +DL  IRLPP EDFGIVSDD DL++E++LEF+ GFG+
Sbjct  1    MADVMSMEDIHATAARLNVDLSSLDLGPIRLPPAEDFGIVSDDEDLKKEESLEFEEGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+TQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD+SHIFAVNMFDDIEKFMKVP+EWAPPETK YTP E
Sbjct  121  EAELAKEKTNGYKLDRSHIFAVNMFDDIEKFMKVPEEWAPPETKPYTPGE  170



>gb|EYU40305.1| hypothetical protein MIMGU_mgv1a002098mg [Erythranthe guttata]
Length=715

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M+ME I ATA RLNIDLS +D DSI LPP EDFGI SDD DL+ E++LEF+ GFG+
Sbjct  1    MADVMTMEAIHATADRLNIDLSALDFDSIHLPPSEDFGIASDDDDLKGEESLEFEEGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVV KEKFEKLEGVVRKIY QIG+IKEDGLWMPVDPDTQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVAKEKFEKLEGVVRKIYSQIGIIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD+SHIFAVNMFDDIEKFMKVP+EWAPPE K YTP E
Sbjct  121  EAELAKEKTNGYKLDRSHIFAVNMFDDIEKFMKVPEEWAPPEAKPYTPGE  170



>emb|CAN76773.1| hypothetical protein VITISV_017587 [Vitis vinifera]
Length=719

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MAE +SME+IRATA+ L ID+S ID DSIRLPPGEDFGI SDD   EE+      +GFG+
Sbjct  1    MAEVISMEDIRATASTLGIDVSNIDFDSIRLPPGEDFGITSDDDLHEEDPLEYD-SGFGN  59

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVD DTQKTLGYCFIEYNTPQ
Sbjct  60   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDSDTQKTLGYCFIEYNTPQ  119

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELA+EKT+GY+LD++HIFAVNMFDD ++FMKVPDEWAPPETK YTP E
Sbjct  120  EAELAREKTNGYKLDRAHIFAVNMFDDFDRFMKVPDEWAPPETKPYTPGE  169



>ref|XP_002285591.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Vitis vinifera]
 emb|CBI21174.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =   269 bits (688),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MAE +SME+IRATA+ L ID+S ID DSIRLPPGEDFGI SDD   EE+      +GFG+
Sbjct  1    MAEVISMEDIRATASTLGIDVSNIDFDSIRLPPGEDFGITSDDDLHEEDPLEYD-SGFGN  59

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVD DTQKTLGYCFIEYNTPQ
Sbjct  60   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDSDTQKTLGYCFIEYNTPQ  119

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELA+EKT+GY+LD++HIFAVNMFDD ++FMKVPDEWAPPETK YTP E
Sbjct  120  EAELAREKTNGYKLDRAHIFAVNMFDDFDRFMKVPDEWAPPETKPYTPGE  169



>emb|CDP20278.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   268 bits (684),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 1/166 (1%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            MSME+IRA+A+RL ID SE+DLDSIRLPPGEDFGI+SDD DL+EE+ LEF+ GFG++IVV
Sbjct  1    MSMEDIRASASRLGIDFSEVDLDSIRLPPGEDFGIISDDEDLKEEEELEFEAGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPKEKFEKLEGV+RKIY QIGVIK+DGLWMPVD  T KTLGYCFIEYNTPQEAEL
Sbjct  61   DNLPVVPKEKFEKLEGVIRKIYSQIGVIKDDGLWMPVD-HTGKTLGYCFIEYNTPQEAEL  119

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD+SHIFAVNMFDDIEKFMKVPDEWAPPET  YTP E
Sbjct  120  AKEKTNGYKLDRSHIFAVNMFDDIEKFMKVPDEWAPPETIPYTPGE  165



>ref|XP_009595023.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B {ECO:0000255|HAMAP-Rule:MF_03001} [Nicotiana tomentosiformis]
Length=717

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+  SM EI A AAR+ +DLS+IDLDSI LPPGED GI SDD DL EED LEFD GFG+
Sbjct  1    MADVTSMGEITAIAARIGVDLSQIDLDSIHLPPGEDCGIPSDDDDLMEEDPLEFDAGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            ++VVDNLPVVPKEKFEKLEGVVRKIY Q+GVIKEDGLWMPVDP+TQKTLGYCFIEYNTPQ
Sbjct  61   ILVVDNLPVVPKEKFEKLEGVVRKIYSQLGVIKEDGLWMPVDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAEL+KEKTHGY+LD+SHIFAVNMFDDIEKF+KVPDEWAPPE K Y P E
Sbjct  121  EAELSKEKTHGYKLDRSHIFAVNMFDDIEKFLKVPDEWAPPEIKPYVPGE  170



>ref|XP_006483512.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Citrus sinensis]
 gb|KDO67379.1| hypothetical protein CISIN_1g005140mg [Citrus sinensis]
Length=712

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + + M EI ATA RL IDL ++DLDSI+LPPGED GI+SDD D+ E+D  E ++GFG+
Sbjct  1    MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+TQK+LGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIFAVNMFDD +KFMKVPDEWAPPE K YTP E
Sbjct  121  EAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGE  170



>ref|XP_003529057.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Glycine max]
Length=718

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TA RL +DLS +DLD+IRLPPGED GIVSDD  + +E+ LEF++GFG+
Sbjct  1    MADVMVMKEIEDTALRLGVDLSTLDLDAIRLPPGEDCGIVSDDEVVYQEENLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETEKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIFAV+MFDD ++FMKVP+EWAPPETK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYAPGE  170



>ref|XP_007136910.1| hypothetical protein PHAVU_009G0841000g, partial [Phaseolus vulgaris]
 gb|ESW08904.1| hypothetical protein PHAVU_009G0841000g, partial [Phaseolus vulgaris]
Length=567

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TA RL +DLS +DLDS+RLPPGE+ GIVSDD ++ +ED LEF++GFG+
Sbjct  1    MADVMVMKEIEDTALRLGLDLSTLDLDSVRLPPGENCGIVSDDDEVYQEDNLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETDKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIF V+MFDD ++FMKVP+EWAPPETK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFCVSMFDDFDRFMKVPNEWAPPETKPYAPGE  170



>ref|XP_010108292.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
 gb|EXC18772.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
Length=714

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TAA L IDLS+ID DSIRLPPGEDFGI SDD D+  ++ LEFD+GFG+
Sbjct  1    MADVMLMKEIDDTAASLGIDLSQIDFDSIRLPPGEDFGIKSDDEDVYRDENLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QI VIK+DG WMPVDP+T+KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVVRKIYSQISVIKDDGFWMPVDPETKKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD+SHIFAV+MFDD ++FMKVPDEWAPPE K YTP E
Sbjct  121  EAELAKEKTHGYKLDRSHIFAVSMFDDFDRFMKVPDEWAPPEVKPYTPGE  170



>gb|KHN42137.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=718

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  T+ RL +DLS +DLD+IRLPPGED GIVSDD ++ +E+ LEF++GFG+
Sbjct  1    MADVMVMKEIEDTSLRLGVDLSTLDLDAIRLPPGEDCGIVSDDEEVYQEENLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETEKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIFAV+MFDD ++FMKVP+EWAPPETK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYAPGE  170



>sp|P56821.1|EIF3B_TOBAC RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=eIF-3-eta; AltName: Full=eIF3 
p110 [Nicotiana tabacum]
 emb|CAA72721.1| PRT1 protein [Nicotiana tabacum]
Length=719

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+  SM EI A AAR+ +DLS+IDLDSI LPPGED GI SDD DL EED LEFD GFG+
Sbjct  1    MADVTSMGEITAIAARIGVDLSQIDLDSIHLPPGEDCGIPSDDDDLMEEDPLEFDAGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            ++VVDNLPVVPKEKFEKLEGVVRKIY Q+GVIKEDGLWMPVDP+T KTLGYCFIEYNTPQ
Sbjct  61   ILVVDNLPVVPKEKFEKLEGVVRKIYSQLGVIKEDGLWMPVDPETHKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAEL+KEKTHGY+LD+SHIFAVNMFDDIE+F+KVPDEWAPPE K Y P E
Sbjct  121  EAELSKEKTHGYKLDRSHIFAVNMFDDIERFLKVPDEWAPPEIKPYVPGE  170



>ref|XP_008388785.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=722

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M+  +I ATAAR+ IDLS++DLDSIRLPPGEDFGI+SDD D+ + D  E D+GFGS
Sbjct  1    MADVMAYNDIEATAARIGIDLSQLDLDSIRLPPGEDFGIISDDEDVYKVDNSELDSGFGS  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLE V+RKIY QIGVIK+DG WMP+DP+T KTLGYCF+E+NTPQ
Sbjct  61   IIVVDNLPVVPLEKFEKLENVIRKIYSQIGVIKDDGFWMPLDPETNKTLGYCFLEFNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKE+THGY+LD+SHIF VNMFDD ++FMKVPD+WAPPE+K YTP E
Sbjct  121  EAELAKERTHGYKLDRSHIFVVNMFDDFDRFMKVPDQWAPPESKPYTPGE  170



>gb|KHN25084.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=718

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TA RL +DLS +DLD+IRLPPGED GIVSDD  + +E+ LEF++GFG+
Sbjct  1    MADVMVMKEIEDTALRLGVDLSTLDLDAIRLPPGEDCGIVSDDEVVYQEENLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETEKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EA+ AKEKTHGY+LD++HIFAV+MFDD ++FMKVP+EWAPPETK Y P E
Sbjct  121  EAKFAKEKTHGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYAPGE  170



>ref|XP_007208057.1| hypothetical protein PRUPE_ppa002067mg [Prunus persica]
 gb|EMJ09256.1| hypothetical protein PRUPE_ppa002067mg [Prunus persica]
Length=722

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + M + +I ATAAR+ IDLS++DLDSIRLPPGEDFGI+SDD D+ +E+  E D+GFG+
Sbjct  1    MGDVMVLNDIEATAARIGIDLSQLDLDSIRLPPGEDFGIISDDEDIYQEENSELDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEK+EKLE V+RKIY QIG+IK+DG WMP+DP+TQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKYEKLENVIRKIYSQIGLIKDDGFWMPLDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD+SHIFAV+MFDD ++FMKVPD+WAPPE+  Y P E
Sbjct  121  EAELAKEKTHGYKLDRSHIFAVSMFDDFDRFMKVPDQWAPPESNPYKPGE  170



>ref|XP_003522102.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Glycine max]
Length=718

 Score =   261 bits (668),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  T+ RL +DLS +DLD+IRLP GED GIVSDD ++ +E+ LEF++GFG+
Sbjct  1    MADVMIMKEIEDTSLRLGVDLSTLDLDAIRLPTGEDCGIVSDDEEVYQEENLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETEKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIFAV+MFDD ++FMKVP+EWAPPETK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYAPGE  170



>ref|XP_008218420.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Prunus mume]
Length=722

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + M + +I ATAAR+ IDLS++DLDSIRLPPGE+FGI+SDD D+ +E+  E D+GFG+
Sbjct  1    MGDVMVLNDIEATAARIGIDLSQLDLDSIRLPPGENFGIISDDEDIYQEENSELDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEK+EKLE V+RKIY QIG+IK+DG WMP+DP+TQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKYEKLENVIRKIYSQIGLIKDDGFWMPLDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD+SHIFAV+MFDD ++FMKVPD+WAPPE+  Y P E
Sbjct  121  EAELAKEKTHGYKLDRSHIFAVSMFDDFDRFMKVPDQWAPPESNPYKPGE  170



>ref|XP_006354613.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Solanum tuberosum]
Length=717

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M+E +SMEEIRA + RL +DL++IDLDSI LPPG+D GI SDD DL EEDALE D GFG+
Sbjct  1    MSEVVSMEEIRAISDRLGVDLTQIDLDSIHLPPGDDLGIPSDDEDLLEEDALEEDQGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            ++VVDNLPVVPKEK+EKLEGVVRKIY Q+GVIKE GL+MP+DP+TQKTLGYCFIEYNTPQ
Sbjct  61   ILVVDNLPVVPKEKYEKLEGVVRKIYSQLGVIKEGGLYMPIDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAEL+KEKTHGY+LD+SHIFAVNMF+DIEKF+KVPDEWAPPE K Y P E
Sbjct  121  EAELSKEKTHGYKLDRSHIFAVNMFEDIEKFLKVPDEWAPPEIKPYVPGE  170



>gb|KJB32894.1| hypothetical protein B456_005G267000 [Gossypium raimondii]
Length=716

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            AE M M EI ATAA++ ID++ ID  SI+LPPGE+ GI+SDD D+  +D LEFD+GFG+V
Sbjct  3    AEVMLMNEIEATAAQMGIDMN-IDFSSIQLPPGENCGIISDDDDVYHDDQLEFDSGFGNV  61

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  62   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  121

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKTHGY+LD++HIFAVNMFDD +K+MKVPDEWAPPE K YTP E
Sbjct  122  AELAKEKTHGYKLDRAHIFAVNMFDDFDKYMKVPDEWAPPEIKPYTPGE  170



>gb|KHF99557.1| Eukaryotic translation initiation factor 3 subunit B [Gossypium 
arboreum]
Length=716

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            AE M M EI ATAA++ ID++ ID  SI+LPPGE+ GI+SDD D+  +D LEFD+GFG+V
Sbjct  3    AEVMLMNEIEATAAQMGIDMN-IDFSSIQLPPGENCGIISDDDDVYHDDQLEFDSGFGNV  61

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  62   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  121

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKTHGY+LD++HIFAVNMFDD +K+MKVPDEWAPPE K YTP E
Sbjct  122  AELAKEKTHGYKLDRAHIFAVNMFDDFDKYMKVPDEWAPPEIKPYTPGE  170



>ref|XP_007136908.1| hypothetical protein PHAVU_009G084000g [Phaseolus vulgaris]
 gb|ESW08902.1| hypothetical protein PHAVU_009G084000g [Phaseolus vulgaris]
Length=718

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TA RL +DLS +DLDSIRLPPGE+ GIVSDD ++ +ED LEF++GFG+
Sbjct  1    MADVMVMKEIEDTALRLGLDLSTLDLDSIRLPPGENCGIVSDDDEVYQEDNLEFESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVD+LPVVPKEKFEKLEGVVRKIY QIGVIKEDGLWMPVDP+T KTLGYCFIEYNTPQ
Sbjct  61   IIVVDSLPVVPKEKFEKLEGVVRKIYSQIGVIKEDGLWMPVDPETDKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIF V+MFDD ++FMKVP+EWA PETK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFCVSMFDDFDRFMKVPNEWALPETKPYAPGE  170



>ref|XP_009346830.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=722

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M+  +I ATAAR+ IDLS++DLDSIRLP GEDFGI+SDD D+ + D  E D GFG+
Sbjct  1    MADVMAYNDIEATAARIGIDLSQLDLDSIRLPSGEDFGIISDDEDIYKVDNSELDAGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLE V+RKIY QIGVIK+DG WMP+DP+T KTLGYCF+E+NTPQ
Sbjct  61   IIVVDNLPVVPLEKFEKLENVIRKIYSQIGVIKDDGFWMPLDPETNKTLGYCFLEFNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKE+THGY+LD+SHIF VNMF+D ++FMKVPD+WAPPE+K YTP E
Sbjct  121  EAELAKERTHGYKLDRSHIFVVNMFEDFDRFMKVPDQWAPPESKPYTPGE  170



>gb|KGN44408.1| hypothetical protein Csa_7G281370 [Cucumis sativus]
Length=718

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ + M+EI  TA RL IDLS++D D+IRLPPGEDFGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVVLMKEIEETAGRLGIDLSQVDFDAIRLPPGEDFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVD  TQKTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDRTTQKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF+D ++FMKVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEDFDRFMKVPDEWAPPEVNPYTPGE  170



>ref|XP_004150392.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis sativus]
Length=718

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ + M+EI  TA RL IDLS++D D+IRLPPGEDFGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVVLMKEIEETAGRLGIDLSQVDFDAIRLPPGEDFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVD  TQKTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDRTTQKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF+D ++FMKVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEDFDRFMKVPDEWAPPEVNPYTPGE  170



>ref|XP_008461500.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis melo]
Length=718

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ + M+EI  TA RL IDLS++D D+IRLPPGEDFGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVVLMKEIEETAGRLGIDLSQVDFDAIRLPPGEDFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVD  TQKTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDHTTQKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF+D ++FMKVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEDFDRFMKVPDEWAPPEVSPYTPGE  170



>gb|KDP33486.1| hypothetical protein JCGZ_07057 [Jatropha curcas]
Length=720

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MAE M M E+ A A    IDLS++DL+SI+LP  E FGI+SDD D+ EE+ L+F+TGFG+
Sbjct  1    MAEVMMMHELEARAVAAGIDLSQLDLNSIQLPRDESFGIISDDEDVYEEEQLDFETGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+TQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIFAVNMFDD +KFM+VPDEWAPPE + Y P E
Sbjct  121  EAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMRVPDEWAPPEIRPYVPGE  170



>ref|XP_007041117.1| Translation initiation factor 3B1 isoform 2 [Theobroma cacao]
 gb|EOX96948.1| Translation initiation factor 3B1 isoform 2 [Theobroma cacao]
Length=616

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            +E M M EI +TAARL IDL   D  S++LPPGE  GIVSDD D+  +D LEFD+GFG++
Sbjct  3    SEVMLMNEIESTAARLGIDLDNFDYSSVKLPPGEYCGIVSDDEDVYHDDQLEFDSGFGNI  62

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  63   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  122

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKT+GY+LD++HIFAV+MFDD +K+M+VPDEWAPPE K YTP E
Sbjct  123  AELAKEKTNGYKLDRAHIFAVSMFDDFDKYMRVPDEWAPPEIKPYTPGE  171



>ref|XP_004160247.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B-like [Cucumis sativus]
Length=718

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ + M+EI  TA RL IDLS++D D+IRLPPGEDFGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVVLMKEIEETAGRLGIDLSQVDFDAIRLPPGEDFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKF+KLEGVVRKI+GQIGVIK+DGLWMPVD  TQKTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFDKLEGVVRKIFGQIGVIKDDGLWMPVDRTTQKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF+D ++FMKVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEDFDRFMKVPDEWAPPEVNPYTPGE  170



>gb|EPS67275.1| hypothetical protein M569_07499 [Genlisea aurea]
Length=712

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ +SME+IRATA R+ +DLS IDL SIRLPPGEDFGIVSDD DL+ +D+LEF+   G+
Sbjct  1    MADVISMEDIRATAERIQVDLSSIDLSSIRLPPGEDFGIVSDDDDLKNDDSLEFEESSGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP+EKF+KLEGVVRKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIE+++PQ
Sbjct  61   IIVVDNLPVVPREKFDKLEGVVRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEFSSPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKTHGY+LD++HIFAVN+F+D EK+M+VP+EWAPP TK Y P E
Sbjct  121  EAELAKEKTHGYKLDRAHIFAVNIFNDFEKYMEVPEEWAPPVTKPYNPGE  170



