BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030P22

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               278   3e-87   Nicotiana sylvestris
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               276   2e-86   Nicotiana tomentosiformis
dbj|BAC53892.1|  cytochrome P450                                        271   3e-84   Petunia x hybrida [garden petunia]
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               270   8e-84   Solanum tuberosum [potatoes]
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               263   4e-81   Solanum tuberosum [potatoes]
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               260   4e-80   Solanum lycopersicum
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               254   6e-78   Prunus mume [ume]
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               253   3e-77   Solanum tuberosum [potatoes]
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               251   2e-76   Nicotiana tomentosiformis
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               251   2e-76   
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               250   3e-76   Nicotiana sylvestris
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               249   7e-76   Solanum tuberosum [potatoes]
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               249   1e-75   Solanum lycopersicum
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               243   1e-73   Solanum tuberosum [potatoes]
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    243   2e-73   Vitis vinifera
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             243   2e-73   Populus trichocarpa [western balsam poplar]
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    243   2e-73   Solanum melongena [aubergine]
emb|CAN77399.1|  hypothetical protein VITISV_015277                     242   3e-73   Vitis vinifera
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               242   4e-73   
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               241   6e-73   Populus euphratica
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               241   7e-73   Sesamum indicum [beniseed]
gb|AGT03776.1|  CYP76 hydroxylase                                       241   1e-72   Withania somnifera [ashwagandha]
emb|CBI30226.3|  unnamed protein product                                244   2e-72   Vitis vinifera
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             239   5e-72   Citrus clementina [clementine]
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               239   7e-72   Pyrus x bretschneideri [bai li]
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               239   7e-72   Pyrus x bretschneideri [bai li]
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   239   8e-72   Citrus sinensis [apfelsine]
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               237   2e-71   
emb|CDP15344.1|  unnamed protein product                                230   5e-71   Coffea canephora [robusta coffee]
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    236   6e-71   Nicotiana sylvestris
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    236   7e-71   Nicotiana sylvestris
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             236   1e-70   
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               234   6e-70   Nicotiana tomentosiformis
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               234   7e-70   Prunus mume [ume]
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               233   1e-69   Solanum lycopersicum
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               233   2e-69   Vitis vinifera
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               232   9e-69   Sesamum indicum [beniseed]
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               230   1e-68   Nicotiana tomentosiformis
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               229   3e-68   Fragaria vesca subsp. vesca
ref|XP_010112510.1|  Cytochrome P450 76A2                               228   7e-68   
ref|XP_007027589.1|  Cytochrome P450 76A2                               229   2e-67   
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               227   3e-67   Fragaria vesca subsp. vesca
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               226   7e-67   Nicotiana sylvestris
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         225   1e-66   Jatropha curcas
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               225   1e-66   Solanum lycopersicum
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               224   4e-66   Eucalyptus grandis [rose gum]
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                223   7e-66   Erythranthe guttata [common monkey flower]
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               223   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               223   1e-65   Eucalyptus grandis [rose gum]
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               223   1e-65   Nicotiana sylvestris
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               222   2e-65   Eucalyptus grandis [rose gum]
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    222   2e-65   Vitis vinifera
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               221   5e-65   Glycine max [soybeans]
gb|KHN18720.1|  Cytochrome P450 76A2                                    220   2e-64   Glycine soja [wild soybean]
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               216   3e-63   Cicer arietinum [garbanzo]
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               216   3e-63   Eucalyptus grandis [rose gum]
emb|CBI30225.3|  unnamed protein product                                223   3e-63   Vitis vinifera
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     215   5e-63   Eucalyptus grandis [rose gum]
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             215   1e-62   Phaseolus vulgaris [French bean]
gb|KEH24104.1|  cytochrome P450 family protein                          213   4e-62   Medicago truncatula
emb|CAN77400.1|  hypothetical protein VITISV_015278                     211   1e-61   Vitis vinifera
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               212   2e-61   Solanum tuberosum [potatoes]
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                     209   4e-61   Eucalyptus grandis [rose gum]
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               210   6e-61   Eucalyptus grandis [rose gum]
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     208   3e-60   Eucalyptus grandis [rose gum]
ref|XP_002528645.1|  cytochrome P450, putative                          206   2e-59   Ricinus communis
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    206   2e-59   Solanum lycopersicum
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               206   3e-59   
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     204   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               203   1e-58   Eucalyptus grandis [rose gum]
gb|KJB62266.1|  hypothetical protein B456_009G409000                    201   2e-57   Gossypium raimondii
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             201   2e-57   Paeonia lactiflora [common garden peony]
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    201   3e-57   Vitis vinifera
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               200   5e-57   Eucalyptus grandis [rose gum]
emb|CAN76784.1|  hypothetical protein VITISV_028823                     200   5e-57   Vitis vinifera
dbj|BAC53891.1|  cytochrome P450                                        200   6e-57   Petunia x hybrida [garden petunia]
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     199   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               199   1e-56   Eucalyptus grandis [rose gum]
ref|XP_002528647.1|  cytochrome P450, putative                          197   4e-56   Ricinus communis
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               197   7e-56   Eucalyptus grandis [rose gum]
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               197   8e-56   Eucalyptus grandis [rose gum]
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               196   2e-55   Eucalyptus grandis [rose gum]
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               196   2e-55   Podophyllum peltatum
gb|AHX24365.1|  CYP76A26-like protein                                   195   4e-55   Cinchona calisaya [quinine]
gb|AJD25180.1|  cytochrome P450 CYP76A36                                195   4e-55   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg             194   5e-55   
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               194   9e-55   
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    194   1e-54   Vitis vinifera
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               193   1e-54   Vitis vinifera
gb|AHX24370.1|  CYP76A26                                                192   4e-54   Catharanthus roseus [chatas]
gb|AHK60833.1|  iridoid oxidase                                         192   5e-54   Catharanthus roseus [chatas]
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    189   2e-53   Solanum melongena [aubergine]
gb|AHX24367.1|  CYP76A26-like protein                                   190   3e-53   Rauvolfia serpentina [devilpepper]
gb|AHX24368.1|  CYP76A26-like protein                                   188   2e-52   Tabernaemontana elegans
gb|AHX24366.1|  CYP76A26-like protein                                   187   4e-52   Amsonia hubrichtii
gb|AHX24369.1|  CYP76A26-like protein                                   186   6e-52   Vinca minor [common periwinkle]
ref|XP_002528654.1|  cytochrome P450, putative                          185   2e-51   
ref|XP_002528653.1|  cytochrome P450, putative                          185   2e-51   Ricinus communis
ref|XP_002528650.1|  cytochrome P450, putative                          184   6e-51   
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   183   1e-50   Citrus sinensis [apfelsine]
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               183   1e-50   Citrus sinensis [apfelsine]
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             183   1e-50   Citrus clementina [clementine]
gb|KDP20523.1|  hypothetical protein JCGZ_05069                         182   3e-50   Jatropha curcas
gb|AHX24364.1|  CYP76A26-like protein                                   182   4e-50   Lonicera japonica [Japanese honeysuckle]
gb|KDP43102.1|  hypothetical protein JCGZ_27051                         180   2e-49   Jatropha curcas
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like               179   2e-49   Sesamum indicum [beniseed]
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         176   7e-48   Jatropha curcas
gb|KDP26153.1|  hypothetical protein JCGZ_22834                         175   1e-47   Jatropha curcas
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               175   1e-47   Sesamum indicum [beniseed]
gb|KDP27489.1|  hypothetical protein JCGZ_20024                         168   3e-45   Jatropha curcas
ref|XP_006381328.1|  hypothetical protein POPTR_0006s11830g             163   2e-44   
ref|XP_002528649.1|  cytochrome P450, putative                          164   1e-43   
gb|KCW84357.1|  hypothetical protein EUGRSUZ_B012102                    150   1e-41   Eucalyptus grandis [rose gum]
gb|KCW84346.1|  hypothetical protein EUGRSUZ_B011962                    149   3e-41   Eucalyptus grandis [rose gum]
ref|XP_008241321.1|  PREDICTED: cytochrome P450 76A1                    156   8e-41   
emb|CBI30229.3|  unnamed protein product                                156   1e-40   Vitis vinifera
gb|AJD25179.1|  cytochrome P450 CYP76A35                                155   1e-40   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007201998.1|  hypothetical protein PRUPE_ppa022979mg             155   4e-40   
ref|XP_011466802.1|  PREDICTED: cytochrome P450 76A1-like               152   4e-39   Fragaria vesca subsp. vesca
ref|XP_008392536.1|  PREDICTED: cytochrome P450 76A1                    152   4e-39   Malus domestica [apple tree]
ref|XP_004246575.1|  PREDICTED: cytochrome P450 76A1-like               151   5e-39   Solanum lycopersicum
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         151   5e-39   Jatropha curcas
gb|EYU38602.1|  hypothetical protein MIMGU_mgv1a006828mg                150   5e-39   Erythranthe guttata [common monkey flower]
ref|XP_007027586.1|  Cytochrome P450                                    154   8e-39   
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                     150   9e-39   Eucalyptus grandis [rose gum]
gb|KJB46481.1|  hypothetical protein B456_007G371400                    150   1e-38   Gossypium raimondii
ref|XP_002528643.1|  cytochrome P450, putative                          150   1e-38   Ricinus communis
ref|XP_009613392.1|  PREDICTED: cytochrome P450 76A2-like               149   1e-38   Nicotiana tomentosiformis
ref|XP_006341260.1|  PREDICTED: cytochrome P450 76A2-like               149   2e-38   Solanum tuberosum [potatoes]
ref|XP_002528644.1|  cytochrome P450, putative                          149   2e-38   Ricinus communis
ref|XP_011036815.1|  PREDICTED: cytochrome P450 76A1-like               149   3e-38   Populus euphratica
emb|CAB86901.1|  cytochrome P450-like protein                           149   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190865.2|  cytochrome P450, family 76, subfamily G, polype...    149   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g             149   5e-38   Phaseolus vulgaris [French bean]
ref|XP_010112509.1|  Cytochrome P450 76A2                               149   5e-38   Morus notabilis
gb|KCW47877.1|  hypothetical protein EUGRSUZ_K01623                     149   5e-38   Eucalyptus grandis [rose gum]
ref|XP_010036342.1|  PREDICTED: cytochrome P450 76A1-like               148   6e-38   Eucalyptus grandis [rose gum]
ref|XP_006382516.1|  hypothetical protein POPTR_0005s02900g             148   7e-38   
ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                    148   7e-38   Vitis vinifera
ref|XP_002877896.1|  CYP76G1                                            148   8e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_011036810.1|  PREDICTED: cytochrome P450 76A1-like               148   1e-37   Populus euphratica
dbj|BAC42682.1|  putative cytochrome P450                               147   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KCW84353.1|  hypothetical protein EUGRSUZ_B01205                     146   2e-37   Eucalyptus grandis [rose gum]
ref|XP_006382524.1|  hypothetical protein POPTR_0005s02990g             146   3e-37   Populus trichocarpa [western balsam poplar]
emb|CBI30232.3|  unnamed protein product                                145   3e-37   Vitis vinifera
ref|XP_011101481.1|  PREDICTED: cytochrome P450 76A1                    146   4e-37   Sesamum indicum [beniseed]
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg             146   5e-37   Capsella rubella
ref|XP_010431310.1|  PREDICTED: cytochrome P450 76A1-like               145   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006382522.1|  hypothetical protein POPTR_0005s02960g             145   6e-37   
ref|XP_010038981.1|  PREDICTED: cytochrome P450 76A1-like               145   7e-37   Eucalyptus grandis [rose gum]
emb|CDP15345.1|  unnamed protein product                                144   1e-36   Coffea canephora [robusta coffee]
ref|XP_009148756.1|  PREDICTED: cytochrome P450 76A1                    144   3e-36   Brassica rapa
gb|EYU38601.1|  hypothetical protein MIMGU_mgv1a004436mg                143   4e-36   Erythranthe guttata [common monkey flower]
ref|XP_006382521.1|  hypothetical protein POPTR_0005s02950g             143   5e-36   
ref|XP_010112512.1|  Cytochrome P450 76A2                               136   5e-36   
ref|NP_001190075.1|  cytochrome P450, family 76, subfamily G, pol...    142   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504051.1|  PREDICTED: cytochrome P450 76A1-like               142   1e-35   
gb|KDP24879.1|  hypothetical protein JCGZ_25132                         135   1e-35   Jatropha curcas
gb|KCW48752.1|  hypothetical protein EUGRSUZ_K02392                     139   2e-35   Eucalyptus grandis [rose gum]
gb|KDP43103.1|  hypothetical protein JCGZ_27052                         139   2e-35   Jatropha curcas
gb|KDO61005.1|  hypothetical protein CISIN_1g0379902mg                  138   2e-35   Citrus sinensis [apfelsine]
ref|XP_006382520.1|  hypothetical protein POPTR_0005s02940g             141   2e-35   
gb|KDP29244.1|  hypothetical protein JCGZ_16633                         139   2e-34   Jatropha curcas
ref|XP_009626046.1|  PREDICTED: cytochrome P450 76A1                    138   2e-34   Nicotiana tomentosiformis
emb|CDP18467.1|  unnamed protein product                                137   2e-34   Coffea canephora [robusta coffee]
gb|KDP26150.1|  hypothetical protein JCGZ_22831                         131   3e-34   Jatropha curcas
emb|CDX76245.1|  BnaA04g05090D                                          138   3e-34   
ref|XP_006482365.1|  PREDICTED: cytochrome P450 76A2-like               138   3e-34   Citrus sinensis [apfelsine]
gb|AJD25184.1|  cytochrome P450 CYP76G16                                138   3e-34   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006439139.1|  hypothetical protein CICLE_v10033708mg             137   6e-34   Citrus clementina [clementine]
ref|XP_009793679.1|  PREDICTED: cytochrome P450 76A1                    137   7e-34   Nicotiana sylvestris
gb|KHN37270.1|  Cytochrome P450 76A2                                    135   3e-33   Glycine soja [wild soybean]
ref|XP_003535793.1|  PREDICTED: cytochrome P450 76A2-like               135   3e-33   Glycine max [soybeans]
ref|XP_006403743.1|  hypothetical protein EUTSA_v10010318mg             133   1e-32   
ref|XP_003592855.1|  Cytochrome P450                                    132   2e-32   Medicago truncatula
ref|XP_010558964.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    132   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_004138005.1|  PREDICTED: cytochrome P450 76A2-like               131   7e-32   Cucumis sativus [cucumbers]
ref|XP_008442789.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    130   1e-31   Cucumis melo [Oriental melon]
ref|XP_004168914.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    129   4e-31   
gb|KDO63687.1|  hypothetical protein CISIN_1g040285mg                   125   2e-30   Citrus sinensis [apfelsine]
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 126   3e-30   Vitis vinifera