>gb|AIU34463.1| putative eukaryotic translation initiation factor 3 subunit B, 
partial [Taraxacum brevicorniculatum]
Length=708

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ MSME+I A AARLNIDLS +D +S+ +PPGEDFGI SDD DL EED+LEFD GFG+
Sbjct  1    MADVMSMEDINAQAARLNIDLSSVDWNSVWVPPGEDFGIKSDDEDLNEEDSLEFDAGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            VIVVDNLPVVP+EKFEKLEGVVRKIY QIGVIKE+GLWMPV+ +T KT GYCFIEYNTPQ
Sbjct  61   VIVVDNLPVVPREKFEKLEGVVRKIYSQIGVIKENGLWMPVEEETGKTRGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIF+VN+FD+IEKFM+VPD+WAPPE+K YT  E
Sbjct  121  EAELAKEKTNGYKLDRAHIFSVNIFDEIEKFMRVPDQWAPPESKPYTSGE  170



>ref|XP_009337980.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=722

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M+  +I ATAAR+ IDLS++DLDSIRLP GEDFGI+SDD D+   D  E D GF +
Sbjct  1    MADIMTYNDIEATAARIGIDLSQLDLDSIRLPAGEDFGIISDDEDIYNVDNSELDAGFSN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLE V+RKIY QIGVIK+DG WMP+DP+T KTLGYCF+E+NTPQ
Sbjct  61   IIVVDNLPVVPLEKFEKLENVIRKIYSQIGVIKDDGFWMPLDPETNKTLGYCFLEFNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKE+THGY+LD+SHIF VNMF+D ++FM VPD+WAPPE+K YTP E
Sbjct  121  EAELAKERTHGYKLDRSHIFVVNMFNDFDRFMSVPDQWAPPESKPYTPGE  170



>ref|XP_004229693.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Solanum lycopersicum]
Length=717

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M+E +SM+EIRA + RL +DL++I+LDSI LPPG+D GI SDD DL +EDALE D GFG+
Sbjct  1    MSEVVSMDEIRAISERLGVDLAKINLDSIHLPPGDDMGIPSDDEDLLKEDALEEDQGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            ++VVDNLPVVPKEK+EKLEGVVRKIY Q+GVIKE GL MPVDP TQKTLGYCFIEYNTPQ
Sbjct  61   ILVVDNLPVVPKEKYEKLEGVVRKIYSQLGVIKEGGLNMPVDPVTQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAEL+KEKTHGY+LD+SHIFAVNMF+DIEKF+KVPDEWAPPE K Y P E
Sbjct  121  EAELSKEKTHGYKLDRSHIFAVNMFEDIEKFLKVPDEWAPPEIKPYVPVE  170



>ref|XP_009784422.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B-like [Nicotiana sylvestris]
Length=724

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+  SM EI A AAR+ +DLS+IDLDSI LPPGED GI SDD DL EED LEFD GFG+
Sbjct  1    MADVTSMGEITAIAARIGVDLSQIDLDSIHLPPGEDCGIPSDDDDLMEEDPLEFDAGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            ++VVDNLPVVPKEK +KLEGVVRKIY Q+GVIKEDGL MPVDP+TQKTLGYCFIEYNTPQ
Sbjct  61   ILVVDNLPVVPKEKLKKLEGVVRKIYSQLGVIKEDGLXMPVDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYT  636
            +AEL+KEKTHGY+LD+SHIFAVNMFDDIEKF+KVPDEWAPPE K Y 
Sbjct  121  KAELSKEKTHGYKLDRSHIFAVNMFDDIEKFLKVPDEWAPPEIKPYV  167



>gb|KCW52938.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
Length=581

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+   I   AA + ID+S+IDLDS++LPPGEDFGI+SDD DL +ED LE DTG G++I+V
Sbjct  1    MADALIEERAALMGIDMSQIDLDSVQLPPGEDFGIISDDDDLYQEDTLELDTGLGNIIIV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVP+EKF+KLEGVVRKIY QIGVIK+DGLWMPVDPDTQKTLGYCFIEYNT QEAEL
Sbjct  61   DNLPVVPREKFDKLEGVVRKIYSQIGVIKDDGLWMPVDPDTQKTLGYCFIEYNTAQEAEL  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD+SHIFAV+MF+D ++FM+VPDEWAPPETK YTP E
Sbjct  121  AKEKTNGYKLDRSHIFAVSMFEDFDRFMRVPDEWAPPETKPYTPGE  166



>ref|XP_007041116.1| Translation initiation factor 3B1 isoform 1 [Theobroma cacao]
 gb|EOX96947.1| Translation initiation factor 3B1 isoform 1 [Theobroma cacao]
Length=718

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            +E M M EI +TAARL IDL   D  S++LPPGE  GIVSDD D+  +D LEFD+GFG++
Sbjct  3    SEVMLMNEIESTAARLGIDLDNFDYSSVKLPPGEYCGIVSDDEDVYHDDQLEFDSGFGNI  62

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  63   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  122

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKT+GY+LD++HIFAV+MFDD +K+M+VPDEWAPPE K YTP E
Sbjct  123  AELAKEKTNGYKLDRAHIFAVSMFDDFDKYMRVPDEWAPPEIKPYTPGE  171



>gb|KJB47937.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=620

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            AE M M EI A AA + IDL+ ID +SI+LP GED GIVSDD D+  +D LEFD+GFG+V
Sbjct  3    AEVMLMNEIEAKAASMAIDLN-IDFNSIQLPRGEDCGIVSDDEDVYHDDQLEFDSGFGNV  61

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  62   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  121

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKT+GY+LD++HIFAVNMFDD +K+M+VPDEWAPPE K YTP E
Sbjct  122  AELAKEKTNGYKLDRAHIFAVNMFDDFDKYMRVPDEWAPPEIKPYTPGE  170



>ref|XP_008345739.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=722

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M+  +I ATAAR+ IDLS++DLDSIRLP GEDFGI+SDD D+   D  E D GF +
Sbjct  1    MADVMTYNDIEATAARIGIDLSQLDLDSIRLPAGEDFGIISDDEDIYNVDNSELDAGFSN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLE V+RKIY QIGVIK+DG WMP+DP+T KTLGYCF+E+NTPQ
Sbjct  61   IIVVDNLPVVPLEKFEKLENVIRKIYSQIGVIKDDGFWMPLDPETNKTLGYCFLEFNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKE+THGY+LD+SHIF VN+F+D ++FM VPD+WAPPE+K YTP E
Sbjct  121  EAELAKERTHGYKLDRSHIFVVNIFNDFDRFMSVPDQWAPPESKPYTPGE  170



>gb|KHG06633.1| Eukaryotic translation initiation factor 3 subunit B -like protein 
[Gossypium arboreum]
Length=715

 Score =   251 bits (642),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            AE M M EI A AA + IDL+ ID +SI+LP GED GIVSDD D+  +D LEFD+GFG+V
Sbjct  3    AEVMLMNEIEAKAASMGIDLN-IDFNSIQLPRGEDCGIVSDDEDVYHDDQLEFDSGFGNV  61

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  62   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  121

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKT+GY+LD++HIFAVNMFDD +K+M+VPDEWAPPE K YTP E
Sbjct  122  AELAKEKTNGYKLDRAHIFAVNMFDDFDKYMRVPDEWAPPEIKPYTPGE  170



>gb|KGN44089.1| hypothetical protein Csa_7G181640 [Cucumis sativus]
Length=537

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  +A RL IDLS++D D+IRLPPGE+FGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVMLMKEIEDSAGRLGIDLSQVDFDAIRLPPGENFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVDP T KTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDPTTTKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF++  + +KVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEEFNRLVKVPDEWAPPEINPYTPGE  170



>gb|KCW52937.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
Length=633

 Score =   249 bits (637),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+   I   AA + ID+S+IDLDS++LPPGEDFGI+SDD DL +ED LE DTG G++I+V
Sbjct  1    MADALIEERAALMGIDMSQIDLDSVQLPPGEDFGIISDDDDLYQEDTLELDTGLGNIIIV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVP+EKF+KLEGVVRKIY QIGVIK+DGLWMPVDPDTQKTLGYCFIEYNT QEAEL
Sbjct  61   DNLPVVPREKFDKLEGVVRKIYSQIGVIKDDGLWMPVDPDTQKTLGYCFIEYNTAQEAEL  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD+SHIFAV+MF+D ++FM+VPDEWAPPETK YTP E
Sbjct  121  AKEKTNGYKLDRSHIFAVSMFEDFDRFMRVPDEWAPPETKPYTPGE  166



>gb|KJB47936.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=715

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +1

Query  139  AETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            AE M M EI A AA + IDL+ ID +SI+LP GED GIVSDD D+  +D LEFD+GFG+V
Sbjct  3    AEVMLMNEIEAKAASMAIDLN-IDFNSIQLPRGEDCGIVSDDEDVYHDDQLEFDSGFGNV  61

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLPVVP+EKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+T+KTLGYCFIEYNTPQE
Sbjct  62   IVVDNLPVVPREKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETKKTLGYCFIEYNTPQE  121

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AELAKEKT+GY+LD++HIFAVNMFDD +K+M+VPDEWAPPE K YTP E
Sbjct  122  AELAKEKTNGYKLDRAHIFAVNMFDDFDKYMRVPDEWAPPEIKPYTPGE  170



>ref|XP_004501412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cicer arietinum]
Length=719

 Score =   251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI   A+ L IDLS IDLDSI  PPGED GI SDD D+ +E+ LEFD+GFG+
Sbjct  1    MADVMVMKEIEDKASLLGIDLSTIDLDSIHFPPGEDCGIPSDDEDIYQEENLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGVVRKIY QIGVIK+DGLWMPVDP T+K+LGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVVRKIYSQIGVIKDDGLWMPVDPVTEKSLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELA+EKTHGY+LD+SHIFA++MFDD ++FMKVPDEWAPP  K Y P E
Sbjct  121  EAELAREKTHGYKLDRSHIFALSMFDDFDRFMKVPDEWAPPPNKEYAPGE  170



>ref|XP_010933521.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
Length=717

 Score =   251 bits (640),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 147/171 (86%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MAE +SM +I ATA R  IDLS +DLDSI+LPPGEDFGI SDD +   ++  LEF+ GFG
Sbjct  1    MAEVVSMADIEATAQRRGIDLSSVDLDSIQLPPGEDFGIKSDDDEDLHQEDPLEFEAGFG  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++I+VDNLPVVP EKFEKLEGV+RKIY QIGVI+E GLWMPV+P+TQKTLGYCFIEYNTP
Sbjct  61   NIIMVDNLPVVPPEKFEKLEGVIRKIYSQIGVIREGGLWMPVNPETQKTLGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+FDD EK+MK+PDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNLFDDFEKYMKIPDEWTPAEIKPYTPGE  171



>ref|XP_010033332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Eucalyptus grandis]
 gb|KCW52935.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
 gb|KCW52936.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
Length=714

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+   I   AA + ID+S+IDLDS++LPPGEDFGI+SDD DL +ED LE DTG G++I+V
Sbjct  1    MADALIEERAALMGIDMSQIDLDSVQLPPGEDFGIISDDDDLYQEDTLELDTGLGNIIIV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVP+EKF+KLEGVVRKIY QIGVIK+DGLWMPVDPDTQKTLGYCFIEYNT QEAEL
Sbjct  61   DNLPVVPREKFDKLEGVVRKIYSQIGVIKDDGLWMPVDPDTQKTLGYCFIEYNTAQEAEL  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD+SHIFAV+MF+D ++FM+VPDEWAPPETK YTP E
Sbjct  121  AKEKTNGYKLDRSHIFAVSMFEDFDRFMRVPDEWAPPETKPYTPGE  166



>ref|XP_002515389.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF46838.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=720

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M +I   AA   IDLS++DL SI L PGE+FGI+SDD D+ + + L+F+ GF +
Sbjct  1    MADVMMMNDIDERAAAAGIDLSQLDLSSIHLSPGENFGIISDDEDVHQREQLDFEAGFNN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+TQKTLGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKTLGYCFIEYNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIFAVNMF+D ++FM+VPDEWAPPE + Y P E
Sbjct  121  EAELAKEKTNGYKLDRAHIFAVNMFEDFDRFMRVPDEWAPPEFRPYVPGE  170



>ref|XP_008447809.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Cucumis melo]
 ref|XP_008447810.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Cucumis melo]
Length=718

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  TA RL IDLS +D D+IRLPPGE+FGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVMLMKEIEDTAGRLGIDLSLVDFDAIRLPPGENFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLP+VP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVDP T+KTLGYC+IEY TPQ
Sbjct  61   IIVVDNLPIVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDPTTKKTLGYCYIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF+D ++ +KVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEDFDRLLKVPDEWAPPEINPYTPGE  170



>ref|XP_004139759.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis sativus]
Length=718

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI  +A RL IDLS++D D+IRLPPGE+FGI+SDD ++ +E++LEFD+GFG+
Sbjct  1    MADVMLMKEIEDSAGRLGIDLSQVDFDAIRLPPGENFGIISDDEEVLQEESLEFDSGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVP EKFEKLEGVVRKI+GQIGVIK+DGLWMPVDP T KTLGYCFIEY TPQ
Sbjct  61   IIVVDNLPVVPPEKFEKLEGVVRKIFGQIGVIKDDGLWMPVDPTTTKTLGYCFIEYGTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD++HIF VNMF++  + +KVPDEWAPPE   YTP E
Sbjct  121  EAELAKEKTDGYKLDRAHIFTVNMFEEFNRLVKVPDEWAPPEINPYTPGE  170



>ref|XP_008786288.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Phoenix dactylifera]
Length=718

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MAE +SM +I ATA R  IDLS +DLDSIRLPPGEDFGI SDD +   ++  LEF+ GFG
Sbjct  1    MAEVVSMADIEATAQRHGIDLSSVDLDSIRLPPGEDFGIKSDDDEDLHQEDPLEFEAGFG  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EKFEKLEGV+RKIY QIGVI+E GLWMPV+P+T+KTLGYCFIEY+TP
Sbjct  61   NIIVVDNLPVVPPEKFEKLEGVIRKIYSQIGVIREGGLWMPVNPETRKTLGYCFIEYSTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+FDD EK+M +PDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNLFDDFEKYMNIPDEWTPAEIKPYTPGE  171



>ref|XP_006371769.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
 gb|ERP49566.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
Length=718

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            +S+ E+ A A    IDLS+IDLDSI+LPPG+DFGI+SDD D+ +E+ ++FD G G+ IVV
Sbjct  4    ISLNELEARADAAGIDLSQIDLDSIQLPPGDDFGIISDDEDVYQEEQMDFDYGLGNTIVV  63

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPKEKF+KLEGVVRKIY QIGVIKEDGLWMPVDPDT KTLGYCFIEYNTPQEAEL
Sbjct  64   DNLPVVPKEKFDKLEGVVRKIYSQIGVIKEDGLWMPVDPDTHKTLGYCFIEYNTPQEAEL  123

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD++HIFAVNM +D  +FMKVPDEWAPPE + Y P E
Sbjct  124  AKEKTNGYKLDRAHIFAVNMIEDFNRFMKVPDEWAPPEIRPYVPGE  169



>ref|XP_011036732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Populus euphratica]
Length=718

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            +S+ E+ A A    IDLS+IDLDSI+LPPG+DFGI+SDD D+ +E+ ++FD G G+ IVV
Sbjct  4    ISLNELEARADAAGIDLSQIDLDSIQLPPGDDFGIISDDEDVYQEEQMDFDYGLGNTIVV  63

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPKEKF+KLEGVVRKIY QIGVIKEDGLWMPVDPDT KTLGYCFIEYNTPQEAEL
Sbjct  64   DNLPVVPKEKFDKLEGVVRKIYSQIGVIKEDGLWMPVDPDTHKTLGYCFIEYNTPQEAEL  123

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD++HIFAVNM +D  +FMKVPDEWAPPE + Y P E
Sbjct  124  AKEKTNGYKLDRAHIFAVNMIEDFNRFMKVPDEWAPPEIRPYVPGE  169



>ref|XP_010525888.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tarenaya hassleriana]
Length=715

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  ++ A AARL +DLS++DLDS+RLPPGEDFGIVSDD D+ ++D LEFDTGFG++IVV
Sbjct  1    MAAVDVEAWAARLGVDLSQVDLDSVRLPPGEDFGIVSDDEDVYKDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVPKEKFEKLEGVVRKIY Q+GVIKEDG+WMP+DPDT+ TLGYCFIE+NTP+EA+ 
Sbjct  61   DHLPVVPKEKFEKLEGVVRKIYNQLGVIKEDGIWMPIDPDTKMTLGYCFIEFNTPEEAKN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AK+KTHGY+LD+SHIFAVNMFDDI++ MKV ++W+ PETK Y P E
Sbjct  121  AKDKTHGYKLDRSHIFAVNMFDDIDRLMKVEEKWSAPETKPYMPGE  166



>ref|XP_009381931.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Musa acuminata subsp. malaccensis]
Length=721

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MAE + +E+I A+A RL IDLS +DLDSI+LP GEDFGI SDD D   ++  LEF+ GFG
Sbjct  2    MAEVVLIEDIEASATRLGIDLSSVDLDSIQLPRGEDFGIKSDDDDDLYQEDPLEFEAGFG  61

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EKFEKLEGV+RKIY QIG I+E G+WMPV+PDTQKTLGYCFIEYNTP
Sbjct  62   NIIVVDNLPVVPPEKFEKLEGVIRKIYSQIGTIREGGIWMPVNPDTQKTLGYCFIEYNTP  121

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+FDD EK+MKVPDEW   E K YTP E
Sbjct  122  QEAELAREKTNGYKLDKSHIFAVNLFDDFEKYMKVPDEWKAAEIKPYTPGE  172



>ref|XP_004302144.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Fragaria vesca subsp. vesca]
Length=713

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +1

Query  154  MEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDN  333
            M EI ATAARL IDL   DLDSIRLPPGE+ GI+SD+ D+  +   E ++GFG++IVVDN
Sbjct  6    MHEIDATAARLGIDLPP-DLDSIRLPPGENCGILSDNDDVGNDVDSEMESGFGNIIVVDN  64

Query  334  LPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAK  513
            LPVVP EKFEKLE V+RKIY Q+GVI+EDG +MP+DP+TQKT+GYCFIE+NTPQEAELAK
Sbjct  65   LPVVPIEKFEKLENVIRKIYSQLGVIREDGFFMPLDPETQKTMGYCFIEFNTPQEAELAK  124

Query  514  EKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EKTHGY+LD+SHIFAVNMFDD ++FMKVPD+WAPPE K YTP E
Sbjct  125  EKTHGYKLDRSHIFAVNMFDDFDRFMKVPDQWAPPEIKPYTPGE  168



>ref|XP_008784685.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Phoenix dactylifera]
Length=720

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MAE +SM +I ATA R  IDLS +DLDSIRLPPGEDFGI SDD +   ++  LEF+ GFG
Sbjct  1    MAEVVSMADIEATAQRHGIDLSSVDLDSIRLPPGEDFGIKSDDDEDPHQEDPLEFEAGFG  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            + IVVDNLPVVP EKFEKLEGVVRKIY QIGVI+E GLWMP++P+TQKTLGYCFIEYNTP
Sbjct  61   NTIVVDNLPVVPPEKFEKLEGVVRKIYSQIGVIREGGLWMPMNPETQKTLGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIF VN+ DD EK+MKVP+EW P E   YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFVVNLLDDFEKYMKVPEEWTPAEINPYTPGE  171



>ref|XP_010245655.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nelumbo nucifera]
Length=719

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA  +SM +I A A  L IDLS++DLD+IRLPPGEDFG+ SDD D+  ED LE ++G G+
Sbjct  1    MATMVSMADIEAKAMGLGIDLSKVDLDAIRLPPGEDFGVKSDDEDVLREDNLESESGLGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +I+VDNLPVV  EKFEKLEGV+RKIY QI V+KED +WMPV+P+TQKTLGYCFIE NTPQ
Sbjct  61   IIIVDNLPVVAPEKFEKLEGVIRKIYSQICVLKEDAIWMPVNPETQKTLGYCFIELNTPQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GYRLDKSHIF++N+FDD E+F+KVPDEWAPPETK  TP E
Sbjct  121  EAELAKEKTQGYRLDKSHIFSINLFDDFERFIKVPDEWAPPETKPCTPGE  170



>ref|XP_010276277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nelumbo nucifera]
Length=721

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA  +SM +I A A  L IDLS++DLD IR PPGEDFGI SDD D+ +ED LEF++G G+
Sbjct  1    MATMVSMADIEAKAMGLGIDLSKVDLDVIRFPPGEDFGIKSDDEDILQEDNLEFESGLGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVV  EKFEKLEGV+RKIY QI V+KED +WMP++P+TQKTLGYCFIE+NT Q
Sbjct  61   IIVVDNLPVVAPEKFEKLEGVIRKIYSQICVLKEDAIWMPLNPETQKTLGYCFIEFNTLQ  120

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LDKSHIF+VN+FDD +KFMKVPDEWAPPETK YTP E
Sbjct  121  EAELAKEKTQGYKLDKSHIFSVNLFDDFDKFMKVPDEWAPPETKPYTPGE  170



>gb|KHN47647.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=201

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +1

Query  127  SPTMAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTG  306
            +  M + M M+EI   A RL +DLS ++LD IR+ PGED  IV     + +E+ LEF++ 
Sbjct  34   ATIMVDVMVMKEIEDMALRLGVDLSTLNLDVIRVAPGEDCSIV-----VYQEENLEFESR  88

Query  307  FGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYN  486
            FG++IVVDNL VVP+EKFEKLEGVV+KIY QIGVIKEDGLWMPVDP+T+KTL Y FIEYN
Sbjct  89   FGNIIVVDNLLVVPREKFEKLEGVVQKIYSQIGVIKEDGLWMPVDPETEKTLCYYFIEYN  148

Query  487  TPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTP  639
            TPQEAELAKEKTHGY+LD++HIF V+MFDD ++FMKVP+EWAPPETK Y P
Sbjct  149  TPQEAELAKEKTHGYKLDRAHIFVVSMFDDFDRFMKVPNEWAPPETKPYAP  199



>emb|CAD29833.1| translation initiation factor [Viscum album subsp. album]
Length=237

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  157  EEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNL  336
            E+I+  ++RL ID S IDL S+RLPPGE+ GIVSDD DL +ED LE+D GFG+ IVVDNL
Sbjct  62   EKIKEISSRLQIDPSNIDLSSVRLPPGENCGIVSDDEDLHQEDELEYDPGFGNAIVVDNL  121

Query  337  PVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKE  516
            PVVP EKFEKLEGV+RKI+ QIGVIK++GL+MPVD DT KTLGYCFIEYNT QEAELAKE
Sbjct  122  PVVPLEKFEKLEGVIRKIFSQIGVIKDEGLFMPVDSDTHKTLGYCFIEYNTAQEAELAKE  181

Query  517  KTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            KTH Y+LD+SHIF+VNMFDD EKF +VPD+WAP ETK Y P E
Sbjct  182  KTHSYKLDRSHIFSVNMFDDFEKFNEVPDQWAPSETKPYVPGE  224



>ref|XP_002308719.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
 gb|EEE92242.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
Length=719

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            +S+ E+   AA   IDLS ID+DSI+LPPG+DFG++SDD D+ +E+ ++FD G G+ IVV
Sbjct  4    ISLTELEERAAAAGIDLSLIDIDSIKLPPGDDFGVISDDEDVYQEEQMDFDYGLGNTIVV  63

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPKEKF+KLEGVV KIY QIGVIKEDGLWMPVDP TQKTLGYCFIEYNTPQEAEL
Sbjct  64   DNLPVVPKEKFDKLEGVVNKIYSQIGVIKEDGLWMPVDPGTQKTLGYCFIEYNTPQEAEL  123

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD++HIFAVNM +D  +FMKVPDEWAPPE + Y P E
Sbjct  124  AKEKTNGYKLDRAHIFAVNMIEDFNRFMKVPDEWAPPEIRPYVPGE  169



>gb|KDO67378.1| hypothetical protein CISIN_1g005140mg [Citrus sinensis]
Length=702

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 10/170 (6%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + + M EI ATA RL IDL ++DLDSI+LPPGED GI+SDD D+ E+D  E ++GFG+
Sbjct  1    MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGV          IKEDGLWMPVDP+TQK+LGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGV----------IKEDGLWMPVDPETQKSLGYCFIEYNTPQ  110

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIFAVNMFDD +KFMKVPDEWAPPE K YTP E
Sbjct  111  EAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGE  160



>ref|XP_011031407.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Populus euphratica]
Length=719

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            +S+ E+ A AA   +DLS ID+DSI+LPPG+DFG++SDD D+ +E+ ++FD G G+ IVV
Sbjct  4    ISLTELEARAAAAGMDLSLIDIDSIKLPPGDDFGVISDDEDVYQEEQMDFDYGLGNTIVV  63

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPKEKF+KLEGVVRKIY QIGVIKEDGLWMPVDP TQKTLGYCFIEYNT QEAEL
Sbjct  64   DNLPVVPKEKFDKLEGVVRKIYSQIGVIKEDGLWMPVDPGTQKTLGYCFIEYNTLQEAEL  123

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT+GY+LD++HIFAVNM +D  +FMKVPDEWAPPE + Y P E
Sbjct  124  AKEKTNGYKLDRAHIFAVNMIEDFNRFMKVPDEWAPPEIRPYVPGE  169



>ref|XP_010675245.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Beta vulgaris subsp. vulgaris]
Length=712

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalef-dTGFGSVIVVDNL  336
            +I A AARL +DL+++DLDSI LPPGEDFG+ SDD    +E+     D G G++IVVD+L
Sbjct  4    DIDAMAARLGVDLTQVDLDSIPLPPGEDFGVTSDDEAALQEEENSDFDQGHGNIIVVDHL  63

Query  337  PVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKE  516
            P VPKEKFEKLE V+RKIY QIGVIK+DG WMPVD  T+K+LGYCFIEYNTPQEAELAKE
Sbjct  64   PQVPKEKFEKLESVIRKIYSQIGVIKDDGFWMPVDSATEKSLGYCFIEYNTPQEAELAKE  123

Query  517  KTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            KT+GY+LDKSHIF+VN+FD+IEKFMKVPDEWAPPETK YTP E
Sbjct  124  KTNGYKLDKSHIFSVNLFDEIEKFMKVPDEWAPPETKPYTPTE  166



>ref|XP_010495540.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=371

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L ID S+++LDSI+LPPG+DFGI SDD  +  +D  EFDTGFG++IVV
Sbjct  1    MEVLDIDARAAKLGIDWSQVNLDSIQLPPGQDFGIESDDEAVYHDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVPKEKFEKLEGVV+KIY QIGVIKE+GLWMPVDP T+ TLGYCFIE+N+PQEA+ 
Sbjct  61   DHLPVVPKEKFEKLEGVVKKIYNQIGVIKENGLWMPVDPVTKMTLGYCFIEFNSPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  121  AKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGE  166



>ref|XP_010919846.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
 ref|XP_010919847.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
Length=720

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalef-dTGFG  312
            MAE +SM +I ATA R  IDLS +DLDSI+LPPGEDFGI SDD +   E+     + GFG
Sbjct  1    MAEVVSMADIEATAQRHGIDLSSVDLDSIQLPPGEDFGIKSDDDEDIHEEDSLEFEAGFG  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EKFEKLEGV+RKIY Q GVI+E GL MP++PDTQKTLGYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKFEKLEGVIRKIYSQTGVIREGGLSMPMNPDTQKTLGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+FDD EK+MKVP+EW   E   YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNLFDDFEKYMKVPEEWTHAEINPYTPGE  171



>gb|AIZ68196.1| eukaryotic translation initiation factor 3 subunit B-like protein 
[Ornithogalum saundersiae]
Length=718

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MA T+SM++I   A RL  DLS ID+D+I LPPG+DFGI SDD +   ++  LEF+ GF 
Sbjct  1    MAATISMQDIEVMAQRLGKDLSSIDVDAITLPPGDDFGIKSDDDEDLYQEDPLEFEGGFR  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +VIVVDNLPVVP EKFEKLE VVRKIY QIGVIK+ GLWMPV+P+TQK+LGYCFIEYNTP
Sbjct  61   NVIVVDNLPVVPPEKFEKLENVVRKIYSQIGVIKDGGLWMPVNPETQKSLGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKTHGY+LDKSHIFAVN+FDD +K+M VPDEW P E K YTP E
Sbjct  121  QEAELAREKTHGYKLDKSHIFAVNLFDDFDKYMNVPDEWTPAEIKPYTPGE  171



>gb|AES73491.2| eukaryotic translation initiation factor 3 subunit B [Medicago 
truncatula]
Length=716

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI   A  L IDLS IDLDSI LPPG++ GI SDD   +EE+     +GFG+
Sbjct  1    MADVMLMKEIEDKALLLGIDLSSIDLDSIHLPPGDNCGIPSDDDVDQEENLEFD-SGFGN  59

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKL  VVRKIY QIG IKEDGLWMPVDP T+K+LGYCFIEYNTPQ
Sbjct  60   IIVVDNLPVVPKEKFEKLVTVVRKIYSQIGAIKEDGLWMPVDPATEKSLGYCFIEYNTPQ  119

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT GY+LD+SHIF+V+MFDD ++FMKVPDEWAPP  K Y P E
Sbjct  120  EAELAKEKTQGYKLDRSHIFSVSMFDDFDRFMKVPDEWAPPPNKEYAPGE  169



>ref|XP_010232157.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brachypodium distachyon]
Length=718

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L ID+  +D+DSI LPPGEDF I+SDD DL   + L E + GF 
Sbjct  1    MALAISMEAIDARARELGIDIDSVDVDSITLPPGEDFDILSDDEDLLHNEDLPELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE VVRKIY QIGVIKE GLWMP DP+T+KTLGYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVVRKIYSQIGVIKEGGLWMPTDPETKKTLGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD +K+MKVPDEWAP E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWAPAEIKPYTPGE  171



>ref|XP_003603240.1| Eukaryotic translation initiation factor 3 subunit B [Medicago 
truncatula]
Length=731

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ M M+EI   A  L IDLS IDLDSI LPPG++ GI SDD   +EE+     +GFG+
Sbjct  1    MADVMLMKEIEDKALLLGIDLSSIDLDSIHLPPGDNCGIPSDDDVDQEENLEFD-SGFGN  59

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKL  VVRKIY QIG IKEDGLWMPVDP T+K+LGYCFIEYNTPQ
Sbjct  60   IIVVDNLPVVPKEKFEKLVTVVRKIYSQIGAIKEDGLWMPVDPATEKSLGYCFIEYNTPQ  119

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTP  639
            EAELAKEKT GY+LD+SHIF+V+MFDD ++FMKVPDEWAPP  K Y P
Sbjct  120  EAELAKEKTQGYKLDRSHIFSVSMFDDFDRFMKVPDEWAPPPNKEYAP  167



>ref|XP_003578786.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brachypodium distachyon]
Length=719

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SM+ I A A  L +DLS +DLDSI LPPGEDFGI+SDD D+ + D   E D GF 
Sbjct  1    MALAISMDAIEARARELGVDLSTVDLDSITLPPGEDFGILSDDEDILQNDDFPELDMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +++VVDNLPVVP EK+EKLEGVVRKIY QIGVIK+DGLWMP DP+TQKT GYCFIEYNTP
Sbjct  61   NIVVVDNLPVVPTEKYEKLEGVVRKIYSQIGVIKKDGLWMPKDPETQKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT  Y+LD+SH+FAVN+FDD EK+MKVPDEW P E K YTP E
Sbjct  121  QEAELAREKTSLYKLDRSHVFAVNIFDDFEKYMKVPDEWKPAEIKPYTPGE  171



>ref|NP_568498.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
 sp|Q9C5Z1.1|EIF3B_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=eIF-3-eta; AltName: Full=eIF3 
p110; AltName: Full=p82 [Arabidopsis thaliana]
 gb|AAG53615.1|AF285834_1 eukaryotic initiation factor 3B1 subunit [Arabidopsis thaliana]
 gb|AAK55686.1|AF378883_1 AT5g27640/F15A18_100 [Arabidopsis thaliana]
 gb|AAM26716.1| AT5g27640/F15A18_100 [Arabidopsis thaliana]
 gb|AED93709.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
Length=712

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L ID S+++ DSI+LPPGEDFGI SDD  + ++D  EFDTGFG++IVV
Sbjct  1    MEVVDIDARAAKLGIDWSQVNFDSIQLPPGEDFGIESDDEAVYQDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVPKEKFEKLEGVV+KIY Q+GVIKE+GLWMPVDPDT+ TLGYCFIE+NTPQEA+ 
Sbjct  61   DHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  121  AKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGE  166



>gb|EMT20627.1| Eukaryotic translation initiation factor 3 subunit B [Aegilops 
tauschii]
Length=693

 Score =   234 bits (597),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L IDL  +D+DSI LPPGEDFGI+SDD DL + + + E + GF 
Sbjct  1    MALAISMEAIDARARELGIDLDSVDVDSITLPPGEDFGILSDDEDLLQNEDIPELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE V+RKIYGQ+GVI+E GLWMP DP+T+KT GYCFIE+NTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVLRKIYGQLGVIREGGLWMPTDPETKKTQGYCFIEFNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAE A EKT GY+LDKSHIFAVNMFDD EK+MKVPDEWAP E K YTP E
Sbjct  121  QEAEFAMEKTRGYKLDKSHIFAVNMFDDFEKYMKVPDEWAPAEIKPYTPGE  171



>dbj|BAJ85622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=721

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L IDL  +D+DSI LPPGEDF I+SDD DL + + + E + GF 
Sbjct  1    MALAISMEAIDARARELGIDLDSVDVDSITLPPGEDFDILSDDEDLLQNEDIPELEMGFS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE VVRKIY QIGVIKE GLWMP  P+T+KT GYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVVRKIYSQIGVIKEGGLWMPTHPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD EK+MKVPDEWAP E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFEKYMKVPDEWAPAEIKPYTPGE  171



>gb|EMS54123.1| Eukaryotic translation initiation factor 3 subunit B [Triticum 
urartu]
Length=721

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L IDL  +D+DSI LPPGEDF I+SDD DL + + + E + GF 
Sbjct  1    MALAISMEAIDARARELGIDLDSVDVDSITLPPGEDFDILSDDEDLLQNEDIPELEMGFS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE VVRKIY QIGVIKE GLWMP  P+T+KT GYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVVRKIYSQIGVIKEGGLWMPTHPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD EK+MKVPDEWAP E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFEKYMKVPDEWAPAEIKPYTPGE  171



>ref|XP_010695357.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Beta vulgaris subsp. vulgaris]
Length=711

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I A AA + +DL+++DLDSIRLPPGEDFGI SDD  L EE+  +FD G+G++IVVD+LP
Sbjct  4    DIDAMAAEVGVDLTQLDLDSIRLPPGEDFGIPSDDEALREEENSDFDQGYGNIIVVDHLP  63

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
             VPKEKF+KL  V+RKIY QIGVIKEDG  MPVDP T+K+LG+CFIEYNTPQEAELAKEK
Sbjct  64   QVPKEKFDKLGSVIRKIYSQIGVIKEDGFLMPVDPATEKSLGFCFIEYNTPQEAELAKEK  123

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            T+GY+LDKSHIF++N+FD+++KFMKVPD+WAPPETK YTP E
Sbjct  124  TNGYKLDKSHIFSLNLFDEVDKFMKVPDQWAPPETKPYTPTE  165



>ref|XP_010455107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=721

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  145  TMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIV  324
            +M + +I A AA+L ID S ++LDSI+LPPG+DFGI SDD  +  +D  EFDTGFG++IV
Sbjct  8    SMEVLDIDARAAKLGIDWSHVNLDSIQLPPGQDFGIESDDEAVYHDDQSEFDTGFGNIIV  67

Query  325  VDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAE  504
            VD+LPVVPKEKFEKLEGVV+KIY QIGVIKE+GLWMPVDPDT+ TLGYCFIE+N+PQEA+
Sbjct  68   VDHLPVVPKEKFEKLEGVVKKIYNQIGVIKENGLWMPVDPDTKMTLGYCFIEFNSPQEAQ  127

Query  505  LAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
             AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + + P E
Sbjct  128  NAKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPFVPGE  174



>ref|XP_002872264.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48523.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L I+ S+++ DSI+LPPGEDFGI SDD  +  +D  EFDTGFG++IVV
Sbjct  1    MEVVDIDARAAKLGINWSQVNFDSIQLPPGEDFGIESDDEAVYHDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVPKEKFEKLEGVV+KIY Q+GVIKE+GLWMPVDPDT+ TLGYCFIE+NTPQEA+ 
Sbjct  61   DHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  121  AKEKSHGYKLDKSHIFAVNMFDDFDRLMNVREEWEPPQARPYVPGE  166



>gb|EMS45026.1| Eukaryotic translation initiation factor 3 subunit B [Triticum 
urartu]
Length=688

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L IDL  +D+DSI LPPGEDF I+SDD DL +++ + E + GF 
Sbjct  1    MALAISMEAIDARARELGIDLDSVDVDSIALPPGEDFDILSDDEDLLQDEDIPELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE V+RKIYGQ+GVIKE GLWMP DP+T+KT GYCFIE+NTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVLRKIYGQLGVIKEGGLWMPTDPETKKTQGYCFIEFNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAE A EKT GY+LDKSHIFAVNMFDD EK+MKVPDEWAP E K YTP E
Sbjct  121  QEAEFAMEKTRGYKLDKSHIFAVNMFDDFEKYMKVPDEWAPAEIKPYTPGE  171



>ref|XP_010421590.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Camelina sativa]
Length=713