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    126   4e-30   Vitis vinifera
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like             125   5e-30   Vitis vinifera
ref|XP_007034575.1|  Cytochrome P450, putative                          126   7e-30   
ref|XP_004497404.1|  PREDICTED: cytochrome P450 76A2-like               125   8e-30   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg             125   8e-30   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    124   3e-29   Populus euphratica
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g             123   4e-29   
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like             123   4e-29   Citrus sinensis [apfelsine]
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    122   7e-29   Populus euphratica
ref|XP_003600328.1|  Cytochrome P450                                    121   3e-28   Medicago truncatula
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like             119   1e-27   Vitis vinifera
ref|XP_002528651.1|  cytochrome P450, putative                          115   1e-27   
ref|XP_007040049.1|  Cytochrome P450, putative                          119   1e-27   
gb|AAS92624.1|  cytochrome P450                                         119   2e-27   Hypericum androsaemum
ref|XP_010053381.1|  PREDICTED: geraniol 8-hydroxylase-like             118   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    118   3e-27   
ref|XP_006423671.1|  hypothetical protein CICLE_v10028269mg             118   3e-27   Citrus clementina [clementine]
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  117   5e-27   Vitis vinifera
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg             117   6e-27   Citrus clementina [clementine]
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like             117   6e-27   
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                   117   6e-27   Citrus sinensis [apfelsine]
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like             117   6e-27   Citrus sinensis [apfelsine]
emb|CDP11721.1|  unnamed protein product                                116   1e-26   Coffea canephora [robusta coffee]
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                  116   1e-26   Vitis vinifera
emb|CBI33813.3|  unnamed protein product                                117   1e-26   Vitis vinifera
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like             116   2e-26   Pyrus x bretschneideri [bai li]
emb|CBI38803.3|  unnamed protein product                                119   2e-26   Vitis vinifera
ref|XP_010093536.1|  Cytochrome P450 76C4                               116   2e-26   Morus notabilis
ref|XP_006494410.1|  PREDICTED: geraniol 8-hydroxylase-like             115   2e-26   
ref|XP_006494407.1|  PREDICTED: geraniol 8-hydroxylase-like             115   2e-26   Citrus sinensis [apfelsine]
ref|XP_003636948.1|  Cytochrome P450                                    114   2e-26   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg             115   3e-26   Prunus persica
ref|XP_008447652.1|  PREDICTED: geraniol 8-hydroxylase-like             113   3e-26   
ref|XP_010108078.1|  Cytochrome P450 76C4                               115   3e-26   Morus notabilis
gb|KGN58318.1|  Cytochrome P450                                         113   3e-26   Cucumis sativus [cucumbers]
gb|AHF22835.1|  drimenol oxidase 1                                      115   3e-26   Persicaria hydropiper [water-pepper]
sp|O23976.1|C76B1_HELTU  RecName: Full=7-ethoxycoumarin O-deethyl...    115   4e-26   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg             115   4e-26   
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like             115   4e-26   Citrus sinensis [apfelsine]
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like             115   4e-26   Citrus sinensis [apfelsine]
ref|XP_006423672.1|  hypothetical protein CICLE_v10028278mg             114   5e-26   Citrus clementina [clementine]
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    114   5e-26   Vitis vinifera
gb|ACU20890.1|  unknown                                                 114   6e-26   Glycine max [soybeans]
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    114   7e-26   Vitis vinifera
ref|XP_003600322.1|  Cytochrome P450                                    114   8e-26   Medicago truncatula
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    114   8e-26   
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg             114   8e-26   Citrus clementina [clementine]
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g             114   8e-26   Populus trichocarpa [western balsam poplar]
gb|KEH34024.1|  cytochrome P450 family 71 protein                       114   8e-26   Medicago truncatula
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like             114   8e-26   Citrus sinensis [apfelsine]
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg             114   1e-25   Citrus clementina [clementine]
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    114   1e-25   Amsonia hubrichtii
ref|XP_004152069.1|  PREDICTED: geraniol 8-hydroxylase-like             114   1e-25   Cucumis sativus [cucumbers]
ref|XP_004164278.1|  PREDICTED: geraniol 8-hydroxylase-like             113   1e-25   
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like             114   1e-25   
emb|CBI38806.3|  unnamed protein product                                116   1e-25   Vitis vinifera
gb|KHM99472.1|  Cytochrome P450 71D11                                   113   1e-25   Glycine soja [wild soybean]
emb|CAA71178.1|  7-ethoxycoumarin O-deethylase                          113   1e-25   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002509652.1|  cytochrome P450, putative                          112   1e-25   
emb|CAN76783.1|  hypothetical protein VITISV_028822                     111   1e-25   Vitis vinifera
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               113   1e-25   Glycine max [soybeans]
ref|XP_010667620.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
gb|KDO43348.1|  hypothetical protein CISIN_1g039787mg                   110   3e-25   Citrus sinensis [apfelsine]
emb|CDY58284.1|  BnaCnng32860D                                          108   3e-25   Brassica napus [oilseed rape]
ref|XP_006853497.1|  hypothetical protein AMTR_s00032p00215290          112   4e-25   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    112   5e-25   Solanum lycopersicum
ref|XP_006358804.1|  PREDICTED: geraniol 8-hydroxylase-like             111   5e-25   Solanum tuberosum [potatoes]
ref|XP_006494538.1|  PREDICTED: geraniol 8-hydroxylase-like             113   6e-25   
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                    111   6e-25   Rauvolfia serpentina [devilpepper]
ref|XP_006853508.1|  hypothetical protein AMTR_s00032p00219670          111   6e-25   
gb|KJB37572.1|  hypothetical protein B456_006G211100                    111   6e-25   Gossypium raimondii
ref|XP_009372320.1|  PREDICTED: geraniol 8-hydroxylase-like             111   7e-25   Pyrus x bretschneideri [bai li]
gb|KEH34016.1|  cytochrome P450 family 71 protein                       111   7e-25   Medicago truncatula
gb|AIO11760.1|  cytochrome p450                                         111   7e-25   Croton stellatopilosus
gb|KHG25715.1|  7-ethoxycoumarin O-deethylase                           110   9e-25   Gossypium arboreum [tree cotton]
ref|XP_003528904.1|  PREDICTED: geraniol 8-hydroxylase-like             111   1e-24   Glycine max [soybeans]
ref|XP_003630839.1|  Cytochrome P450                                    108   1e-24   
ref|XP_006423678.1|  hypothetical protein CICLE_v10028268mg             110   1e-24   
ref|XP_009757342.1|  PREDICTED: geraniol 8-hydroxylase-like             110   1e-24   Nicotiana sylvestris
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like             110   1e-24   Citrus sinensis [apfelsine]
gb|KEH15784.1|  cytochrome P450 family 71 protein                       110   1e-24   Medicago truncatula
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             110   1e-24   Phaseolus vulgaris [French bean]
ref|XP_006494536.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-24   Citrus sinensis [apfelsine]
ref|XP_010667793.1|  PREDICTED: geraniol 8-hydroxylase-like             109   2e-24   
ref|XP_003600327.1|  Cytochrome P450                                    110   2e-24   Medicago truncatula
ref|XP_010038950.1|  PREDICTED: geraniol 8-hydroxylase-like             109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-24   Nicotiana sylvestris
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-24   Glycine max [soybeans]
ref|XP_006423673.1|  hypothetical protein CICLE_v10028257mg             110   2e-24   Citrus clementina [clementine]
gb|KCW48249.1|  hypothetical protein EUGRSUZ_K01977                     109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               110   2e-24   Cicer arietinum [garbanzo]
ref|XP_002301305.2|  cytochrome P450 family protein                     110   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006487471.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    110   2e-24   Citrus sinensis [apfelsine]
ref|XP_006423714.1|  hypothetical protein CICLE_v10028277mg             110   2e-24   Citrus clementina [clementine]
emb|CDP11720.1|  unnamed protein product                                110   3e-24   Coffea canephora [robusta coffee]