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L ID S+++LDSI+LPPG+DFGI SDD  +  +D  EFDTGFG++IVV
Sbjct  1    MEVLDIDARAAKLGIDWSQVNLDSIQLPPGQDFGIESDDEAVYHDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVP EKFEKLEGVV+KIY QIGVIKE+GLWMPVDPDT+ TLGYCFIE+N+PQEA+ 
Sbjct  61   DHLPVVPMEKFEKLEGVVKKIYNQIGVIKENGLWMPVDPDTKMTLGYCFIEFNSPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  121  AKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGE  166



>ref|XP_006287159.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
 gb|EOA20057.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
Length=713

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L I+ S+++LDSI+LPPGE+FGI SDD  +  +D  EFDTGFG++IVV
Sbjct  1    MEVLDIDARAAKLGINWSQVNLDSIQLPPGENFGIESDDEAVYHDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVPKEKFEKLEGVV+KIY Q+GVIKE+GLWMPV+PDT+ TLGYCFIE+NTPQEA+ 
Sbjct  61   DHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVNPDTKMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+HGY+LDKSHIFAVNMFDD E+ M V +EW PP+ + Y P E
Sbjct  121  AKEKSHGYKLDKSHIFAVNMFDDFERLMNVREEWEPPQARPYVPGE  166



>gb|ABK25119.1| unknown [Picea sitchensis]
Length=724

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +1

Query  181  RLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKF  360
            +LNID S +DLDSI+LPPGEDFGI   + + EEED+LEF+TGFG+++VVDNLPVVP EKF
Sbjct  21   QLNIDFSNVDLDSIQLPPGEDFGI-KSEDEEEEEDSLEFETGFGNIVVVDNLPVVPPEKF  79

Query  361  EKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLD  540
            EKLEGVVRKI+GQIG I+E GLWMP+ P+TQKT GYCFIEYNTPQEA+ AK++T+GY+LD
Sbjct  80   EKLEGVVRKIFGQIGTIRERGLWMPIHPETQKTQGYCFIEYNTPQEAQTAKDQTNGYKLD  139

Query  541  KSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            KSH+FAVNMFDD +K+MKVP+EW PPETK YTP E
Sbjct  140  KSHVFAVNMFDDFDKYMKVPNEWIPPETKAYTPGE  174



>ref|XP_004983594.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Setaria italica]
Length=720

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA T SME + A A  L +DLS +DLDSI LP GEDFGI+SDD ++   +   E + G  
Sbjct  1    MALTTSMEGLEARARELAVDLSAVDLDSITLPAGEDFGILSDDEEVLRNEDPPELEMGLS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +++VVDNLPVVP EKFEKLE V+RKIY QIG IKE+GLWMPV+P+T+KT GYCFIEYNTP
Sbjct  61   NIMVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKENGLWMPVNPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNM DD EK+MKVPD W P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMLDDFEKYMKVPDTWTPAEIKPYTPGE  171



>ref|XP_009140599.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Brassica rapa]
 emb|CDY45599.1| BnaA04g14660D [Brassica napus]
Length=714

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I + AA+L ID S+++LDSI LPPGEDFGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MANIDIDSRAAQLGIDWSQVNLDSIHLPPGEDFGIQSDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPK KFEKLE V++KIY Q+GVIKE+GLWMPVDPDT  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPKAKFEKLENVLKKIYNQLGVIKENGLWMPVDPDTGVTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKTHGY+LDKSHIFAVNMFDD ++ M V +EW  P+TK Y P E
Sbjct  121  AKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEAPQTKPYVPGE  166



>ref|XP_008664809.1| PREDICTED: uncharacterized protein LOC100216593 isoform X1 [Zea 
mays]
 gb|ACN28856.1| unknown [Zea mays]
 tpg|DAA46387.1| TPA: hypothetical protein ZEAMMB73_070228 [Zea mays]
Length=720

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA ++SME I A A  L +DLS +DLDSI LP GEDFGIVSDD ++   + L E + G  
Sbjct  1    MALSVSMEGIEARARDLGVDLSAVDLDSITLPAGEDFGIVSDDEEVLRGEDLPELEMGLS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EKFEKLE V+RKIY QIG IKE+GLWMPV+P+T+KT GYCFIEY+TP
Sbjct  61   NIIVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKENGLWMPVNPETKKTYGYCFIEYSTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+ DD EK+MKVPD W P E K YT  E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNLLDDFEKYMKVPDTWTPAEIKPYTAGE  171



>emb|CDY34755.1| BnaA09g41220D [Brassica napus]
Length=714

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I   AA+L ID S+++LDSI+LPPGE+FGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MAELDIDTRAAKLGIDWSQVNLDSIQLPPGENFGIESDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPK KFEKLE V++KIY Q+GVIKE GLWMPVDP+T  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPKTKFEKLENVLKKIYSQLGVIKEKGLWMPVDPNTGMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKTHGY+LDKSHIFAVNMFDD ++ M V +EW  P+TK Y P E
Sbjct  121  AKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEAPQTKPYVPGE  166



>ref|XP_009117099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brassica rapa]
Length=714

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I   AA+L ID S+++LDSI+LPPGE+FGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MAELDIDTRAAKLGIDWSQVNLDSIQLPPGENFGIESDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPK KFEKLE V++KIY Q+GVIKE GLWMPVDP+T  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPKTKFEKLENVLKKIYSQLGVIKEKGLWMPVDPNTGMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKTHGY+LDKSHIFAVNMFDD ++ M V +EW  P+TK Y P E
Sbjct  121  AKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEAPQTKPYVPGE  166



>ref|XP_002464900.1| hypothetical protein SORBIDRAFT_01g028520 [Sorghum bicolor]
 gb|EER91898.1| hypothetical protein SORBIDRAFT_01g028520 [Sorghum bicolor]
Length=720

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L +DLS +DLDSI LP GEDFGI+SDD ++   +   E + G  
Sbjct  1    MALAISMEGIDARARELGVDLSAVDLDSITLPAGEDFGILSDDEEVLRSEDPPELEMGLS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EKFEKLE V+RKIY QIGVIKE+GLWMPV+ +T+KT GYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKFEKLENVIRKIYSQIGVIKENGLWMPVNSETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVN+ DD EK+MKVPD W P E K YT  E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNLLDDFEKYMKVPDTWTPAEIKPYTAGE  171



>emb|CDX76792.1| BnaC08g33780D [Brassica napus]
Length=714

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I   A +L ID S+++LDSI+LPPGE+FGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MAELDIDTRAGKLGIDWSQVNLDSIQLPPGENFGIESDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPK KFEKLE V++KIY Q+GVIKE GLWMPVDP+T  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPKTKFEKLENVLKKIYSQLGVIKEKGLWMPVDPNTGMTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKTHGY+LDKSHIFAVNMFDD ++ M V +EW  P+TK Y P E
Sbjct  121  AKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEAPQTKPYVPGE  166



>gb|KFK32610.1| hypothetical protein AALP_AA6G266400 [Arabis alpina]
Length=713

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I A  A+L ID S+++LDSI LPPGE+FGI SDD  +  +D  EFDTGFG++IVV
Sbjct  1    MTEMDIEARTAQLGIDWSQVNLDSINLPPGENFGIESDDERVGHDDQQEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            D+LPVVP+ KFEKLEGVV+KIY Q+GVIKE+GLWMPVDPDT+ TLGYCFIE+ TPQEA+ 
Sbjct  61   DHLPVVPEAKFEKLEGVVKKIYNQVGVIKENGLWMPVDPDTRMTLGYCFIEFMTPQEAQA  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKT GY+LD+SHIFAVNMFDD ++ M V +EW  P+TK Y P E
Sbjct  121  AKEKTQGYKLDRSHIFAVNMFDDFDRLMNVQEEWEAPQTKPYVPGE  166



>ref|NP_568477.1| eukaryotic translation initiation factor 3B-2 [Arabidopsis thaliana]
 gb|AAO00753.1| eukaryotic translation initiation factor - like protein [Arabidopsis 
thaliana]
 gb|AED93487.1| eukaryotic translation initiation factor 3B-2 [Arabidopsis thaliana]
Length=714

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I    A+L I+ S+++LDSI+LPPG DFGI SDD  + ++D  EFDTGFG++IVVD+LP
Sbjct  6    DIDVLTAQLGINWSDVNLDSIQLPPGNDFGIESDDESVYQDDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
            VVPKEKFEKLEGVV+KIY Q+GVIKE+GL MPVDPDT+ TLGYCFIE+NTPQEA+ AKEK
Sbjct  66   VVPKEKFEKLEGVVKKIYNQLGVIKENGLLMPVDPDTKMTLGYCFIEFNTPQEAQNAKEK  125

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  126  SHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQERPYVPGE  167



>gb|AAF67758.1|AF255680_1 eIF3b [Arabidopsis thaliana]
Length=716

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I    A+L I+ S+++LDSI+LPPG DFGI SDD  + ++D  EFDTGFG++IVVD+LP
Sbjct  6    DIDVLTAQLGINWSDVNLDSIQLPPGNDFGIESDDESVYQDDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
            VVPKEKFEKLEGVV+KIY Q+GVIKE+GL MPVDPDT+ TLGYCFIE+NTPQEA+ AKEK
Sbjct  66   VVPKEKFEKLEGVVKKIYNQLGVIKENGLLMPVDPDTKMTLGYCFIEFNTPQEAQNAKEK  125

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +HGY+LDKSHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  126  SHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQERPYVPGE  167



>emb|CDY36167.1| BnaC04g37270D [Brassica napus]
Length=714

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I + AA+L ID S+++LDSI LP GEDFGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MANIDIDSRAAQLGIDWSQVNLDSIHLPRGEDFGIQSDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVPK KFEKLE V++KIY Q+GVIKE+GLWMPVDP T  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPKAKFEKLENVLKKIYNQLGVIKENGLWMPVDPGTGVTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEKTHGY+LDKSHIFAVNMFDD ++ M V  EW  P+TK Y P E
Sbjct  121  AKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKGEWEAPQTKPYVPGE  166



>ref|XP_009789485.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nicotiana sylvestris]
Length=375

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIE  480
            TGFG+++VVDNLPVVPKEKFEKLEGVV+KIY Q+GVIKEDGLWMPVDP+TQKTL YCFIE
Sbjct  121  TGFGNILVVDNLPVVPKEKFEKLEGVVQKIYSQLGVIKEDGLWMPVDPETQKTLRYCFIE  180

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            YNTPQEAEL+KEKTHGY+LD SHIF VNMFDDIEKF+KVPDEWA PE K Y PRE
Sbjct  181  YNTPQEAELSKEKTHGYKLDMSHIFVVNMFDDIEKFLKVPDEWARPEIKPYVPRE  235



>ref|NP_001031954.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
 gb|AED93710.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
Length=738

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 141/192 (73%), Gaps = 26/192 (14%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M + +I A AA+L ID S+++ DSI+LPPGEDFGI SDD  + ++D  EFDTGFG++IVV
Sbjct  1    MEVVDIDARAAKLGIDWSQVNFDSIQLPPGEDFGIESDDEAVYQDDQSEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP-----  492
            D+LPVVPKEKFEKLEGVV+KIY Q+GVIKE+GLWMPVDPDT+ TLGYCFIE+NTP     
Sbjct  61   DHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQKGAQ  120

Query  493  ---------------------QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEW  609
                                 QEA+ AKEK+HGY+LDKSHIFAVNMFDD ++ M V +EW
Sbjct  121  TRLFLMVEYFLRVSLNVWGSLQEAQNAKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEW  180

Query  610  APPETKVYTPRE  645
             PP+ + Y P E
Sbjct  181  EPPQARPYVPGE  192



>ref|XP_010421436.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X2 [Camelina sativa]
Length=734

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I   AA+L I+ SEI+LDSI+LPPG+DFGI SDD  +  ED  EFDTGFG++IVVD+LP
Sbjct  6    DIDGRAAQLGINWSEINLDSIQLPPGDDFGIASDDEAVYHEDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
            VV +EK+EKLEGVV+KIY Q+GVI+E+GLWMPVDPDT+KTLGYC IE+NT QEA+ AKEK
Sbjct  66   VVTREKYEKLEGVVKKIYNQLGVIRENGLWMPVDPDTKKTLGYCLIEFNTAQEAQNAKEK  125

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTP  639
            THGY+LDKSHIF VN FDD ++ M V +EW PP+ + Y P
Sbjct  126  THGYKLDKSHIFDVNKFDDFDRLMNVKEEWEPPQARPYVP  165



>ref|XP_010454917.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=715

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I   AA+L I+ SEI+LDSI LPP +DFGI SDD  +  ED  EFDTGFG++IVVD+LP
Sbjct  6    DIDGRAAQLGINWSEINLDSIHLPPRDDFGIASDDEAVYHEDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
            VV +EK+EKLEGVV+KIY Q+GVI+E+GLWMPVDPDT+ TLGYCFIE+NT QEA+ AKEK
Sbjct  66   VVTREKYEKLEGVVKKIYNQLGVIRENGLWMPVDPDTELTLGYCFIEFNTAQEAQNAKEK  125

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            THGY+LDKSHIF VN FDD ++ M V +EW PP+   Y P E
Sbjct  126  THGYKLDKSHIFDVNKFDDFDRLMNVKEEWEPPQASFYVPAE  167



>ref|XP_009140598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Brassica rapa]
Length=737

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 138/189 (73%), Gaps = 23/189 (12%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I + AA+L ID S+++LDSI LPPGEDFGI SDD  +  +D LEFDTGFG++IVV
Sbjct  1    MANIDIDSRAAQLGIDWSQVNLDSIHLPPGEDFGIQSDDEGVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP-----  492
            DNLPVVPK KFEKLE V++KIY Q+GVIKE+GLWMPVDPDT  TLGYCFIE+NTP     
Sbjct  61   DNLPVVPKAKFEKLENVLKKIYNQLGVIKENGLWMPVDPDTGVTLGYCFIEFNTPQVTYL  120

Query  493  ------------------QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPP  618
                              QEA+ AKEKTHGY+LDKSHIFAVNMFDD ++ M V +EW  P
Sbjct  121  TFYVSLCHMYVVDIWVGLQEAQNAKEKTHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEAP  180

Query  619  ETKVYTPRE  645
            +TK Y P E
Sbjct  181  QTKPYVPGE  189



>ref|XP_006405042.1| hypothetical protein EUTSA_v10000061mg [Eutrema salsugineum]
 gb|ESQ46495.1| hypothetical protein EUTSA_v10000061mg [Eutrema salsugineum]
Length=716

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  148  MSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVV  327
            M+  +I A A +L ID S++DL+SI++P GED GI SDD ++  +D LEFDTGFG++IVV
Sbjct  1    MADVDIDARATQLRIDWSQVDLNSIQVPSGEDCGIESDDEEVYHDDQLEFDTGFGNIIVV  60

Query  328  DNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL  507
            DNLPVVP  KFEKLEGVV+KIY Q+GVIKE GLWMPV+PDT  TLGYCFIE+NTPQEA+ 
Sbjct  61   DNLPVVPAAKFEKLEGVVKKIYNQLGVIKERGLWMPVEPDTGTTLGYCFIEFNTPQEAQN  120

Query  508  AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            AKEK+ GY+LD+SHIFAVNMFDD ++ M V +EW PP+ + Y P E
Sbjct  121  AKEKSQGYKLDRSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGE  166



>ref|XP_002874283.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50542.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 138/187 (74%), Gaps = 25/187 (13%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I A +A+L ++ SE++LDSI+LPPG +FGI SDD  +  +D  EFDTGFG++IVVD+LP
Sbjct  6    DIDALSAQLGVNWSEVNLDSIQLPPGNNFGIESDDEAVYHDDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAEL----  507
            VVPKEKFEKLEGV++KIY Q+GVIKE+GLWMPVDPDT+ TLGYCFIE+NTPQE EL    
Sbjct  66   VVPKEKFEKLEGVLKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQETELDCLT  125

Query  508  ---------------------AKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPET  624
                                 AKEK+HGY+LDK+HIFAVNMFDD ++ M V +EW PP+ 
Sbjct  126  MVVYILRVCFNVWGSLQEAQNAKEKSHGYKLDKTHIFAVNMFDDFDRLMNVREEWEPPQA  185

Query  625  KVYTPRE  645
            + Y P E
Sbjct  186  RPYVPGE  192



>ref|XP_010493833.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=713

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLP  339
            +I   AA+L I+ SEI+LDSI+LPPG+DFGI SDD  +  +D  EFDTGFG++IVVD+LP
Sbjct  6    DIDGRAAQLGINWSEINLDSIQLPPGDDFGIASDDEAVYHDDQSEFDTGFGNIIVVDHLP  65

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
             V +EK+EKLEGVV+KIY Q+GVI+E+GLWMPV PDT KTLGYCFIE+NT QEA+ AKEK
Sbjct  66   DVLREKYEKLEGVVKKIYNQLGVIRENGLWMPVGPDT-KTLGYCFIEFNTAQEAQNAKEK  124

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            THGY+LDKSHIF VN FDD ++ M V +EW PP+ + Y+P E
Sbjct  125  THGYKLDKSHIFDVNKFDDFDRLMNVKEEWEPPQARPYSPAE  166



>gb|EEE51441.1| hypothetical protein OsJ_32527 [Oryza sativa Japonica Group]
Length=697

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MA  +SME I A A  L +DLS +DLDS+ LP GEDFGI+SDD DL   D  +E + GF 
Sbjct  1    MALEISMEGIEARARELGVDLSTVDLDSVTLPAGEDFGILSDDEDLLRIDDPMELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +V+VVDNLPVVP EKFEKLE V+RKIY QIG IKE GLWMPV+P+T+KT GYCFIEYNTP
Sbjct  61   NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD +K+MKVPDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGE  171



>ref|NP_001065446.1| Os10g0569200 [Oryza sativa Japonica Group]
 gb|AAL86464.1|AC077693_3 putative eukaryotic initiation factor subunit [Oryza sativa Japonica 
Group]
 gb|AAP55090.1| Eukaryotic translation initiation factor 3 subunit 9, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF27283.1| Os10g0569200 [Oryza sativa Japonica Group]
 dbj|BAG90702.1| unnamed protein product [Oryza sativa Japonica Group]
Length=719

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MA  +SME I A A  L +DLS +DLDS+ LP GEDFGI+SDD DL   D  +E + GF 
Sbjct  1    MALEISMEGIEARARELGVDLSTVDLDSVTLPAGEDFGILSDDEDLLRIDDPMELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +V+VVDNLPVVP EKFEKLE V+RKIY QIG IKE GLWMPV+P+T+KT GYCFIEYNTP
Sbjct  61   NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD +K+MKVPDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGE  171



>gb|EEC67477.1| hypothetical protein OsI_34716 [Oryza sativa Indica Group]
Length=720

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MA  +SME I A A  L +DLS +DLDS+ LP GEDFGI+SDD DL   D  +E + GF 
Sbjct  1    MALEISMEGIEARARELGVDLSTVDLDSVTLPAGEDFGILSDDEDLLRIDDPMELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +V+VVDNLPVVP EKFEKLE V+RKIY QIG IKE GLWMPV+P+T+KT GYCFIEYNTP
Sbjct  61   NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD +K+MKVPDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGE  171



>ref|XP_006662084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Oryza brachyantha]
Length=719

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeeda-lefdTGFG  312
            MA  +SME I A A  L +DLS +DLD I LP GEDFGI SDD DL  +D  +E + GF 
Sbjct  1    MALEISMEGIEARARELGVDLSAVDLDYITLPAGEDFGIPSDDEDLLRDDDPMELEMGFA  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +V+VVDNLPVVP EKFEKLE V+RKIY QIG IKE GLWMPV+P+T+KT GYCFIEYNTP
Sbjct  61   NVVVVDNLPVVPPEKFEKLENVIRKIYSQIGAIKEGGLWMPVNPETKKTYGYCFIEYNTP  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            QEAELA+EKT+GY+LDKSHIFAVNMFDD +K+MKVPDEW P E K YTP E
Sbjct  121  QEAELAREKTNGYKLDKSHIFAVNMFDDFDKYMKVPDEWMPAEIKPYTPGE  171



>ref|XP_006855977.1| hypothetical protein AMTR_s00037p00235640 [Amborella trichopoda]
 gb|ERN17444.1| hypothetical protein AMTR_s00037p00235640 [Amborella trichopoda]
Length=719

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +1

Query  190  IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKL  369
            ID+S IDLDSI LPPG+DFGI SDD  + EE+     +GFGS+I+VDNLPVV  EK+EKL
Sbjct  25   IDISNIDLDSIHLPPGDDFGIPSDDDVVAEEELEFD-SGFGSIIIVDNLPVVAPEKYEKL  83

Query  370  EGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSH  549
            E V+RKI+GQIGVI+E GL MPVD +T+KT GYCFIEY+TPQEA+ AK++T+GY+LDKSH
Sbjct  84   EIVIRKIFGQIGVIREGGLCMPVDQETKKTKGYCFIEYSTPQEAQTAKDQTNGYKLDKSH  143

Query  550  IFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +FAV +FD+ +K++ VPDEW PPE K YTP E
Sbjct  144  VFAVYLFDEFDKYVNVPDEWVPPEIKPYTPGE  175



>gb|KHN29662.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=286

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +1

Query  340  VVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEK  519
            +VP+EKFEKLEGVVRKIY QIGVIKEDGLWMP+ P+T+KTLGYCFIEYNTPQEAELAKEK
Sbjct  14   LVPREKFEKLEGVVRKIYSQIGVIKEDGLWMPIYPETEKTLGYCFIEYNTPQEAELAKEK  73

Query  520  THGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            THGY+LD++HIFAV+MFDD ++FMKVP+EWAPPETK YTP E
Sbjct  74   THGYKLDRAHIFAVSMFDDFDRFMKVPNEWAPPETKPYTPGE  115



>ref|XP_001771510.1| predicted protein [Physcomitrella patens]
 gb|EDQ63710.1| predicted protein [Physcomitrella patens]
Length=714

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = +1

Query  181  RLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKF  360
            +LNID S +DLDSI LPPG+D GI SDD + EEE      TGFG+VIVVDNLPVV  EK+
Sbjct  11   QLNIDWSNVDLDSIMLPPGDDMGIKSDDEEEEEETLETD-TGFGNVIVVDNLPVVASEKY  69

Query  361  EKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLD  540
            EKLEGV+RKI+GQIG I  +GL MP D ++ KT G+ FIEY+TPQEA+ A+E+T+GY+LD
Sbjct  70   EKLEGVIRKIFGQIGAITPNGLMMPRD-ESGKTKGFAFIEYSTPQEAQTAREQTNGYKLD  128

Query  541  KSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +SH+F VNMFDD +K+MKVPDEW PPE K YTP E
Sbjct  129  RSHVFVVNMFDDYDKYMKVPDEWNPPEIKPYTPGE  163



>ref|XP_006495404.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Citrus sinensis]
Length=129

 Score =   177 bits (450),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + + M EI ATA RL IDL ++DLDSI+LPPGED GI+SDD D+ E+D  E ++GFG+
Sbjct  1    MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+TQK+LGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQ  120



>ref|XP_006450239.1| hypothetical protein CICLE_v100076091mg, partial [Citrus clementina]
 gb|ESR63479.1| hypothetical protein CICLE_v100076091mg, partial [Citrus clementina]
Length=120

 Score =   177 bits (449),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + + M EI ATA RL IDL ++DLDSI+LPPGED GI+SDD D+ E+D  E ++GFG+
Sbjct  1    MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            +IVVDNLPVVPKEKFEKLEGV+RKIY QIGVIKEDGLWMPVDP+TQK+LGYCFIEYNTPQ
Sbjct  61   IIVVDNLPVVPKEKFEKLEGVIRKIYSQIGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQ  120



>ref|XP_001770820.1| predicted protein [Physcomitrella patens]
 gb|EDQ64344.1| predicted protein [Physcomitrella patens]
Length=723

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = +1

Query  181  RLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKF  360
            +LNID   +DLDSI LPPG+D GI SDD + EEE      TGFG+VI+VDNLPVV  EK+
Sbjct  26   QLNIDWGNVDLDSIVLPPGDDMGIKSDDEEEEEETLETD-TGFGNVIIVDNLPVVASEKY  84

Query  361  EKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLD  540
            EKLEGV+RKI+GQIGVI  +GL MP D ++ KT GY FIEY+TPQEA+ A+E+T+GY+LD
Sbjct  85   EKLEGVIRKIFGQIGVITPNGLLMPRD-ESGKTKGYAFIEYSTPQEAQTAREQTNGYKLD  143

Query  541  KSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +SH+F VNMFDD +K+MKVPDEW  PE K YTP E
Sbjct  144  RSHVFVVNMFDDYDKYMKVPDEWNSPEIKPYTPGE  178



>ref|XP_006841801.1| hypothetical protein AMTR_s00003p00268400 [Amborella trichopoda]
 gb|ERN03476.1| hypothetical protein AMTR_s00003p00268400 [Amborella trichopoda]
Length=718

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  190  IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKL  369
            ID+S IDL+SI+LPPG+D+GI SDD  +EEE      +GF ++I+V NLPVV  EKFEKL
Sbjct  25   IDISNIDLESIQLPPGDDYGIPSDDDVVEEEALEFD-SGFENIIIVYNLPVVAPEKFEKL  83

Query  370  EGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSH  549
            E V+RKI+GQIGVI+E GL MP+D +T+KT GYCFIEY+TPQEA+ AK++T+GY+LDKSH
Sbjct  84   EIVIRKIFGQIGVIREGGLRMPIDQETKKTQGYCFIEYSTPQEAQTAKDQTNGYKLDKSH  143

Query  550  IFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +FAV +FD+ +K++ VPDEW  PE K YTP E
Sbjct  144  VFAVYLFDEFDKYVNVPDEWVAPEIKPYTPGE  175



>ref|XP_002986150.1| hypothetical protein SELMODRAFT_182220 [Selaginella moellendorffii]
 gb|EFJ12681.1| hypothetical protein SELMODRAFT_182220 [Selaginella moellendorffii]
Length=723

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +1

Query  184  LNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFE  363
            LNID S+++LD I+LPPGEDFGI   + + EEE+ +E ++GFGS+IVVDNLPVV   K+E
Sbjct  26   LNIDWSQVNLDEIQLPPGEDFGI-KSEDEEEEEEIVESESGFGSIIVVDNLPVVEPAKYE  84

Query  364  KLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDK  543
            KLE VVRKI+GQ+G+I+   L+MP D  T KT G+ FIEY++PQEA  A+E+  GY+LDK
Sbjct  85   KLENVVRKIFGQMGIIRT--LFMPKDKATGKTAGFAFIEYSSPQEAHTAREQADGYKLDK  142

Query  544  SHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            SH+F V MFDDI+K+MKVP++W  PE K Y P E
Sbjct  143  SHVFMVRMFDDIDKYMKVPEQWVAPEIKSYVPGE  176



>ref|XP_009784533.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nicotiana sylvestris]
Length=121

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  154  MEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDN  333
            M EI   AAR+ ++LS+IDLDSI LPPGED GI SDD DL EED LEFDTGFG+++VVDN
Sbjct  1    MGEITTIAARIGVELSQIDLDSIHLPPGEDCGIPSDDDDLMEEDPLEFDTGFGNILVVDN  60

Query  334  LPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            LPVVPKEKFEKLEGVVRKIY Q+GVIKEDGLW+PVDP TQKTLGYCFIEYNTPQ
Sbjct  61   LPVVPKEKFEKLEGVVRKIYNQLGVIKEDGLWIPVDPKTQKTLGYCFIEYNTPQ  114



>ref|XP_002984964.1| hypothetical protein SELMODRAFT_446105 [Selaginella moellendorffii]
 gb|EFJ13839.1| hypothetical protein SELMODRAFT_446105 [Selaginella moellendorffii]
Length=723

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +1

Query  184  LNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFE  363
            LNID S+++LD I+LPPGEDFGI   + + EEE+ +E ++GFGS+IVVDNLPVV   K+E
Sbjct  26   LNIDWSQVNLDEIQLPPGEDFGI-KSEDEEEEEEIVESESGFGSIIVVDNLPVVEPAKYE  84

Query  364  KLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDK  543
            KLE VVRKI+GQ+G+I+   L+MP D  T KT G+ FIEY++PQEA  A+++  GY+LDK
Sbjct  85   KLENVVRKIFGQMGIIRT--LFMPKDKATGKTSGFAFIEYSSPQEAHTARDQADGYKLDK  142

Query  544  SHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            SH+F V MFDDI+K+MKVP++W  PE K Y P E
Sbjct  143  SHVFMVRMFDDIDKYMKVPEQWVAPEIKSYVPGE  176



>gb|ABI14666.1| eukaryotic translation initiation factor 3 subunit [Aegiceras 
corniculatum]
Length=114

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA+ MSME+IRATA RL IDLS +DLDSI LP GED+GI+SDD DL+E+D LEFD G  +
Sbjct  1    MADVMSMEDIRATATRLGIDLSTVDLDSIHLPAGEDYGIISDDEDLKEDDELEFDGGLSN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFI  477
            +IVVDNLPVVP EKFEKLEGV++KIY QIGVIKEDG+WMP+DP T KT GYCFI
Sbjct  61   IIVVDNLPVVPMEKFEKLEGVIKKIYSQIGVIKEDGIWMPIDPTTSKTRGYCFI  114



>gb|EMT30161.1| Callose synthase 3 [Aegilops tauschii]
Length=1030

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 115/169 (68%), Gaps = 12/169 (7%)
 Frame = +1

Query  160  EIRATAARLNIDLSEIDLDSIRLPP-GEDFGIVSddgdleeedale-------fdTGFGS  315
            ++ A A  L +DL+ +DLDSI LP    DF   +DD D E              +TGFG+
Sbjct  8    QLEARARELGVDLTAVDLDSITLPADAGDFPCSNDDDDDEVLLLESDVGPPPELETGFGN  67

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            VI+VDNLP+VP EKFE+L+ V+R IYGQIGVIKE GLW+P+      T GYCFIEY TPQ
Sbjct  68   VIIVDNLPIVPAEKFERLQCVMRAIYGQIGVIKEGGLWIPI---LYTTYGYCFIEYATPQ  124

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWA-PPETKVYTP  639
            EAELA+ KT+ Y LD+ H F VNMFDD +K++KVPD+W  P E K YTP
Sbjct  125  EAELARRKTNLYALDRFHKFQVNMFDDFDKYIKVPDQWTLPDEIKQYTP  173



>ref|XP_006412558.1| hypothetical protein EUTSA_v10027018mg, partial [Eutrema salsugineum]
 gb|ESQ54011.1| hypothetical protein EUTSA_v10027018mg, partial [Eutrema salsugineum]
Length=667

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGV-IKEDGLWMPVDPDTQKTLGYCFI  477
            T FG+VIVVD LPVV  ++FEKLEG +RK+Y Q+GV IKEDG  MPVD DT  T GYCFI
Sbjct  10   TEFGNVIVVDQLPVVGMDRFEKLEGAIRKLYNQLGVVIKEDGFSMPVDSDTNTTNGYCFI  69

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTP  639
            E+NTPQEA+ AKEKTHG +  KSHI AV MFDDIE+ M V +EW PP+ K Y P
Sbjct  70   EFNTPQEAQKAKEKTHGCKFGKSHILAVYMFDDIERLMNVKEEWEPPQIKPYAP  123



>gb|EMT19614.1| Eukaryotic translation initiation factor 3 subunit B [Aegilops 
tauschii]
Length=672

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedal-efdTGFG  312
            MA  +SME I A A  L IDL  +D+DSI LPPGEDF I+SDD DL + + + E + GF 
Sbjct  1    MALAISMEAIDARARELGIDLDSVDVDSITLPPGEDFDILSDDEDLLQNEDIPELEMGFS  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            ++IVVDNLPVVP EK+EKLE VVRKIY QIGVIKE GLWMP  P+T+KT GYCFIEYNTP
Sbjct  61   NIIVVDNLPVVPPEKYEKLENVVRKIYSQIGVIKEGGLWMPTHPETKKTYGYCFIEYNTP  120

Query  493  QEAEL  507
            QE  L
Sbjct  121  QENLL  125



>ref|XP_002505347.1| eukaryotic translation initiation factor-like protein [Micromonas 
sp. RCC299]
 gb|ACO66605.1| eukaryotic translation initiation factor-like protein [Micromonas 
sp. RCC299]
Length=717

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 113/169 (67%), Gaps = 5/169 (3%)
 Frame = +1

Query  148  MSMEEIRATAARLN---IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSV  318
            M +EEI     R     +D S++D+  + +P G+D GIVSDD  ++ E+     +GFG+V
Sbjct  1    MGLEEIPPNLPRGEDGYVDWSKVDVKDLEMPAGDDMGIVSDDEGIDVEEVKSE-SGFGTV  59

Query  319  IVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQE  498
            IVVDNLP VP  KFEKL  VVRKIYGQIGV++E+GL MP   D   T G+ F+E++ P E
Sbjct  60   IVVDNLPKVPDAKFEKLCTVVRKIYGQIGVVRENGLHMPKGADGV-TKGFAFVEFHNPAE  118

Query  499  AELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            A  A E+T+GY+LDK+H+F V+ FDD  K+  VPDE+  PE K Y  RE
Sbjct  119  AAAAIEQTNGYKLDKAHVFKVSKFDDFSKYDAVPDEYKAPEPKPYVARE  167



>gb|KIZ03095.1| Eukaryotic translation initiation factor 3 subunit B [Monoraphidium 
neglectum]
Length=177

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 105/146 (72%), Gaps = 2/146 (1%)
 Frame = +1

Query  205  IDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKLEGVVR  384
             D++ + LP G+D  I   D D  EE+ LE  +GFGSVIVVDNLP VP+EK+EKL  V++
Sbjct  30   FDVEELILPDGDDMDI-RSDEDESEEEELETASGFGSVIVVDNLPSVPEEKYEKLVNVLK  88

Query  385  KIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSHIFAVN  564
            KIYGQIG I++ G++MP D + + + GY FIE++ P EA+ A+ +T GY+LDK+H F V 
Sbjct  89   KIYGQIGNIRDGGVYMPKDAN-KVSKGYAFIEFSHPMEAQAARAQTAGYQLDKNHRFNVT  147

Query  565  MFDDIEKFMKVPDEWAPPETKVYTPR  642
            +FDD E++ +VPDE+  PE K + P+
Sbjct  148  LFDDFERYARVPDEYVAPEDKAFAPQ  173



>ref|XP_007514980.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15220.1| predicted protein [Bathycoccus prasinos]
Length=732

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 110/168 (65%), Gaps = 7/168 (4%)
 Frame = +1

Query  163  IRATAARLNIDLSEIDLDSIRLPPGED-FGI------VSddgdleeedalefdTGFGSVI  321
            +R T     ++  +ID+DSI LPP ED +GI      ++      ++ + +  +   + I
Sbjct  2    LRITTQNGYVEWDKIDIDSIDLPPSEDNYGIPSDDEDLTQKDGANKDGSKDESSMMSTAI  61

Query  322  VVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEA  501
            +VDNLP VP+ KF KL  V+ KI+GQIG I++ GL MP+DP T+ + GY FIE+++  EA
Sbjct  62   IVDNLPEVPEAKFVKLTNVLTKIFGQIGQIRDGGLHMPMDPATKMSCGYAFIEFSSRAEA  121

Query  502  ELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            + A E+T GY+LDK+H+F V+ FDD EK+ K+PDE+  PE K YT RE
Sbjct  122  DAAVEQTDGYKLDKAHVFKVSKFDDFEKYAKIPDEYVAPEPKPYTQRE  169



>ref|XP_001421305.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99598.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=713

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 0/152 (0%)
 Frame = +1

Query  190  IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKL  369
            +D  ++D++S+ LP  E      D     E +  + DTGF SVIVVDNLP +P+ KF KL
Sbjct  16   VDWDKVDVESVELPADEIKRAGLDQPVKVELEEAKEDTGFASVIVVDNLPQIPEAKFGKL  75

Query  370  EGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSH  549
              V+ KI+ QIG I+E G+ MP D  T+ +LGY F+E+   Q+A+ A E+T GY+LDK+H
Sbjct  76   LNVLTKIFTQIGEIREGGMLMPQDEATKTSLGYAFVEFANEQQAQSAVEQTDGYKLDKTH  135

Query  550  IFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            IF V  FDD EK+ KVPDE+  P  K + PRE
Sbjct  136  IFKVCKFDDFEKYQKVPDEYVAPPPKPFAPRE  167



>ref|XP_005648006.1| eukaryotic initiation factor [Coccomyxa subellipsoidea C-169]
 gb|EIE23462.1| eukaryotic initiation factor [Coccomyxa subellipsoidea C-169]
Length=713

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGV-IKEDGLWMPVDPDTQKTLGYCFI  477
            TGFGSV+VVDNLP VP EK+EKL GVV+K+  Q  V I+E G +MPVD +T+ + G+ F+
Sbjct  58   TGFGSVVVVDNLPQVPPEKYEKLSGVVKKVISQAKVVIREGGFFMPVDEETKLSKGFAFV  117

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            E+N+P+EA   ++  +G++LDKSH FAVN+FD+I+K+M++PD +  PE K + P E
Sbjct  118  EFNSPEEALAVRQVVNGFKLDKSHTFAVNLFDEIDKYMRIPDVYESPEDKKFEPTE  173



>ref|XP_008229535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X4 [Prunus mume]
Length=184

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 106/171 (62%), Gaps = 12/171 (7%)
 Frame = +1

Query  142  ETMSMEEIRATAARLNIDLSEIDLDSIRLPPGED---------FGIVSddgdleeedale  294
            +T +ME+I+A A  L + LS +  +S   P  +D         FG         ++D L 
Sbjct  4    DTATMEDIQAEAEELRLQLSSLHFNSAAPPLNQDLHNNNTENNFG--DGQEVFYDDDGLL  61