ref|XP_006606065.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-24   Glycine max [soybeans]
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like             109   3e-24   Nicotiana sylvestris
ref|XP_007226675.1|  hypothetical protein PRUPE_ppa021147mg             109   3e-24   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              109   4e-24   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               109   4e-24   
ref|XP_009397045.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-24   
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like             109   5e-24   
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g             108   6e-24   
ref|XP_004166926.1|  PREDICTED: geraniol 8-hydroxylase-like             108   6e-24   
gb|KGN50170.1|  hypothetical protein Csa_5G157290                       108   6e-24   
ref|XP_006423622.1|  hypothetical protein CICLE_v10028275mg             108   6e-24   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               109   6e-24   
ref|XP_007153084.1|  hypothetical protein PHAVU_003G005500g             108   6e-24   
gb|ABR17519.1|  unknown                                                 108   7e-24   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like             108   7e-24   
ref|XP_006358817.1|  PREDICTED: geraniol 8-hydroxylase-like             107   7e-24   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       108   7e-24   
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like             108   8e-24   
ref|XP_008222093.1|  PREDICTED: geraniol 8-hydroxylase-like             108   9e-24   
ref|XP_010676979.1|  PREDICTED: geraniol 8-hydroxylase-like             108   9e-24   
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609    110   9e-24   
gb|KJB51557.1|  hypothetical protein B456_008G222600                    108   1e-23   
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg             108   1e-23   
gb|AGI97015.1|  geraniol 10-hydroxylase                                 108   1e-23   
ref|XP_006358805.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-23   
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg             107   1e-23   
ref|XP_002301307.2|  cytochrome P450 family protein                     108   1e-23   
ref|XP_008437176.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-23   
gb|KDO36937.1|  hypothetical protein CISIN_1g044449mg                   104   1e-23   
gb|AJG35804.1|  CYP76G10                                                108   1e-23   
ref|XP_006451469.1|  hypothetical protein CICLE_v10008095mg             108   1e-23   
gb|KDO57775.1|  hypothetical protein CISIN_1g011069mg                   108   1e-23   
gb|KHM99473.1|  Cytochrome P450 71D11                                   107   1e-23   
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like             107   1e-23   
ref|XP_009397046.1|  PREDICTED: geraniol 8-hydroxylase-like             106   2e-23   
ref|XP_010040683.1|  PREDICTED: geraniol 8-hydroxylase-like             107   2e-23   
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like             107   2e-23   
ref|XP_007227491.1|  hypothetical protein PRUPE_ppa004517mg             107   2e-23   
gb|KCW45005.1|  hypothetical protein EUGRSUZ_L01405                     107   2e-23   
gb|KDO41057.1|  hypothetical protein CISIN_1g043641mg                   107   2e-23   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg             107   2e-23   
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...    107   2e-23   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         107   2e-23   
ref|XP_004511453.1|  PREDICTED: geraniol 8-hydroxylase-like             107   2e-23   
ref|XP_010544670.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    107   2e-23   
ref|XP_010544671.1|  PREDICTED: cytochrome P450 76C2-like isoform X2    107   2e-23   
gb|KDP39088.1|  hypothetical protein JCGZ_00845                         107   2e-23   
emb|CAN81642.1|  hypothetical protein VITISV_036426                     106   2e-23   
ref|XP_010053375.1|  PREDICTED: geraniol 8-hydroxylase-like             107   3e-23   
ref|XP_006829362.1|  hypothetical protein AMTR_s01143p00010430          105   3e-23   
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g             107   3e-23   
gb|AHB33940.1|  santalene/bergamotene oxidase                           107   3e-23   
ref|XP_010540267.1|  PREDICTED: geraniol 8-hydroxylase-like             107   3e-23   
ref|XP_006495031.1|  PREDICTED: geraniol 8-hydroxylase-like             106   3e-23   
emb|CAN81641.1|  hypothetical protein VITISV_036425                     106   3e-23   
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like             106   4e-23   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             107   4e-23   
ref|XP_006423716.1|  hypothetical protein CICLE_v10028276mg             105   4e-23   
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like             106   4e-23   
ref|XP_002276094.1|  PREDICTED: geraniol 8-hydroxylase                  106   4e-23   
ref|XP_010692295.1|  PREDICTED: geraniol 8-hydroxylase-like             106   4e-23   
gb|AHB33946.1|  santalene/bergamotene oxidase                           106   4e-23   
ref|XP_009788349.1|  PREDICTED: geraniol 8-hydroxylase-like             105   4e-23   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             106   4e-23   
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                    106   5e-23   
ref|XP_007224608.1|  hypothetical protein PRUPE_ppa026952mg             106   5e-23   
ref|XP_004505593.1|  PREDICTED: geraniol 8-hydroxylase-like             106   5e-23   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             106   5e-23   
gb|AHB33947.1|  santalene/bergamotene oxidase                           106   5e-23   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             106   5e-23   
ref|XP_004241762.2|  PREDICTED: geraniol 8-hydroxylase-like             108   5e-23   
gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    106   5e-23   
ref|XP_010528786.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    106   5e-23   
ref|XP_010528787.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    106   6e-23   
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                    106   6e-23   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like             106   6e-23   
ref|XP_007020549.1|  Cytochrome P450                                    106   6e-23   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             105   6e-23   
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             106   6e-23   
gb|AHB33948.1|  santalene/bergamotene oxidase                           106   7e-23   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               106   7e-23   
gb|KEH43874.1|  cytochrome P450 family protein                          106   7e-23   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like              106   7e-23   
ref|XP_009780649.1|  PREDICTED: geraniol 8-hydroxylase-like             105   7e-23   
ref|XP_002509653.1|  cytochrome P450, putative                          105   7e-23   
ref|XP_009624917.1|  PREDICTED: geraniol 8-hydroxylase-like             105   8e-23   
ref|XP_011457440.1|  PREDICTED: geraniol 8-hydroxylase-like             105   9e-23   
dbj|BAP90522.1|  geraniol 10-hydroxylase                                105   9e-23   
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                   105   9e-23   
gb|KHM99474.1|  Cytochrome P450 71D11                                   105   1e-22   
ref|XP_004505635.1|  PREDICTED: geraniol 8-hydroxylase-like             105   1e-22   
gb|AHB33943.1|  CYP76F43                                                105   1e-22   
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g             105   1e-22   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg             105   1e-22   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like              105   1e-22   
ref|XP_006365964.1|  PREDICTED: geraniol 8-hydroxylase-like             105   1e-22   
dbj|BAC53893.1|  cytochrome P450                                        105   1e-22   
ref|XP_011457549.1|  PREDICTED: geraniol 8-hydroxylase-like             107   1e-22   
ref|XP_010920218.1|  PREDICTED: geraniol 8-hydroxylase-like             105   1e-22   
ref|XP_004173362.1|  PREDICTED: cytochrome P450 71A2-like               101   1e-22   
gb|AAS90125.1|  cytochrome P450                                         105   1e-22   
gb|KCW77657.1|  hypothetical protein EUGRSUZ_D01955                     104   2e-22   
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             105   2e-22   
ref|XP_006423660.1|  hypothetical protein CICLE_v10030225mg             104   2e-22   
ref|XP_002310007.2|  cytochrome P450 family protein                     104   2e-22   
ref|XP_009794425.1|  PREDICTED: geraniol 8-hydroxylase-like             104   2e-22   
ref|XP_010680621.1|  PREDICTED: geraniol 8-hydroxylase-like             104   2e-22   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               104   2e-22   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              104   2e-22   
ref|XP_010053379.1|  PREDICTED: geraniol 8-hydroxylase-like             104   2e-22   
ref|XP_004305997.2|  PREDICTED: cytochrome P450 71D11-like              104   2e-22   
gb|KHG03596.1|  Cytochrome P450 protein                                 104   2e-22   
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                  104   3e-22   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              104   3e-22   
ref|XP_009801952.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-22   
gb|EMT03552.1|  Cytochrome P450 76C4                                    104   3e-22   
gb|KDO62256.1|  hypothetical protein CISIN_1g0441781mg                99.8    3e-22   
gb|AFS28686.1|  putative geraniol 10-hydroxylase                        103   3e-22   
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                    103   3e-22   
gb|EYU21984.1|  hypothetical protein MIMGU_mgv1a019764mg                101   3e-22   
gb|KDP25563.1|  hypothetical protein JCGZ_20719                         105   3e-22   
ref|XP_007146615.1|  hypothetical protein PHAVU_006G0551000g          99.8    4e-22   
ref|XP_004248583.1|  PREDICTED: premnaspirodiene oxygenase-like i...    103   4e-22   
ref|XP_006494719.1|  PREDICTED: geraniol 8-hydroxylase-like             103   4e-22   
ref|XP_008447356.1|  PREDICTED: geraniol 8-hydroxylase-like             103   4e-22   
ref|XP_004304108.2|  PREDICTED: cytochrome P450 71D9-like               105   4e-22   
ref|XP_007219031.1|  hypothetical protein PRUPE_ppa004503mg             103   4e-22   
gb|KHG17729.1|  Cytochrome P450                                         104   4e-22   
ref|XP_010102946.1|  Serine/threonine-protein kinase AFC2               105   4e-22   
gb|KHG18333.1|  Cytochrome P450                                         104   4e-22   
ref|XP_010687578.1|  PREDICTED: cytochrome P450 71D10-like              103   4e-22   
ref|XP_006487435.1|  PREDICTED: geraniol 8-hydroxylase-like             103   4e-22   
gb|AAQ05825.1|AF479661_1  cytochrome P450                               103   4e-22   
ref|XP_003636936.1|  Cytochrome P450                                    103   4e-22   
gb|KJB83173.1|  hypothetical protein B456_013G233400                    100   4e-22   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       103   5e-22   
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like             103   5e-22   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               103   5e-22   
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like             103   5e-22   
ref|XP_006358802.1|  PREDICTED: geraniol 8-hydroxylase-like             103   5e-22   
ref|XP_010920219.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    103   5e-22   
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like             103   5e-22   
ref|XP_010920220.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    103   5e-22   
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...    103   5e-22   
ref|XP_003609742.1|  Cytochrome P450                                    102   5e-22   
gb|KJB27712.1|  hypothetical protein B456_005G005900                    103   6e-22   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    103   6e-22   
ref|XP_010102947.1|  Cytochrome P450 71A1                               103   6e-22   
ref|XP_008439074.1|  PREDICTED: cytochrome P450 71A1-like               103   6e-22   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             103   6e-22   
ref|XP_007224897.1|  hypothetical protein PRUPE_ppa022132mg             103   6e-22   
gb|KHG19246.1|  Cytochrome P450                                         103   6e-22   
ref|XP_004152574.1|  PREDICTED: cytochrome P450 71A1-like               103   7e-22   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       103   7e-22   
gb|KEH43873.1|  cytochrome P450 family protein                          103   8e-22   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              103   8e-22   
ref|XP_004152572.1|  PREDICTED: cytochrome P450 71A1-like               103   8e-22   
ref|XP_004157822.1|  PREDICTED: cytochrome P450 71A1-like               102   8e-22   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              103   9e-22   
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like             103   9e-22   
gb|KHG16719.1|  Cytochrome P450                                         102   9e-22   
gb|KJB83171.1|  hypothetical protein B456_013G233300                    103   1e-21   
ref|XP_004172542.1|  PREDICTED: geraniol 8-hydroxylase-like             100   1e-21   
gb|EAY89257.1|  hypothetical protein OsI_10754                          102   1e-21   
gb|ABF94963.1|  Cytochrome P450 family protein, expressed               102   1e-21   
gb|KFK25691.1|  hypothetical protein AALP_AA8G146600                    102   1e-21   
gb|AHB33944.1|  santalene/bergamotene oxidase                           102   1e-21   
ref|XP_010911502.1|  PREDICTED: geraniol 8-hydroxylase-like             102   1e-21   
ref|XP_004506712.1|  PREDICTED: cytochrome P450 71D10-like              102   1e-21   
gb|AET02720.2|  cytochrome P450 family protein                          102   1e-21   
ref|XP_004496400.1|  PREDICTED: geraniol 8-hydroxylase-like             102   1e-21   
gb|EYU24235.1|  hypothetical protein MIMGU_mgv1a005267mg                102   1e-21   
ref|XP_008437178.1|  PREDICTED: geraniol 8-hydroxylase-like             102   1e-21   
gb|AFK46798.1|  unknown                                                 102   1e-21   
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                      102   1e-21   
ref|XP_006338233.1|  PREDICTED: geraniol 8-hydroxylase-like             102   2e-21   
gb|KGN50167.1|  hypothetical protein Csa_5G157260                       100   2e-21   
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like             102   2e-21   
ref|XP_006397736.1|  hypothetical protein EUTSA_v10001282mg             104   2e-21   
ref|XP_003615665.1|  Cytochrome P450                                    102   2e-21   
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like             102   2e-21   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               102   2e-21   
ref|XP_011072187.1|  PREDICTED: cytochrome P450 71A9-like               102   2e-21   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                102   2e-21   
ref|XP_006423677.1|  hypothetical protein CICLE_v10028488mg             101   2e-21   
gb|AHB33942.1|  bergamotene oxidase                                     102   2e-21   
ref|XP_002270541.1|  PREDICTED: geraniol 8-hydroxylase                  102   2e-21   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like               100   2e-21   
ref|XP_006338229.1|  PREDICTED: geraniol 8-hydroxylase-like             102   2e-21   
gb|AHB33945.1|  bergamotene oxidase                                     102   2e-21   
ref|XP_008222068.1|  PREDICTED: geraniol 8-hydroxylase-like             101   2e-21   
ref|XP_010687580.1|  PREDICTED: cytochrome P450 71D11-like              101   2e-21   
ref|XP_010102940.1|  Cytochrome P450 71A1                               102   3e-21   
ref|XP_010523703.1|  PREDICTED: cytochrome P450 76C4-like               101   3e-21   
ref|XP_010053037.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-21   
emb|CAN83490.1|  hypothetical protein VITISV_001325                     101   3e-21   
gb|AHB33941.1|  bergamotene oxidase                                     101   3e-21   
gb|KDO35818.1|  hypothetical protein CISIN_1g038027mg                 97.4    3e-21   
ref|XP_004147597.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    101   3e-21   
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-21   
gb|AHB33939.1|  bergamotene oxidase                                     101   3e-21   
ref|XP_007226839.1|  hypothetical protein PRUPE_ppa017329mg             101   3e-21   
dbj|BAE97672.1|  CYP76J1                                                102   3e-21   
ref|XP_004492652.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-21   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         101   3e-21   
ref|XP_011069681.1|  PREDICTED: ferruginol synthase-like                101   3e-21   
gb|KJB13847.1|  hypothetical protein B456_002G097400                    101   3e-21   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             101   3e-21   
ref|XP_006358801.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-21   
ref|XP_009372314.1|  PREDICTED: geraniol 8-hydroxylase-like             101   3e-21   
ref|XP_008791859.1|  PREDICTED: geraniol 8-hydroxylase-like             101   4e-21   
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like             101   4e-21   
ref|XP_006404367.1|  hypothetical protein EUTSA_v10010304mg             101   4e-21   
ref|XP_009782145.1|  PREDICTED: geraniol 8-hydroxylase-like             101   4e-21   
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like             101   4e-21   
gb|KJB61440.1|  hypothetical protein B456_009G358600                    100   4e-21   
gb|KEH43603.1|  cytochrome P450 family protein                          100   4e-21   
ref|XP_003615666.1|  Cytochrome P450                                    101   4e-21   
gb|KCW89351.1|  hypothetical protein EUGRSUZ_A01647                     100   4e-21   
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               100   5e-21   
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g           99.8    5e-21   
gb|ABR16821.1|  unknown                                                 101   5e-21   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...    100   5e-21   