Query  295  fdTGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCF  474
            F+ GFG+VIVVDNLP+V  E  ++LE  +R+++ ++GVIKEDG  MP++P  QKTLG CF
Sbjct  62   FNIGFGNVIVVDNLPIVKAEMAQQLESEIRRVFSEVGVIKEDGFSMPLNPLNQKTLGRCF  121

Query  475  IEYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            IE+++ QEAELA+ K  GY  + +   +V ++DD+++F+ + D    PET 
Sbjct  122  IEFSSRQEAELARVKRDGYNFN-TQALSVTLYDDLDRFIDITDVGTTPETN  171



>ref|XP_007209600.1| hypothetical protein PRUPE_ppa011445mg [Prunus persica]
 gb|EMJ10799.1| hypothetical protein PRUPE_ppa011445mg [Prunus persica]
Length=210

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 101/165 (61%), Gaps = 8/165 (5%)
 Frame = +1

Query  154  MEEIRATAARLNIDLSEIDLDSIRLPPGEDF-------GIVSddgdleeedalefdTGFG  312
            ME+I+A A  L + LS    +S   PP +D                  ++D L F+ GFG
Sbjct  1    MEDIQAKAEELRLQLSSFHFNSAAPPPNQDLYNNNTENNFGDGQEVFYDDDGLLFNIGFG  60

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +VIVVDNLP+V  E  ++LE  +R+++ ++GVIKEDG  MP++P  QKTLG CFIE+++ 
Sbjct  61   NVIVVDNLPIVKAEMAQQLESEIRRVFSEVGVIKEDGFSMPLNPLNQKTLGRCFIEFSSR  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            QEAELA+ K  GY  + +   +V ++DD+++F+ + D    PET 
Sbjct  121  QEAELARVKRDGYNFN-TQALSVTLYDDLDRFIDITDVGTTPETN  164



>ref|XP_008229533.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X2 [Prunus mume]
Length=233

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 104/169 (62%), Gaps = 8/169 (5%)
 Frame = +1

Query  142  ETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDF-------GIVSddgdleeedalefd  300
            +T +ME+I+A A  L + LS +  +S   P  +D                  ++D L F+
Sbjct  4    DTATMEDIQAEAEELRLQLSSLHFNSAAPPLNQDLHNNNTENNFGDGQEVFYDDDGLLFN  63

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIE  480
             GFG+VIVVDNLP+V  E  ++LE  +R+++ ++GVIKEDG  MP++P  QKTLG CFIE
Sbjct  64   IGFGNVIVVDNLPIVKAEMAQQLESEIRRVFSEVGVIKEDGFSMPLNPLNQKTLGRCFIE  123

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            +++ QEAELA+ K  GY  + +   +V ++DD+++F+ + D    PET 
Sbjct  124  FSSRQEAELARVKRDGYNFN-TQALSVTLYDDLDRFIDITDVGTTPETN  171



>ref|XP_008229534.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X3 [Prunus mume]
Length=232

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 104/169 (62%), Gaps = 8/169 (5%)
 Frame = +1

Query  142  ETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDF-------GIVSddgdleeedalefd  300
            +T +ME+I+A A  L + LS +  +S   P  +D                  ++D L F+
Sbjct  4    DTATMEDIQAEAEELRLQLSSLHFNSAAPPLNQDLHNNNTENNFGDGQEVFYDDDGLLFN  63

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIE  480
             GFG+VIVVDNLP+V  E  ++LE  +R+++ ++GVIKEDG  MP++P  QKTLG CFIE
Sbjct  64   IGFGNVIVVDNLPIVKAEMAQQLESEIRRVFSEVGVIKEDGFSMPLNPLNQKTLGRCFIE  123

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            +++ QEAELA+ K  GY  + +   +V ++DD+++F+ + D    PET 
Sbjct  124  FSSRQEAELARVKRDGYNFN-TQALSVTLYDDLDRFIDITDVGTTPETN  171



>ref|XP_008229532.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Prunus mume]
Length=238

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 106/171 (62%), Gaps = 12/171 (7%)
 Frame = +1

Query  142  ETMSMEEIRATAARLNIDLSEIDLDSIRLPPGED---------FGIVSddgdleeedale  294
            +T +ME+I+A A  L + LS +  +S   P  +D         FG         ++D L 
Sbjct  4    DTATMEDIQAEAEELRLQLSSLHFNSAAPPLNQDLHNNNTENNFG--DGQEVFYDDDGLL  61

Query  295  fdTGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCF  474
            F+ GFG+VIVVDNLP+V  E  ++LE  +R+++ ++GVIKEDG  MP++P  QKTLG CF
Sbjct  62   FNIGFGNVIVVDNLPIVKAEMAQQLESEIRRVFSEVGVIKEDGFSMPLNPLNQKTLGRCF  121

Query  475  IEYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            IE+++ QEAELA+ K  GY  + +   +V ++DD+++F+ + D    PET 
Sbjct  122  IEFSSRQEAELARVKRDGYNFN-TQALSVTLYDDLDRFIDITDVGTTPETN  171



>ref|XP_003083330.1| Translation initiation factor 3, subunit b (eIF-3b) (ISS), partial 
[Ostreococcus tauri]
Length=695

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 108/170 (64%), Gaps = 3/170 (2%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            + E + M+  RA      +D +++D++S+ LP  E      D     E + L+ ++GF S
Sbjct  44   LTERLMMDVSRAQDGF--VDWNKVDVESVELPRDEFERAGLDKPVEAEIEELKQESGFAS  101

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
            VIVVDNLP++ + K+ KL  V+ KI+ QIG I+E GL MP D D++ +LG+ FIEY   Q
Sbjct  102  VIVVDNLPMIAEAKYAKLLSVLTKIFSQIGTIREGGLLMPQD-DSKTSLGFAFIEYENEQ  160

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +A+ A ++T+GY+LDK H+F V  FDD EK+ KVPDE+  P  K +  RE
Sbjct  161  QAQSAVDQTNGYQLDKKHVFKVCKFDDFEKYEKVPDEYVAPPPKPFAKRE  210



>emb|CEG01790.1| Eukaryotic translation initiation factor 3 subunit B [Ostreococcus 
tauri]
Length=709

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  190  IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKL  369
            +D +++D++S+ LP  E      D     E + L+ ++GF SVIVVDNLP++ + K+ KL
Sbjct  16   VDWNKVDVESVELPRDEFERAGLDKPVEAEIEELKQESGFASVIVVDNLPMIAEAKYAKL  75

Query  370  EGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSH  549
              V+ KI+ QIG I+E GL MP D D++ +LG+ FIEY   Q+A+ A ++T+GY+LDK H
Sbjct  76   LSVLTKIFSQIGTIREGGLLMPQD-DSKTSLGFAFIEYENEQQAQSAVDQTNGYQLDKKH  134

Query  550  IFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +F V  FDD EK+ KVPDE+  P  K +  RE
Sbjct  135  VFKVCKFDDFEKYEKVPDEYVAPPPKPFAKRE  166



>ref|XP_009371884.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=225

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            GFG+VIVVDNLP+V     EKLE  +R  + ++GVIK DG+ +P++P T ++LG CFIE+
Sbjct  56   GFGNVIVVDNLPIVDARMAEKLESEIRLAFSEVGVIKHDGVSVPLNPQTHESLGRCFIEF  115

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPET  624
            N+ QEAELA+EK  GY    +H  +V+++DD+++F+ + DE   PET
Sbjct  116  NSRQEAELAREKRDGYNF-HTHTLSVSLYDDLDRFVDILDEGTTPET  161



>ref|XP_009339401.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=225

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            GFG+VIVVDNLP+V     EKLE  +R  + ++GVIK DG+ +P++P T  +LG CFIE+
Sbjct  56   GFGNVIVVDNLPIVDARMAEKLESEIRLAFSEVGVIKHDGVSVPLNPQTHASLGRCFIEF  115

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPET  624
            N+ QEAELA+EK  GY    +H  +V+++DD+++F+ + DE   PET
Sbjct  116  NSRQEAELAREKRDGYNF-HTHTLSVSLYDDLDRFVDILDEGTIPET  161



>ref|XP_001691870.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP04360.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=718

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 100/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  205  IDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKLEGVVR  384
             DL+ + LPPG+D GI SDD D+ +ED     +GFGS IV+ NLP  P+EK+EKL GVVR
Sbjct  29   FDLEELILPPGDDMGIKSDDDDVRDEDVQTQ-SGFGSCIVIQNLPKAPEEKYEKLMGVVR  87

Query  385  KIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAE--LAKEK-THGYRLDKSHIF  555
             I  ++G ++E+G++MP+D  T+ T G+ F+E    ++A+  L+ E+  +GY+LDK+H  
Sbjct  88   TIASKLGDVRENGIFMPLDDATKTTKGFAFVEMARKEDADAALSDERFINGYQLDKNHKL  147

Query  556  AVNMFDDIEKFMKVPDEWAPPETKVY  633
             ++ FDD +K+ KVPDE+  PE   Y
Sbjct  148  TLSRFDDFDKYAKVPDEYVQPEPVAY  173



>ref|XP_006287158.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
 gb|EOA20056.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
Length=619

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  430  MPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEW  609
            MPV+PDT+ TLGYCFIE+NTPQEA+ AKEK+HGY+LDKSHIFAVNMFDD E+ M V +EW
Sbjct  1    MPVNPDTKMTLGYCFIEFNTPQEAQNAKEKSHGYKLDKSHIFAVNMFDDFERLMNVREEW  60

Query  610  APPETKVYTPRE  645
             PP+ + Y P E
Sbjct  61   EPPQARPYVPGE  72



>ref|XP_004301706.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Fragaria vesca subsp. vesca]
Length=221

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 91/153 (59%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  ETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVI  321
            ++ +ME++ A A +L I  S IDL+S   P    F          +E+    +  FG VI
Sbjct  4    DSATMEDMEAKADQLGIQFSSIDLNSSHPP---HFNFSECQEVFYDENGFIPNIEFGGVI  60

Query  322  VVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEA  501
            VV NLPVV  E  ++LE  +R ++ ++GVIKEDG  MPV+P TQ+TLG+CFIE+N+ +EA
Sbjct  61   VVSNLPVVEAEMAQELESEIRVVFSEVGVIKEDGFSMPVNPTTQETLGHCFIEFNSQEEA  120

Query  502  ELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVP  600
             LA+ K  GY+     + +V+++D       +P
Sbjct  121  ALARNKRDGYKFGDCKM-SVSLYDAFGSLAAIP  152



>ref|XP_008364498.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=227

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G G+VIVVDNLP+V     EKLE  +R+ + ++GVIK DG+ +P++P T ++LG CFIE+
Sbjct  56   GLGNVIVVDNLPIVDARMAEKLESEIRRAFSEVGVIKHDGVSVPLNPQTHESLGRCFIEF  115

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPET  624
            N+ QEAE A+EK  GY    +H  +V+++DD+++F+ + D     ET
Sbjct  116  NSRQEAEXAREKRDGYNF-HTHTLSVSLYDDLDRFVDILDVGTTIET  161



>ref|XP_010110499.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
 gb|EXC26717.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
Length=197

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +1

Query  175  AARLNIDLSEIDLDSIRLPPGEDFGIVSddgdl--eeedalefdTGFGSVIVVDNLPVVP  348
            A +L + LS +DL+S   P  ++   + ++ D+  +++  +  + GF +V+VVDNLP+V 
Sbjct  8    AEQLKLQLSSMDLNSDHFPIPQNLSAIREERDVFYDDDGLVLDNVGFDNVVVVDNLPLVV  67

Query  349  KEKFEK-LEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTH  525
            +E+  + LE  VR+I+G +GVIK+DG  MPV+P T +TLG+C+IE+ T QEAELA E   
Sbjct  68   REEVVRTLESDVREIFGAVGVIKKDGFSMPVNPQTLETLGHCYIEFTTRQEAELATENMD  127

Query  526  GYRLDKSHIFAVNMFDDIEKFMKVPDEW  609
            GY+  KS I +V ++DD+ +F+ +  E 
Sbjct  128  GYKYGKS-ILSVALYDDLHRFVGISPEL  154



>ref|XP_003060268.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55037.1| predicted protein [Micromonas pusilla CCMP1545]
Length=693

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 10/152 (7%)
 Frame = +1

Query  190  IDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKL  369
            ++  ++D+  I LPPG+D   V  D D    + ++ D+GFGSV+VVDNLP VPK K EKL
Sbjct  5    VEWDKVDVAKIALPPGDD-MGVVSDDDDVNVEEVKMDSGFGSVVVVDNLPKVPKAKHEKL  63

Query  370  EGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSH  549
                      IG + E GL MP D D   T G+ F+E+   QEA+ A+++T GY+LDK+H
Sbjct  64   --------ATIGTVAEGGLHMPADADGV-TKGFAFVEFLNSQEADAARQQTDGYKLDKAH  114

Query  550  IFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +F V+ FDD  K+  VPD++  P+ K Y  RE
Sbjct  115  VFKVSRFDDFAKYDAVPDQYEEPKPKPYVARE  146



>ref|XP_005852304.1| hypothetical protein CHLNCDRAFT_59481 [Chlorella variabilis]
 gb|EFN50617.1| hypothetical protein CHLNCDRAFT_59481 [Chlorella variabilis]
Length=285

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +1

Query  322  VVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEA  501
            VVDNLP VP EK++KL  ++ KI+G  G I+E GL+ P D  T+++ GY F+EY   ++A
Sbjct  32   VVDNLPAVPAEKYDKLTAILTKIFGGSGRIREGGLFHPQDEATKRSKGYAFVEYENAEQA  91

Query  502  ELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
              A+   +GY+LDK+H FA  +FD+ ++  KVPDE+  PE + Y P E
Sbjct  92   RAAQAALNGYQLDKAHKFAATLFDEADRLAKVPDEYGGPEERTYAPAE  139



>ref|XP_004341005.1| eukaryotic translation initiation factor family protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR18941.1| eukaryotic translation initiation factor family protein [Acanthamoeba 
castellanii str. Neff]
Length=687

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = +1

Query  307  FGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQI--GVIKEDGLWMPVDPDTQKTLGYCFIE  480
            F S I+VDNLPVV KEKF+KL GVV KIY QI  G I E  ++MP D   Q T GY F+E
Sbjct  40   FASAIIVDNLPVVGKEKFDKLLGVVTKIYSQIPGGAIVE--VFMPTDEKGQ-TKGYAFVE  96

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            ++T + A  A ++T+GY+LD++HIF VN F+D + + KV D + P E   Y P+E
Sbjct  97   FSTVEAARNAVQQTNGYKLDRAHIFRVNFFEDFQVYDKVTDAFQPIEMPAYKPKE  151



>ref|XP_009045450.1| hypothetical protein LOTGIDRAFT_230249 [Lottia gigantea]
 gb|ESP03968.1| hypothetical protein LOTGIDRAFT_230249 [Lottia gigantea]
Length=703

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SV++VDN+P V  E+ EKL+ VV KI+ + G IK D  + PVD +   + GYCF+E+
Sbjct  63   GIDSVVIVDNVPQVGPERLEKLKNVVSKIFSKFGKIKSD--FYPVD-ENNVSKGYCFVEF  119

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A+ A +   GY+LDK H FAVN+F D EK+  VPDE  PPE + Y
Sbjct  120  TSPVHAQEAMKTADGYKLDKQHTFAVNLFSDFEKYSAVPDEIDPPEPRPY  169



>ref|XP_002595784.1| hypothetical protein BRAFLDRAFT_131352 [Branchiostoma floridae]
 gb|EEN51796.1| hypothetical protein BRAFLDRAFT_131352 [Branchiostoma floridae]
Length=697

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  E+ EKL+ V+RKI+ + G I  +  + P + D  KT GY F+EY
Sbjct  67   GIDSVIVVDNVPQVGPERLEKLQNVIRKIFSKFGKIVSE--YFP-EGDNGKTKGYIFLEY  123

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            ++P  A  A    +GY+LDK H FAVN+F D +K+  +P+EW PPE + Y
Sbjct  124  SSPANALEAVRNCNGYKLDKQHTFAVNLFSDFDKYSGIPEEWEPPEQQPY  173



>ref|XP_002958408.1| eukaryotic translation initiation factor 3b [Volvox carteri f. 
nagariensis]
 gb|EFJ40558.1| eukaryotic translation initiation factor 3b [Volvox carteri f. 
nagariensis]
Length=699

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 94/146 (64%), Gaps = 4/146 (3%)
 Frame = +1

Query  205  IDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKLEGVVR  384
             +L+ + LP G+D GI SDD D++EED     +GFGS +V+ NLP  P+EK+EKL  VVR
Sbjct  10   FELEELILPSGDDMGIRSDDDDIKEEDIQTQ-SGFGSCLVIQNLPKAPEEKYEKLMTVVR  68

Query  385  KIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ--EAELAKEK-THGYRLDKSHIF  555
             I   +G ++E+G++MP+D  T+ T G+ F+E    +  +A L  E+  +GY+LDK+H  
Sbjct  69   TIASNMGDVRENGIYMPLDDATKLTKGFAFVELTRKEDVDAALLNERFANGYQLDKNHKL  128

Query  556  AVNMFDDIEKFMKVPDEWAPPETKVY  633
            +   FDD +K+ KVP E+ P E   Y
Sbjct  129  SFCRFDDFDKYAKVPYEYVPLEQVPY  154



>ref|XP_005108064.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Aplysia californica]
Length=701

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = +1

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            SVI+VD +P V K++ EKL+ V++K++ + G I E  ++ PVD +   T GY F+E+++P
Sbjct  65   SVIIVDCIPKVGKDRLEKLKNVIKKLFSKFGSIVE--MYYPVDEEGT-TKGYMFLEFSSP  121

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Q A  A + T+GY+LDK H+F VN F D EK+  +PDEW PP+ K Y
Sbjct  122  QNAHEAVKMTNGYKLDKQHVFKVNHFSDFEKYTDIPDEWEPPDPKPY  168



>ref|XP_002736509.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Saccoglossus kowalevskii]
Length=696

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 16/116 (14%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVI------KEDGLWMPVDPDTQKTLG  465
            G  SVIVVDN+P V  E+ EKL+ V+RKI+ + G I      K+DG          KT G
Sbjct  67   GIDSVIVVDNIPQVGTERLEKLQNVIRKIFSKYGKIITEHYPKQDG----------KTKG  116

Query  466  YCFIEYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y F+EY +P  A  A +   GY+LDK H F VN+F D EK+  +PDEW PP+ + Y
Sbjct  117  YIFLEYTSPANASDAVKNLSGYKLDKQHTFVVNLFTDFEKYASIPDEWEPPQKQPY  172



>gb|ELT99648.1| hypothetical protein CAPTEDRAFT_163351 [Capitella teleta]
Length=704

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  E+ +KL+ V+RKI+ + G I+ +    P + D  KT GY F+EY
Sbjct  64   GIESVIVVDNVPCVGAERLDKLQNVIRKIFNKFGKIQTEHF--PKESDG-KTKGYIFLEY  120