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEWE  Y+VWS I L+P L+ + +RK+ S SY LPPGPPGLP+ GNM DLG  P+QTIA 
Sbjct  1    MEWEWSYVVWSVIILVPTLIIVFSRKR-SSSYNLPPGPPGLPIFGNMFDLGTLPYQTIAS  59

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
             K+KYG ++W  IGSV T +ILSAK AA+ FKNHD +FA+RK+ID M V  Y+KG+LALA
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAADFFKNHDFAFAERKIIDTMLVHDYNKGSLALA  119

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  574
            PYG+YWR+LRRICTVE+FV+KRINETV +RRKC+ DML WIE EA+ V+ +G+G+ V  F
Sbjct  120  PYGTYWRVLRRICTVEMFVNKRINETVDIRRKCVHDMLQWIEDEANVVEIKGSGIEVTRF  179

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFLSTFN LGNL+ SRDLV P S KAS+FF AM  IM+
Sbjct  180  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIME  217



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 175/218 (80%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEWE  Y+VWS I L+P L+ + ++++ SCSY LPPGPPGLP+ GNM +LG  P+QTIA 
Sbjct  1    MEWEWSYVVWSTIILVPTLIIVFSKRR-SCSYNLPPGPPGLPIFGNMFNLGTLPYQTIAS  59

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
             K+KYG ++W  IGSV T +ILSAK AAE FKNHD +FA+RK++D M V  Y+KG+LA+A
Sbjct  60   FKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAERKIMDTMLVHDYNKGSLAIA  119

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  574
            PYG+YWR+LRRICTVE+FV+KRIN TV +R+KC+DDML WIE+EA+ V+ +G+G+ V  F
Sbjct  120  PYGTYWRVLRRICTVEMFVNKRINATVHIRQKCVDDMLQWIEEEANVVEIKGSGIEVTRF  179

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFLSTFN LGNL+ SRDLV P S KAS+FF AM  IM+
Sbjct  180  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIME  217



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            Y  W +IFL+P    +L+RKK SCS+RLPPGPPG P+ GN+ DLG  PHQTIA MK +YG
Sbjct  7    YFAWFSIFLVPFFFLVLSRKK-SCSHRLPPGPPGWPIFGNLFDLGTLPHQTIAGMKLRYG  65

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             V+ L IGSV T AILSAK A E FKNHD  FADRK+ID M V  Y+K +L LAPYG+YW
Sbjct  66   PVVLLRIGSVKTIAILSAKVATEFFKNHDACFADRKIIDTMLVHNYNKSSLVLAPYGTYW  125

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R+LRRICTVE+F +KRINET  +R+KCID ML WI+KEA S+++G+G+ VA F+FL++FN
Sbjct  126  RVLRRICTVEMFTNKRINETAHLRQKCIDSMLQWIDKEAKSMKKGSGIEVARFIFLASFN  185

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             +GNL+LSRDLVDP S KAS+FF AM G+M+
Sbjct  186  MMGNLMLSRDLVDPESKKASEFFTAMEGLME  216



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEWE  Y+VWS I ++P  + ++  K  S SY+LPPGPPG P+ GNM DLG  P+QTIAE
Sbjct  1    MEWEWNYVVWSIIIIVPTTLIIVFSKTNSSSYKLPPGPPGFPIFGNMFDLGTLPYQTIAE  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
             K KYG V+W  IGSV T +ILSA  A E FKNHD +FA+RK+ID M V  Y+ G+LA+A
Sbjct  61   FKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKIIDTMLVHDYNLGSLAIA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  574
             YG+YWR+LRRICTVE+FVHKRINETV +RRKC+DDM+ WIEKE +SV+ +G+G+ V  F
Sbjct  121  RYGTYWRVLRRICTVEMFVHKRINETVDIRRKCVDDMIHWIEKEVNSVEVKGSGIEVTRF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            VFLSTFN LGNL+ SRDLV P S KAS+FF+AM  IM
Sbjct  181  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIM  217



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +S+I L+P  +   +RKK + CSY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSSIILLPAFILFFSRKKSTKCSYKLPPGPPGLPIFGNMFELGTEPYKRMS  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+WL +G S     + +A+AA ELFKNHD+SFADR + DA +   Y++G+LA
Sbjct  61   VLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADRFIPDANQAHSYYQGSLA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            LAPYGS+WR  RRICTVE+FVHKRI+ETVPVRR+C+D+ML WIEKEA+S ++G+G+ V  
Sbjct  121  LAPYGSFWRFKRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKEANSAEKGSGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             VFL++FN +GNL+LS+DL DP S++AS+FF+AM GIM
Sbjct  181  LVFLASFNMVGNLVLSKDLADPESEEASEFFNAMKGIM  218



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            M+W+  Y+VWS I ++   + ++  K+ S  Y+LPPGPPG+P+ GNM DLGA P+QTIA+
Sbjct  1    MDWDWNYVVWSIIIIVSTTLIIVFSKRNSSCYKLPPGPPGIPIFGNMFDLGALPYQTIAQ  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
             K KYG ++W  IGSV T +ILSAK A E FKNHD  FA+RK++D M V  Y+ G+LA+A
Sbjct  61   YKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIMDTMLVHDYNLGSLAIA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  574
             YG+YWR+LRRICTVE+FVHKRINET+ +RRKC+DDM+ WIE E SS + +G+G+ V  F
Sbjct  121  RYGTYWRVLRRICTVEMFVHKRINETMDIRRKCVDDMIHWIENEVSSKEVKGSGIEVTRF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            VFLSTFN LGNL+ SRDLV P S KAS+FF+AM  IM
Sbjct  181  VFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIM  217



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 170/218 (78%), Gaps = 1/218 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEW   +LV+   FL+P L+FL+ R+  + S +RLPPGPPGLPV GNM DLG  PHQT+ 
Sbjct  2    MEWPWNFLVYFITFLLPALLFLIRRRSSNSSLHRLPPGPPGLPVFGNMFDLGTMPHQTLT  61

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
            E+ +K+G VIWL +G+ +T  I SAKAAA+LFK+HD+SFA R   +A +V  YHKG+LAL
Sbjct  62   ELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
            APYG++WRMLRR+ TVE+ V+KRINET  +R+KC+D++ LWIE+EAS ++ G GVH+A F
Sbjct  122  APYGAHWRMLRRLVTVEMLVNKRINETAFIRKKCLDNLQLWIEEEASKLEEGHGVHMARF  181

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL +FN LGNL+LSRDLVDP S +  +FF AM G+M+
Sbjct  182  VFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLME  219



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +S+I L+   +   ++KK + C Y+LPPGPPGLP+ GNM +LG  P + ++
Sbjct  1    MEWEWSYLFFSSIILLSVFILFFSQKKSTKCCYKLPPGPPGLPIFGNMFELGTEPFKKMS  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+WL +G S +   + +A+AAAELFKNHD+SFADR + D  +   Y++G+LA
Sbjct  61   VLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADRFIPDVNQAHSYYQGSLA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            LAPYG +WR  RRICTVE+FVHK+I+ETVPVRRKC+D+ML WIEK A+S ++G+G+ V  
Sbjct  121  LAPYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKAANSAEKGSGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNLILS++L DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKNLADPESEEASEFFNAMKGIME  219



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 170/219 (78%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKP-SCSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +S I  +P L+ +  +KK  S SYRLPPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYLFFSTIIFLPVLLLIFPKKKAISSSYRLPPGPPGLPIFGNMFELGTLPYKKVA  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+WL IG S+++  + +A+AAA+LFKNHD+SFADR  +D  +   Y++G++A
Sbjct  61   VLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCPVDVNQAHNYYQGSMA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            L  YGS+WR  RRICTVE+FV+K+INETV VRRKC++DM+ WIEKEA+ V++G+G+ +  
Sbjct  121  LGQYGSFWRFQRRICTVEMFVNKKINETVSVRRKCVNDMVKWIEKEANVVKKGSGIELTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNLI S+DL DP S++AS FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLIFSKDLADPDSEEASDFFNAMKGIME  219



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +S+I L+P L+   ++KK + CSY+LPPGPPGLP  GNM +LG  P++ +A
Sbjct  1    MEWEWSYLCFSSIILLPVLILFFSQKKTTKCSYKLPPGPPGLPFFGNMFELGTEPYKRMA  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+WL +G S +   + +A AAAELFKNHD SFADR + D  +   Y++G+LA
Sbjct  61   ALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADRFIPDVNQAHSYYQGSLA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            +  YGS+WR  RRICTVE+FVHKRI+ETVPVRR+C+D+ML WIEKEA+S ++G+G+ V  
Sbjct  121  IGRYGSFWRFQRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKEANSAEKGSGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNLILS+DL DP S++AS FF+AM  IM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASDFFNAMKRIME  219



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 171/218 (78%), Gaps = 1/218 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            M+WE  YL +S I  +P L+ +  +KK + SY+LPPGPPGLP+ GNM +LG+ P++ +A 
Sbjct  1    MQWEWSYLFFSTIIFLPVLLLIFPKKKANSSYKLPPGPPGLPIFGNMFELGSLPYKKVAV  60

Query  218  MKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
            +K KYG ++WL IG S+++  + +A+AAA+LFKNHD+SFADR  +D  +   Y++G++AL
Sbjct  61   LKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCTVDVNQAHNYYQGSMAL  120

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
              YGS+WR+ RRICTVE+FV+K+INETV VR KC+++M+ WIEKEA+ V++G+G+ V  F
Sbjct  121  GQYGSFWRLQRRICTVEMFVNKKINETVSVRGKCVNEMVKWIEKEANVVKKGSGIEVTRF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNLI S+DL DP S++AS FF+AM GIM+
Sbjct  181  VFLASFNMLGNLIFSKDLADPESEEASDFFNAMKGIME  218



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   249 bits (636),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 168/219 (77%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +SAI L+P L+   ++KK + CSY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIILLPVLILFFSQKKSTKCSYKLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             ++ KYG V+ L +G S +   + +A AAAELFKNHD SFADR ++D      Y++G+LA
Sbjct  61   VLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADRPMVDVNLAHNYYQGSLA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            +  YGS+WR  RRICTVE+FVHK+I+ETVP+RRKC+D+ML WIEK  SS ++G+G+ V  
Sbjct  121  IGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKAGSSAEKGSGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNL+LS+DL DP S++AS FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLVLSKDLADPESEEASDFFNAMKGIME  219



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 166/219 (76%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  YL +SAI  +P L+   ++KK S C Y LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEWEWSYLFFSAIIFLPILILFFSQKKSSKCCYNLPPGPPGLPIFGNMFELGKEPYKKMS  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+ L +G S +   + +A+AAAELFKNHD SFADR ++D  +   Y +G+LA
Sbjct  61   ALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIVDVNQAHNYFQGSLA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            +  YGS+WR  RRICTVE+FVHK+I+ETVP+RRKC+D+ML WIEK  +S ++G G+ V  
Sbjct  121  VGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKTVNSAEKGNGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNLILS+DL DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIME  219



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 167/219 (76%), Gaps = 2/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            ME+E  YL +S+  L+   +   ++KK + CSY+LPPGPPGLP+ GNM +LG  P++ ++
Sbjct  1    MEYEWSYLFFSSTILLSIFILFFSKKKTTKCSYKLPPGPPGLPIFGNMFELGTEPYKKMS  60

Query  215  EMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             +K KYG V+ L +G S +   + +A+AAAELFKNHD SFADR ++D      Y++G+ A
Sbjct  61   ALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLVDVNSAHNYYQGSPA  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAH  571
            LA YG +WR  RRICTVE+FVHK+I+ETVPVRRKC+D+ML WIEK A+S ++G+G+ V  
Sbjct  121  LARYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKAANSAEKGSGIEVTR  180

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LGNLILS+DL DP S++AS+FF+AM GIM+
Sbjct  181  FVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIME  219



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            ++W    L+W  I +IP L  LL R++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIPVLFLLLHRRR-SGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++KYG V+WL +G++ TT + S+KAAAELFKN D+ F+DR + + M+ QGYH+ +LALA
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  574
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNL+LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN+ DLG+ PH+T+ +M+ KYG+VIWL +G+++T  ILSAKAA E FKNHD+SFADR 
Sbjct  44   IFGNLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + + M+  GY +G+LALAPYGSYWR+LRR+ TV++ V KRINET  +RRKC+DDML WIE
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASIRRKCVDDMLQWIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  V +  G+HV+ FVFL TFN LGNL+LSRDL+DP S   S+FFDAM G+M+
Sbjct  164  EESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLME  218



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 165/218 (76%), Gaps = 1/218 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEWE  Y+ +SAI ++P  +   ++K  +  SY+ PPGPPGLP+ GNM +LG  P++ +A
Sbjct  1    MEWEWSYVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMA  60

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
             ++ KYG V+WL +GS  T  + +A+A+ ELFKNHD+SFA+R + D  +   Y++G+LA+
Sbjct  61   VLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAI  120

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
            APYG +WR  RRICT+E+FVHK+I+ET PVRRKC+D+ML WIEKEA+S ++G+G+ V  F
Sbjct  121  APYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNLILS+DL D  S++AS+FF AM  I +
Sbjct  181  VFLASFNMLGNLILSKDLADLESEEASEFFIAMKRINE  218



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            ++W    L+W  I +IP L  LL R++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIPVLFLLLHRRR-SGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++KYG V+WL +G++ TT + S+KAAAELFKN D+ F+DR + + M+ QGYH+ +LALA
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNXDLCFSDRTITETMRAQGYHESSLALA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  574
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNL+LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +2

Query  29   FKEMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQ  205
            F   EW   +LV   IF +P LVFL+ R   S  +R  P  P   PVIGNM DLG  PH+
Sbjct  5    FNFNEW--NFLVCLIIFFLPVLVFLIRRSSSSSGHRRLPPGPKGWPVIGNMFDLGTMPHR  62