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P+EA  A + T+GY+LD+ H F VNMF D EK+  V +EW  PE + Y
Sbjct  121  QSPEEALEAVKNTNGYKLDRQHTFIVNMFSDFEKYAAVTEEWEQPEIQPY  170



>gb|KDD76724.1| eukaryotic translation initiation factor eIF2A [Helicosporidium 
sp. ATCC 50920]
Length=715

 Score =   101 bits (251),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 54/140 (39%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = +1

Query  208  DLDSIRLPPGEDFGIVSddgdleeedalefdTGFGSVIVVDNLPVVPKEKFEKLEGVVRK  387
            +++ + LP G+D GI   + + EEE  ++ ++GFG+VI++D LP    +K+ KL  +++K
Sbjct  26   NVEDVMLPEGDDMGI-PSEDEAEEEQEIQSESGFGNVILIDGLPQAGADKYGKLTAILQK  84

Query  388  IYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLDKSHIFAVNM  567
            I G +G ++E G+  PVD    ++ GY  +EY +P+ A  A     GY LDK+H F   +
Sbjct  85   IAGGVGPVREGGVTHPVDSANGQSKGYAMVEYESPEAARAAAAALDGYALDKNHRFTAVL  144

Query  568  FDDIEKFMKVPDEWAPPETK  627
            FD+ E+   VPDEW PPE +
Sbjct  145  FDEAERVAAVPDEWTPPEAR  164



>ref|XP_005829927.1| translation initiation factor 3, subunit B [Guillardia theta 
CCMP2712]
 gb|EKX42947.1| translation initiation factor 3, subunit B [Guillardia theta 
CCMP2712]
Length=662

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 4/114 (4%)
 Frame = +1

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDG----LWMPVDPDTQKTLGYCFIE  480
            +VIVVDNLPVVP EK EKL G++ K+Y +IG I EDG    L MP+D +   + G+ FIE
Sbjct  27   NVIVVDNLPVVPPEKVEKLAGILLKLYSKIGAIVEDGDYNGLHMPMDDEKGMSKGFAFIE  86

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPR  642
            +   + A +A E+T G++LDK+H+F+V  F +  + + VPD++  P+   Y  R
Sbjct  87   FVDKKSAVMAVEQTDGHKLDKNHVFSVCRFPEFHRIVNVPDQYEAPQPPQYKER  140



>ref|XP_011398773.1| Eukaryotic translation initiation factor 3 subunit B [Auxenochlorella 
protothecoides]
 gb|KFM25877.1| Eukaryotic translation initiation factor 3 subunit B [Auxenochlorella 
protothecoides]
Length=688

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +1

Query  322  VVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEA  501
            VVD +P V +EK++KL  ++ KI    G I+E+GLW PVD  T  + G  F+EY TP +A
Sbjct  35   VVDGVPKVSQEKYQKLTSILTKILSGPGHIRENGLWHPVDEATGLSKGCVFVEYETPDQA  94

Query  502  ELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
              A+   HGY LDK+H F+  ++D+ E+   VPDE+  PE +   P E
Sbjct  95   RAAQAALHGYALDKAHKFSATLYDEAERLAAVPDEYVAPEPRDAPPPE  142



>gb|KHN36468.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=92

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 70/143 (49%), Gaps = 53/143 (37%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            M + M M+EI+ TA  L +DLS +DLD+IRLPPGE  GIV      ++            
Sbjct  1    MVDVMVMKEIKDTALHLGVDLSTLDLDAIRLPPGEKCGIVRSLRSSKKWSL---------  51

Query  316  VIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQ  495
                                              DGLWMPVDP+T+KTLG          
Sbjct  52   ----------------------------------DGLWMPVDPETEKTLG----------  67

Query  496  EAELAKEKTHGYRLDKSHIFAVN  564
            EAELAKEKTHGY+LD++HIF+V 
Sbjct  68   EAELAKEKTHGYKLDRAHIFSVQ  90



>ref|XP_003729782.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform 1 [Strongylocentrotus purpuratus]
Length=713

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ--KTLGYCFI  477
            G  SVIV+DN+P V  E+  KL+ V+RK+  + G I  +       P+++  KT GY F+
Sbjct  67   GIDSVIVIDNIPQVGTERLPKLKNVIRKVCSKYGEISTEHY-----PESEDGKTKGYVFV  121

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            EY +P+ A  A ++  GY+LDK H FAVN+  D +KFM +PDEW  PE + Y
Sbjct  122  EYKSPENAIEAAKQLSGYKLDKQHTFAVNLITDFDKFMNLPDEWTSPEKQPY  173



>ref|XP_796053.3| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform 2 [Strongylocentrotus purpuratus]
Length=703

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ--KTLGYCFI  477
            G  SVIV+DN+P V  E+  KL+ V+RK+  + G I  +       P+++  KT GY F+
Sbjct  67   GIDSVIVIDNIPQVGTERLPKLKNVIRKVCSKYGEISTEHY-----PESEDGKTKGYVFV  121

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            EY +P+ A  A ++  GY+LDK H FAVN+  D +KFM +PDEW  PE + Y
Sbjct  122  EYKSPENAIEAAKQLSGYKLDKQHTFAVNLITDFDKFMNLPDEWTSPEKQPY  173



>ref|XP_001652847.1| AAEL007718-PA [Aedes aegypti]
 sp|Q0IEY3.1|EIF3B_AEDAE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Aedes aegypti]
 gb|EAT40558.1| AAEL007718-PA [Aedes aegypti]
Length=688

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  +VIVVDN+PVV   +F KL+GV+ K++   G I    +  P D D + T GY FIE+
Sbjct  54   GVENVIVVDNIPVVGPARFHKLQGVLEKLFKTAGTIV--NIHYPKD-DEENTRGYAFIEF  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
              P+ AE A +  + YRLDKSH   VN+F D +K+  +P EW+PPE + Y
Sbjct  111  KNPEMAEEAVKAFNNYRLDKSHTLLVNLFSDFQKYSDIPKEWSPPEPQPY  160



>ref|XP_011348022.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Cerapachys biroi]
 gb|EZA62630.1| Eukaryotic translation initiation factor 3 subunit B [Cerapachys 
biroi]
Length=703

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  +K EKL+ V+ K+ G+ G I     + PV+    KT GY F+EY
Sbjct  61   GVESVIVVDNVPRVEPDKLEKLQSVINKVLGKFGTIVNQ--YYPVNETDGKTKGYIFLEY  118

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPP  618
            N    A  A + T+ Y++DKSH F VN+F D +KF  +P++W PP
Sbjct  119  NNHLNALTAVKSTNNYKIDKSHTFKVNLFTDFKKFEDIPEDWEPP  163



>ref|XP_001843846.1| eukaryotic translation initiation factor 3 subunit 9 [Culex quinquefasciatus]
 sp|B0W562.1|EIF3B_CULQU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Culex quinquefasciatus]
 gb|EDS34809.1| eukaryotic translation initiation factor 3 subunit 9 [Culex quinquefasciatus]
Length=688

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  +VIVVDN+PVV   +F KL+GV+ KI+   G I    +  P D D + T G+ FIE+
Sbjct  54   GVENVIVVDNIPVVGPARFPKLQGVLEKIFKNAGTIV--NIHYPKD-DEENTKGFAFIEF  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
              P+ AE A +  + YRLDKSH   VN+F D +K+  +P +W+PPE++ Y
Sbjct  111  KNPEMAEEAVKAFNNYRLDKSHTLLVNLFSDFQKYSDIPKDWSPPESQPY  160



>ref|XP_007247954.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Astyanax mexicanus]
Length=587

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  +       P+   KT GY F+E
Sbjct  50   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNEFY-----PEADGKTKGYIFLE  104

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y+ P  A  A +   GY+LDK H F VN+F D +K+M + DEW PPE + +
Sbjct  105  YSVPSHAHEAVKNADGYKLDKQHTFRVNLFTDFDKYMSISDEWEPPEKQPF  155



>ref|XP_011432969.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Crassostrea gigas]
 gb|EKC30771.1| Eukaryotic translation initiation factor 3 subunit B [Crassostrea 
gigas]
Length=701

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 71/110 (65%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  +++VVDN+P V  ++ EKL+ V+RKI+ + G I  +  + PV    +KT GY FIEY
Sbjct  64   GIDNIVVVDNVPQVGPDRQEKLKNVIRKIFEKFGKINRE--FFPVT--NEKTKGYVFIEY  119

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +  +GY+LDK H   VN+F D +K+ K+P+EW PP+ K Y
Sbjct  120  TSPLHASEAVKMANGYKLDKQHTLQVNIFSDFDKYEKIPEEWEPPKPKPY  169



>ref|XP_011270842.1| hypothetical protein CAOG_09132 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97726.1| hypothetical protein CAOG_009132 [Capsaspora owczarzaki ATCC 
30864]
Length=657

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIE  480
             G   VIVVDN+P V   K +KL  V++K++   G ++E+G+ MP D  T  T G+ F+E
Sbjct  22   NGADCVIVVDNVPKVDAAKLDKLMLVLKKVFAGFGELQENGIHMPRDAATGMTKGFAFLE  81

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            + T  +A+ A +K  GYRLDK H F      D E++ KV D + PP+ + Y+ RE
Sbjct  82   FKTAPQAQQAAKKLQGYRLDKMHEFETCTLADFERYEKVSDSYQPPKPEDYSERE  136



>ref|XP_011066137.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Acromyrmex echinatior]
 gb|EGI58199.1| Eukaryotic translation initiation factor 3 subunit B [Acromyrmex 
echinatior]
Length=703

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  +K EKL+ V+ K+ G+ G I     + P++    KT GY F+EY
Sbjct  61   GVESVIVVDNVPRVEPDKLEKLQSVINKVLGKFGTIVNQ--YYPMNETDGKTKGYIFLEY  118

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            N    A  A + T+ Y++DKSH F VN+F D +KF  +P+ W PP+ + +
Sbjct  119  NNHLNALTAVKSTNNYKIDKSHTFKVNLFTDFKKFEDIPENWEPPKAQPF  168



>gb|KHN02147.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=82

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +1

Query  136  MAETMSMEEIRATAARLNIDLSEIDLDSIRLPPGEDFGIVSddgdleeedalefdTGFGS  315
            MA  M M+EI+ T  RL +DL  +DLD+IRLPPGED  I SDD  +  E+ LEF+ GFG+
Sbjct  1    MANVMVMKEIKGTVLRLGVDLFTLDLDAIRLPPGEDCSIASDDEVVYREENLEFEPGFGN  60

Query  316  VIVVDNLPVVPKEKFEKLEGVV  381
            +I+VDNL VVP+EKFEKLEGVV
Sbjct  61   IIIVDNLLVVPREKFEKLEGVV  82



>gb|KDQ19939.1| hypothetical protein BOTBODRAFT_152536 [Botryobasidium botryosum 
FD-172 SS1]
Length=735

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 1/116 (1%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIG-VIKEDGLWMPVDPDTQKTLGYCFI  477
             GF +V+VVDNLP+V   K ++L  V+RK + + G   KEDGL+MP D    K+ GY F+
Sbjct  29   NGFDTVLVVDNLPIVDAAKKDRLLQVIRKNFSKKGPTPKEDGLFMPWDDAKNKSKGYLFV  88

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            E+ +  EA  A +   G  LDK H   VN F DIEKF  + + +  PE + + PRE
Sbjct  89   EFESADEANYAMDAMQGVALDKEHKLVVNKFTDIEKFANMDETYVEPELEEFKPRE  144



>emb|CCG80846.1| Eukaryotic translation initiation factor 3 subunit B [Taphrina 
deformans PYCC 5710]
Length=725

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTL--GYCFI  477
            GF ++++VD  P VP+ K   L  V+ K+  Q GV+KEDG+ MP++   + ++  GY F+
Sbjct  26   GFDNIVLVDGCPKVPESKKAALLRVLNKLCSQYGVLKEDGIIMPMEEKKEGSISKGYMFV  85

Query  478  EYNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EY TP +A  A +  +G +LDK+H    N+F D++K+  + DE+A P+ + YT +E
Sbjct  86   EYETPAQAMNAVKSLNGKKLDKAHTLMANLFTDVDKYANIDDEFAAPDAEDYTEQE  141



>emb|CBJ29502.1| eukaryotic initiation factor 3b [Ectocarpus siliculosus]
Length=701

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 0/112 (0%)
 Frame = +1

Query  307  FGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYN  486
              + +VV NLP V + K EKL GVVRK++ ++G I +DGL  P D  T  T G+ F+ + 
Sbjct  44   LSTAVVVSNLPQVVEAKHEKLGGVVRKVFSKMGTIADDGLTHPFDKTTGLTKGFAFVNFL  103

Query  487  TPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPR  642
             PQ+A+ A    +G++LDKSH+  V  F+ + +   +P+E+  PE K + PR
Sbjct  104  NPQDAKQAAATLNGWQLDKSHLIKVYPFEQLARLRSLPEEYESPEPKPFKPR  155



>ref|XP_006730091.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Leptonychotes weddellii]
Length=275

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  71   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  126

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  127  ASPGHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  176



>ref|XP_011176217.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Solenopsis invicta]
 gb|EFZ21042.1| hypothetical protein SINV_07140 [Solenopsis invicta]
Length=703

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  +K EKL+ V+ K+ G+ G I     + P++    KT GY F+EY
Sbjct  61   GVESVIVVDNVPRVEPDKLEKLQSVINKVLGKFGTIVNQ--YYPMNESDGKTKGYIFLEY  118

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
                 A  A + T+ Y++DKSH F VN+F D +KF  +P++W PP+ +
Sbjct  119  TNHLNALTAVKSTNNYKIDKSHTFKVNLFTDFKKFEDIPEDWEPPKAQ  166



>ref|NP_001277022.1| eukaryotic translation initiation factor 3 subunit B [Danio rerio]
Length=681

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  +       PD   KT GY F+E
Sbjct  50   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNEFY-----PDADGKTKGYIFLE  104

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y+ P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  105  YSAPSHAHEAVKNADGYKLDKQHTFRVNLFTDFDKYMSICDEWEAPEKQPF  155



>ref|XP_008367810.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=155

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  361  EKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTPQEAELAKEKTHGYRLD  540
            EKLE  +R+ + ++GVIK DG+ +P++P T ++LG CFIE+N+ QEAE A+EK  GY   
Sbjct  3    EKLESEIRRAFSEVGVIKHDGVSVPLNPQTHESLGRCFIEFNSRQEAEXAREKRDGYNF-  61

Query  541  KSHIFAVNMFDDIEKFMKVPDEWAPPET  624
             +H  +V+++DD+++F+ + D     ET
Sbjct  62   HTHTLSVSLYDDLDRFVDILDVGTTIET  89



>ref|XP_002092076.1| GE11867 [Drosophila yakuba]
 sp|B4P5F7.1|EIF3B_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Drosophila yakuba]
 gb|EDW91788.1| GE11867 [Drosophila yakuba]
Length=690

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SV+VVDN+P V  E+ +KL+ V+ K++   G I    +  PVD D  KT GY F+EY
Sbjct  54   GVESVVVVDNIPKVEPERLDKLKSVINKLFSNYGDIV--NVVYPVDEDG-KTKGYAFMEY  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
                +AE A +K + +RLDK+H FAVN+F D +K+  +P++W PP  + +
Sbjct  111  KQASQAEEAVKKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTF  160



>ref|XP_010863060.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Esox lucius]
Length=690

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  E+ EKL+ V+ KI+ + G I  +  + P  PD   T GY F+EY
Sbjct  51   GIDSVIVVDNVPQVGPERLEKLKNVIHKIFSKFGKITNE--FYPEGPDGS-TKGYIFLEY  107

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
              P +A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  108  GAPTQALDAVKNADGYKLDKQHTFRVNVFTDFDKYMNICDEWETPEKQPF  157



>gb|AAP21880.1| unknown [Homo sapiens]
Length=385

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P +    KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYPEE--DGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>gb|EWM25691.1| eukaryotic translation initiation factor 3 [Nannochloropsis gaditana]
Length=773

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +1

Query  307  FGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYN  486
            F + IVVDNLP V +EK+++L   VRKIY Q+G I EDGL MP+D  T  TLG+ FI + 
Sbjct  74   FSTAIVVDNLPKVSREKYDRLMVFVRKIYDQVGKIAEDGLQMPLDEATGMTLGFAFINFL  133

Query  487  TPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAP  615
            T   AE A   T+ + LDK+H   VN + D+ K    P+ + P
Sbjct  134  TRDSAEKAIAATNNWNLDKAHALKVNSYVDLVKTTTHPETYTP  176



>ref|XP_010225423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like, partial [Tinamus guttatus]
Length=123

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  +  +   D    KT GY F+EY
Sbjct  15   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIINE-FYPEAD---GKTKGYIFLEY  70

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  71   MSPSHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWEIPEKQ  118



>ref|XP_011254633.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Camponotus floridanus]
 gb|EFN69461.1| Eukaryotic translation initiation factor 3 subunit B [Camponotus 
floridanus]
Length=702

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  S+IVVDN+P V  +K EKL+ V+ K+ G+ G I  +    P++ +  KT GY F+EY
Sbjct  60   GVESMIVVDNVPRVEPDKLEKLKSVINKVLGKFGTIVNEH--YPMNENDGKTKGYIFLEY  117

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            N    A  A + T+ Y++DKSH F VN+F D  K+  +P+ W PP+ + +
Sbjct  118  NNHLNALTAVKSTNNYKIDKSHTFKVNLFTDFNKYEDIPENWEPPKAQPF  167



>ref|XP_002049756.1| GJ20575 [Drosophila virilis]
 sp|B4LM71.1|EIF3B_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Drosophila virilis]
 gb|EDW60949.1| GJ20575 [Drosophila virilis]
Length=690

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SV+VVDN+P V   + EKL+ V+ K++ Q G I    +  PVD +  KT GY F+EY
Sbjct  54   GVESVVVVDNMPKVEPSRLEKLKSVINKLFSQCGEIV--NVVYPVDEEG-KTKGYAFMEY  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPP  618
             T  +AE A +K + +RLDK++ FAVN+F D +K+  +P++W PP
Sbjct  111  KTASQAEDAVKKLNNHRLDKNYTFAVNLFTDFQKYENIPEKWEPP  155



>ref|XP_001974524.1| GG21791 [Drosophila erecta]
 sp|B3NMI5.1|EIF3B_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Drosophila erecta]
 gb|EDV54924.1| GG21791 [Drosophila erecta]
Length=690

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SV+VVDN+P V  E+ +KL+ V+ K++   G I    +  PVD D  KT GY F+EY
Sbjct  54   GVESVVVVDNIPKVEPERLDKLKLVINKLFSNYGDIV--NVVYPVDEDG-KTKGYAFMEY  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
                +AE A +K + +RLDK+H FAVN+F D +K+  +P++W PP  + +
Sbjct  111  KQASQAEEAVKKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTF  160



>ref|XP_006637297.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Lepisosteus oculatus]
Length=682

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 6/109 (6%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  E+ EKL+ V+ KI+ + G I  +       P+ + KT GY F+E
Sbjct  50   GIDSVIVVDNVPQVGPERLEKLKNVIHKIFSRFGKITNEFY-----PEAEGKTKGYIFLE  104

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  105  YASPAHALEAVKNADGYKLDKQHTFRVNIFTDFDKYMNISDEWETPEKQ  153



>gb|KDR10090.1| Eukaryotic translation initiation factor 3 subunit B [Zootermopsis 
nevadensis]
Length=700

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVD +P V  E+ EKL  V+ KI+ + G I  +  + P + + Q T GY F+EY
Sbjct  60   GVESVIVVDGVPQVGPERLEKLTTVINKIFSKFGTIVNE--YYPTNENGQ-TKGYIFLEY  116

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYT  636
            + P+ A+ A +  + ++LD+ H F VN+F D +K+ +VPDEW PPE + Y 
Sbjct  117  SNPKHAQEAVKLANNHKLDRQHTFLVNLFTDFKKYEEVPDEWEPPEPQPYV  167



>gb|ELK09238.1| Eukaryotic translation initiation factor 3 subunit B [Pteropus 
alecto]
Length=666

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  179  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  234

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  235  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  282



>ref|XP_004672764.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Jaculus jaculus]
Length=812

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  180  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  235

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  236  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  285



>ref|XP_004705943.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Echinops telfairi]
Length=706

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  75   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTRGYIFLEY  130

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  131  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  180



>ref|XP_003416544.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Loxodonta africana]
Length=812

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ VV KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  180  GIDSVIVVDNVPQVGPDRLEKLKNVVHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  235

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  236  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  285



>ref|XP_004385981.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Trichechus manatus latirostris]
Length=810

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ VV KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  178  GIDSVIVVDNVPQVGPDRLEKLKNVVHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  233

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  234  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  283



>ref|XP_004629754.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Octodon degus]
Length=743

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  157  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  212

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  213  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  262



>ref|XP_004598208.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ochotona princeps]
Length=736

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  145  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  200

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  201  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  250



>ref|XP_005397937.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Chinchilla lanigera]
Length=791

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  159  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  214

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  215  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  264



>ref|XP_007939402.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Orycteropus afer afer]
Length=812

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  180  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  235

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  236  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  285



>ref|XP_005340894.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Ictidomys tridecemlineatus]
Length=721

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  89   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  144

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  145  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  194



>ref|XP_010329908.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Saimiri boliviensis boliviensis]
Length=911

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  279  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  334

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  335  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  384



>ref|XP_005766982.1| hypothetical protein EMIHUDRAFT_51173, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD14553.1| hypothetical protein EMIHUDRAFT_51173, partial [Emiliania huxleyi 
CCMP1516]
Length=594

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 67/115 (58%), Gaps = 8/115 (7%)
 Frame = +1

Query  301  TGFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIE  480
            T F   IVVD LPVVPKEK EKL  VV       G I EDGL +PVD     TLG+ FI+
Sbjct  8    TSFKQTIVVDGLPVVPKEKHEKLANVV-------GTIVEDGLELPVD-GAGATLGFAFIQ  59

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            +   +EA  A  K  GY+LDK+H F VN F+D  K+M + D+  P     Y PRE
Sbjct  60   FAANEEAAAAIRKADGYKLDKAHTFVVNSFEDYAKYMAISDQEQPFVPPPYVPRE  114



>ref|XP_003423811.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Nasonia vitripennis]
Length=704

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  S+IV+D +P V  ++ EKL+ V+ KIYG+ G I       P D +   T+GY F EY
Sbjct  54   GVDSIIVIDGVPKVEPKRLEKLQSVIEKIYGKFGTIVSKSY--PQDSNGM-TIGYVFFEY  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTP  639
            + P  A  A ++ + Y++DK H F VN+F D +K+  +P++W PPE + + P
Sbjct  111  SDPTSALNAVKQANNYKIDKVHTFKVNLFSDFKKYENIPEDWKPPEPQRFQP  162



>ref|XP_007379104.1| translation initiation factor eIF-3b [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN14187.1| translation initiation factor eIF-3b [Punctularia strigosozonata 
HHB-11173 SS5]
Length=742

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 70/115 (61%), Gaps = 1/115 (1%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGV-IKEDGLWMPVDPDTQKTLGYCFIE  480
            GF ++++VD +PV+ + K E+L   + K +G+ G  IK D +++P D    K+ GY FIE
Sbjct  30   GFDNILIVDGVPVIDESKRERLLTKIAKEFGRKGAPIKPDSIFLPWDEAKGKSKGYIFIE  89

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            + TP EA  A E   G+  D  H F+VN F D+EK+  + + +  PE + YTPRE
Sbjct  90   FPTPDEASFALEAMDGHPFDTKHTFSVNRFSDVEKYANMDETYVEPEKEEYTPRE  144



>ref|XP_011376839.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Pteropus vampyrus]
Length=665

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  33   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  88

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  89   ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  136



>ref|XP_003470101.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cavia porcellus]
Length=791

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  159  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  214

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  215  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  264



>ref|XP_008971434.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pan paniscus]
Length=726

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  87   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  142

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  143  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  190



>ref|XP_008048700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tarsius syrichta]
Length=660

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  28   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  83

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  84   ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  131



>ref|XP_002744483.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Callithrix jacchus]
Length=852

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  220  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  275

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  276  ASPAHAMDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  325



>gb|EPQ18395.1| Eukaryotic translation initiation factor 3 subunit B [Myotis 
brandtii]
Length=682

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 6/109 (6%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D       P+ + KT GY F+E
Sbjct  56   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY-----PEEEGKTKGYIFLE  110

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  111  YASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  159



>ref|XP_006765559.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Myotis davidii]
Length=743

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D       P+ + KT GY F+E
Sbjct  111  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY-----PEEEGKTKGYIFLE  165

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  166  YASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  216



>gb|EPY89345.1| hypothetical protein CB1_000114010 [Camelus ferus]
Length=1416

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  +T GY F+EY
Sbjct  34   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGRTKGYIFLEY  89

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  90   ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  137



>ref|XP_005883424.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Myotis brandtii]
Length=654

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 6/109 (6%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D       P+ + KT GY F+E
Sbjct  22   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY-----PEEEGKTKGYIFLE  76

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  77   YASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  125



>ref|XP_003496346.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Cricetulus griseus]
Length=801

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  169  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  224

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  225  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  274



>gb|EAL23952.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa 
[Homo sapiens]
 gb|EAW87238.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_b [Homo sapiens]
Length=775

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  143  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  198

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  199  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  248



>dbj|BAG62591.1| unnamed protein product [Homo sapiens]
Length=738

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  106  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  161

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  162  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  211



>ref|XP_007094914.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Panthera tigris altaica]
Length=664

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  32   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  87

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  88   ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  135



>ref|XP_011288807.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Felis catus]
Length=709

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  77   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  132

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  133  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  182



>ref|XP_003697518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform 1 [Apis florea]
Length=702

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 3/106 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIV+D +P V  E+ EKL+ V+ K+ G+ G I     + P + +   T GY F+EY
Sbjct  61   GVESVIVIDGVPQVEPERLEKLQSVISKVLGKFGTIVNQ--YYPKN-ENGYTKGYIFLEY  117

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPE  621
            N P  A  A +  + Y++DK H F VN+F D +KF ++PDEW PP+
Sbjct  118  NNPLNALAAAQSVNNYKIDKQHTFKVNLFTDFKKFEEIPDEWEPPK  163



>ref|XP_004440982.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ceratotherium simum simum]
Length=720

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  88   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  143

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  144  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  191



>ref|XP_393588.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform 1 [Apis mellifera]
Length=702

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 3/106 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIV+D +P V  E+ EKL+ V+ K+ G+ G I     + P + +   T GY F+EY
Sbjct  61   GVESVIVIDGVPQVEPERLEKLQSVISKVLGKFGTIVNQ--YYPKN-ENGYTKGYIFLEY  117

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPE  621
            N P  A  A +  + Y++DK H F VN+F D +KF ++PDEW PP+
Sbjct  118  NNPLNALAAAQSVNNYKIDKQHTFKVNLFTDFKKFEEIPDEWEPPK  163



>ref|XP_002155584.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Hydra vulgaris]
Length=694

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +1

Query  313  SVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEYNTP  492
            +VI+VDN+P+V  ++ EKL+ ++ K++   G I  D  + P   +  KT GY F+E+   
Sbjct  65   TVIIVDNVPIVGPDRLEKLKSMIHKVFSSFGTIVND--YYP--EENGKTKGYIFLEFPKA  120

Query  493  QEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYT  636
            ++A  A +  +GYRLDK+H FAVN F+D EK+  +  +W PPE +V+ 
Sbjct  121  EDAANAIKTANGYRLDKNHTFAVNSFNDFEKYKDISTDWVPPEKRVFN  168



>ref|XP_006108329.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Myotis lucifugus]
Length=700

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D       P+ + KT GY F+E
Sbjct  68   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFY-----PEEEGKTKGYIFLE  122

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  123  YASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  173



>ref|XP_006167965.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tupaia chinensis]
Length=791

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  159  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  214

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  215  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  264



>gb|ERE76540.1| eukaryotic translation initiation factor 3 subunit B [Cricetulus 
griseus]
Length=801

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  169  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  224

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  225  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  274



>ref|XP_004688115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Condylura cristata]
Length=789

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  157  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  212

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  213  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  262



>ref|XP_010364964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Rhinopithecus roxellana]
Length=814

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_005368038.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Microtus ochrogaster]
Length=802

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  170  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  225

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  226  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  275



>ref|XP_008564978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Galeopterus variegatus]
Length=748

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  116  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  171

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  172  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  221



>ref|XP_005615263.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3, subunit B [Equus caballus]
Length=742

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  110  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  165

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  166  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  215



>ref|XP_006915964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Pteropus alecto]
Length=684

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  52   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  107

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  108  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  157



>ref|XP_005549077.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Macaca fascicularis]
Length=775

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  143  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  198

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  199  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  248



>ref|XP_003697519.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform 2 [Apis florea]
Length=695

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 3/106 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIV+D +P V  E+ EKL+ V+ K+ G+ G I     + P + +   T GY F+EY
Sbjct  61   GVESVIVIDGVPQVEPERLEKLQSVISKVLGKFGTIVNQ--YYPKN-ENGYTKGYIFLEY  117

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPE  621
            N P  A  A +  + Y++DK H F VN+F D +KF ++PDEW PP+
Sbjct  118  NNPLNALAAAQSVNNYKIDKQHTFKVNLFTDFKKFEEIPDEWEPPK  163



>ref|XP_004394188.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Odobenus rosmarus divergens]
Length=785

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  153  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  208

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  209  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  258



>ref|NP_598677.1| eukaryotic translation initiation factor 3 subunit B [Mus musculus]
 sp|Q8JZQ9.1|EIF3B_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=eIF-3-eta; AltName: 
Full=eIF3 p116 [Mus musculus]
 gb|AAH31704.1| Eukaryotic translation initiation factor 3, subunit B [Mus musculus]
 dbj|BAC28445.1| unnamed protein product [Mus musculus]
 dbj|BAE39671.1| unnamed protein product [Mus musculus]
 dbj|BAE42128.1| unnamed protein product [Mus musculus]
 gb|EDL19120.1| eukaryotic translation initiation factor 3, subunit 9 (eta) [Mus 
musculus]
Length=803

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  171  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  226

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  227  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  276



>gb|ELK28992.1| Eukaryotic translation initiation factor 3 subunit B [Myotis 
davidii]
Length=518

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQ-KTLGYCFIE  480
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D       P+ + KT GY F+E
Sbjct  96   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND-----FYPEEEGKTKGYIFLE  150

Query  481  YNTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
            Y +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  151  YASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  201



>gb|ETN66698.1| eukaryotic translation initiation factor 3 subunit 9 [Anopheles 
darlingi]
Length=689

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 3/110 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  +VIVVDN+PVV  ++F KL+G++ KI+   G I    ++ P D +   T GY FIEY
Sbjct  52   GVENVIVVDNIPVVAADRFPKLKGIMEKIFKNAGTIV--NVYYPKDEE-DNTKGYAFIEY  108

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
               + AE A +  + YRLDK +   VN F D +K+  +P EW+PPE + Y
Sbjct  109  KNAESAEEAVKTLNNYRLDKHYTLLVNRFSDFQKYSDIPKEWSPPEPQPY  158



>ref|XP_005080033.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Mesocricetus auratus]
Length=800

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  168  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  223

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  224  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  273



>ref|XP_536894.3| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform 1 [Canis lupus familiaris]
Length=813

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  181  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  236

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  237  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  286



>dbj|BAG63448.1| unnamed protein product [Homo sapiens]
Length=661

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  29   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  84

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  85   ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  132



>ref|XP_008519592.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Equus przewalskii]
Length=684

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  52   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  107

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  108  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  155



>ref|NP_003742.2| eukaryotic translation initiation factor 3 subunit B [Homo sapiens]
 ref|NP_001032360.1| eukaryotic translation initiation factor 3 subunit B [Homo sapiens]
 sp|P55884.3|EIF3B_HUMAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=Prt1 homolog; Short=hPrt1; 
AltName: Full=eIF-3-eta; AltName: Full=eIF3 p110; AltName: 
Full=eIF3 p116 [Homo sapiens]
 gb|EAL23951.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa 
[Homo sapiens]
 gb|EAW87237.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
 gb|EAW87240.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
 gb|EAW87241.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
Length=814

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_009200773.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Papio anubis]
Length=806

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_006450238.1| hypothetical protein CICLE_v100076092mg, partial [Citrus clementina]
 gb|ESR63478.1| hypothetical protein CICLE_v100076092mg, partial [Citrus clementina]
Length=592

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +1

Query  496  EAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVYTPRE  645
            EAELAKEKT+GY+LD++HIFAVNMFDD +KFMKVPDEWAPPE K YTP E
Sbjct  1    EAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGE  50



>ref|XP_001086876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Macaca mulatta]
Length=814

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_008696680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ursus maritimus]
Length=660

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  28   GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  83

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  84   ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  131



>ref|XP_005549076.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Macaca fascicularis]
Length=814

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>gb|KHN29644.1| Eukaryotic translation initiation factor 3 subunit B, partial 
[Glycine soja]
Length=366

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 7/65 (11%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGV-IKEDGLWMPVDPDTQKTLGYCFIE  480
            GFG +IVV      P  KFEKLEGV+RKIY QIG+ I+EDG WMPV   T KTLGYCFIE
Sbjct  16   GFGHIIVV------PPYKFEKLEGVIRKIYCQIGLTIREDGFWMPVSHVTDKTLGYCFIE  69

Query  481  YNTPQ  495
            YNTPQ
Sbjct  70   YNTPQ  74



>ref|XP_006990812.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Peromyscus maniculatus bairdii]
Length=801

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  169  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  224

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  225  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  274



>ref|NP_001026810.1| eukaryotic translation initiation factor 3 subunit B [Rattus 
norvegicus]
 sp|Q4G061.1|EIF3B_RAT RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=eIF-3-eta [Rattus 
norvegicus]
 gb|AAH98728.1| Eukaryotic translation initiation factor 3, subunit 9 (eta) [Rattus 
norvegicus]
 gb|EDL89734.1| eukaryotic translation initiation factor 3, subunit 9 (eta) [Rattus 
norvegicus]
Length=797

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  165  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  220

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  221  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  270



>gb|AAC99479.1| eukaryotic translation initiation factor [Homo sapiens]
 gb|AAH01173.1| EIF3B protein [Homo sapiens]
 gb|AAI10866.1| Eukaryotic translation initiation factor 3, subunit B [Homo sapiens]
Length=814

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_003278760.2| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Nomascus leucogenys]
Length=882

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_002006089.1| GI20840 [Drosophila mojavensis]
 sp|B4KNN9.1|EIF3B_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9 [Drosophila mojavensis]
 gb|EDW10024.1| GI20840 [Drosophila mojavensis]
Length=690

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SV+VVDN+P V   + EKL+ V+ K++ Q G I    +  PVD +  KT GY F+E+
Sbjct  54   GVESVVVVDNMPKVEPSRLEKLKSVINKLFSQCGEIV--NVVYPVDEEG-KTKGYAFMEF  110

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPP  618
             T  +AE A +K + +RLDK++ FAVN+F D +K+  +P++W PP
Sbjct  111  KTASQAEDAVKKLNNHRLDKNYTFAVNLFTDFQKYENIPEKWEPP  155



>ref|XP_010641158.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Fukomys damarensis]
Length=752

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  120  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  175

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  176  VSPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  225



>ref|XP_003702862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Megachile rotundata]
Length=702

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 3/106 (3%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIV+D +P V  E+ EKL+ V+ K+ G+ G I     + P + +   T GY F+EY
Sbjct  61   GVESVIVIDGVPQVEPERLEKLQSVISKVLGKFGTIVNQ--YYPKN-ENGYTKGYIFLEY  117

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPE  621
            N P  A  A +  + Y++DK H F VN+F D +KF ++PDEW PP+
Sbjct  118  NNPVNALAAAQSVNNYKIDKQHTFKVNLFTDFKKFEEIPDEWEPPK  163



>ref|XP_007631404.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Cricetulus griseus]
Length=768

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  136  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  191

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  192  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  241



>gb|AAH07175.1| Eif3b protein, partial [Mus musculus]
Length=641

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  9    GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIIND--YYP--EEDGKTKGYIFLEY  64

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETK  627
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE +
Sbjct  65   ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQ  112



>gb|EAW87239.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_c, partial [Homo sapiens]
Length=819

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_006859850.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Chrysochloris asiatica]
Length=810

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  178  GIDSVIVVDNVPQVGPDRLEKLKNVIYKIFSKFGKITND--YYP--EEDGKTKGYIFLEY  233

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  234  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  283



>ref|XP_004776427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Mustela putorius furo]
Length=778

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  146  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYTFLEY  201

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  202  ASPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  251



>gb|AAB42010.1| Prt1 homolog [Homo sapiens]
Length=873

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



>ref|XP_004617310.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Sorex araneus]
Length=766

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 66/110 (60%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  134  GIDSVIVVDNVPQVGPDRMEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  189

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
              P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  190  AAPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  239



>ref|XP_009240769.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pongo abelii]
Length=879

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  188  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  243

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  244  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  293



>ref|XP_003318263.2| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pan troglodytes]
Length=873

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +1

Query  304  GFGSVIVVDNLPVVPKEKFEKLEGVVRKIYGQIGVIKEDGLWMPVDPDTQKTLGYCFIEY  483
            G  SVIVVDN+P V  ++ EKL+ V+ KI+ + G I  D  + P   +  KT GY F+EY
Sbjct  182  GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITND--FYP--EEDGKTKGYIFLEY  237

Query  484  NTPQEAELAKEKTHGYRLDKSHIFAVNMFDDIEKFMKVPDEWAPPETKVY  633
             +P  A  A +   GY+LDK H F VN+F D +K+M + DEW  PE + +
Sbjct  238  ASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPF  287



Lambda      K        H        a         alpha
   0.316    0.135    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000