Query  206  TIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
            T+ ++ +K+G VIWLT+G  +T ++ SAKAAAE FKNHD+SF +R V +  +V  YHKG+
Sbjct  63   TLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGS  122

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  565
            LA+APYG++WR++RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHV
Sbjct  123  LAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHV  182

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            A FVFL TFN LGNL+LSRDLVDP S++  +FF AM G+M+
Sbjct  183  ARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLME  223



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+ DLG+ PH+T+  M+ KYG VIWL +G+++T  ILSAKAA E FKNHD+SFADR 
Sbjct  44   VLGNLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + + M+  GY +G+LALAPYGSYWR+LRR+ TV++ V KRINET   RRKC+DDML WIE
Sbjct  104  ITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASTRRKCVDDMLQWIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  V +  G+HV+ FVFL TFN LGNL+LSRDL+DP S   S+FFDAM G+M+
Sbjct  164  EESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLME  218



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 159/214 (74%), Gaps = 4/214 (2%)
 Frame = +2

Query  47   ERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKN  226
            E  + V+ AI L+P L+F +   K S S RLPPGP G PV G+M +LG  PH+ IAE++ 
Sbjct  2    ELHFFVYPAIILLPPLIFAIIHSKRSGSERLPPGPLGWPVFGHMFNLGGTPHRAIAELEQ  61

Query  227  KYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYG  406
            KYG V+WL +GS++T A+L AK A+E FKNHD+SFADR +++ M   GY+ G+LALAPYG
Sbjct  62   KYGPVVWLKLGSINTMALLKAKPASEFFKNHDLSFADRTIVETMTAHGYNYGSLALAPYG  121

Query  407  SYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLS  586
            S WR+LRRICTVE+FV KRI+ET  +RRKC+DDML WIEK+ +    G  + V  + FL+
Sbjct  122  SRWRVLRRICTVEMFVSKRISETEGIRRKCVDDMLSWIEKDGN----GNAIPVGRYAFLA  177

Query  587  TFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +FN LGNL++SRDLVDP S+K  +F+DAM  +M+
Sbjct  178  SFNMLGNLMMSRDLVDPESEKGLEFYDAMKKVME  211



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPS-CSYRlppgppglpVI-GNMMDLGAFPHQTI  211
            MEWE  YL +S I L+P  + L +RKK + C Y L P  P    I GN+  LG  P + +
Sbjct  1    MEWEWSYLFFSTIILLPAFILLFSRKKATKCYYNLLPPGPPGLPIFGNVFQLGTEPFKAM  60

Query  212  AEMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            A ++ KYG V+WL +G S +   + +A+AAAELFKNHD+SFADR +    +   Y +G++
Sbjct  61   ACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADRFIPIVNQAHNYCQGSM  120

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVA  568
            AL  YGSYWR  RRICTVE+F+HK+I+ETVPVRRKC+D+ML WI K A+S ++G+G+ V 
Sbjct  121  ALCQYGSYWRFQRRICTVEMFIHKKISETVPVRRKCVDNMLKWIGKAANSAEKGSGIEVT  180

Query  569  HFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             FVFL++FN LGNLILS+DL DP S++AS+FF+AM GIM
Sbjct  181  RFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIM  219



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            ++W    L+W  I +IP L  LL R++ S S RLPPGPPG PV GNM DLGA PH+T+A 
Sbjct  2    VDWASNILLWCIILVIPVLFLLLHRRR-SGSVRLPPGPPGWPVFGNMFDLGAMPHETLAG  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++KYG V+WL +G++ TT + S+KAAAELFKN D+ F+DR + + M+ QGYH+ +LALA
Sbjct  61   LRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYHESSLALA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHF  574
            PYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHF
Sbjct  121  PYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNL+LS DL+ P S + S+FF+ M  +M+
Sbjct  181  VFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  218



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 163/222 (73%), Gaps = 7/222 (3%)
 Frame = +2

Query  23   QNFKEMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPH  202
            +N  +M+W    LV   IF   G V LL R+K S   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLHRRKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  203  QTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKG  382
            +T+ E++ KYG V+WL  G+++T AILSAKAA + FKNHD +FA+RKV + M+V GY K 
Sbjct  70   RTLTELRQKYGDVLWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  383  ALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVH  562
            +LALAPYG++WR+LRR+ TVE+   KRINET  VRRKC++DMLLWIE+EAS      GVH
Sbjct  130  SLALAPYGAFWRVLRRLVTVEMLATKRINETASVRRKCVNDMLLWIEQEAS------GVH  183

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VA  VFLSTFN LGNL+LSRDL+D  S+  ++FF AM G+M+
Sbjct  184  VARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  225



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +2

Query  29   FKEMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQ  205
            F   EW    LV   IF +P L+FL+ R   + S+R  P  P   PVIGNM DLG  PH+
Sbjct  5    FNFNEW--NLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHR  62

Query  206  TIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
            T+ ++ +K+G VIWLT+G  +T ++ SAKAAAE FKNHD+SF +R V +  +V  YHKG+
Sbjct  63   TLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGS  122

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  565
            LA+APYG++WR++RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHV
Sbjct  123  LAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHV  182

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            A FVFL TFN LGNL+LSRDLVDP S++  +FF AM G+M+
Sbjct  183  ARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMK  223



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = +2

Query  29   FKEMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQ  205
            F   EW    LV   IF +P L+FL+ R   + S+R  P  P   PVIGNM DLG  PH+
Sbjct  5    FNFNEW--NLLVCLIIFFLPVLLFLIRRSSSNSSHRRLPPGPKGWPVIGNMFDLGTMPHR  62

Query  206  TIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
            T+ ++ +K+G VIWLT+G  +T ++ SAKAAAE FKNHD+SF +R V +  +V  YHKG+
Sbjct  63   TLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNENARVHDYHKGS  122

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  565
            LA+APYG++WR++RR+ TVE+ V+KRINET  +RRKCID+M LWIE+EAS V+ G GVHV
Sbjct  123  LAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEASKVKEGRGVHV  182

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            A FVFL TFN LGNL+LSRDLVDP S++  +FF AM G+M+
Sbjct  183  ARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMK  223



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 162/222 (73%), Gaps = 7/222 (3%)
 Frame = +2

Query  23   QNFKEMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPH  202
            +N  +M+W    LV   IF   G V LL R K S   + PPGPPG P+IGNM DLG  PH
Sbjct  11   ENSDQMDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPH  69

Query  203  QTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKG  382
            +T+ E++ KYG VIWL  G+++T  ILSAKAA + FKNHD +FA+RKV + M+V GY K 
Sbjct  70   RTLTELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKS  129

Query  383  ALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVH  562
            +LALAPYG++WR+LRR+ TVE+ V KRINET  VRRKC++DMLLWIE+EAS      GVH
Sbjct  130  SLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEAS------GVH  183

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VA  VFLSTFN LGNL+LSRDL+D  S+  ++FF AM G+M+
Sbjct  184  VARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  225



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 160/217 (74%), Gaps = 7/217 (3%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            M+W    LV   IF   G V LL R K S   + PPGPPG P+IGNM DLG  PH+T+ E
Sbjct  1    MDW-LGLLVCIIIFSASGAVLLLLRIKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLTE  59

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            ++ KYG VIWL  G+++T AILSAKAA + FKNHD +FA+RKV + M+V GY K +LALA
Sbjct  60   LRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTETMRVHGYDKSSLALA  119

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFV  577
            PYG++WR+LRR+ TVE+ V KRINET  VRRKC++DMLLWIE+EAS      GVHVA  V
Sbjct  120  PYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEAS------GVHVARLV  173

Query  578  FLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FLSTFN LGNL+LSRDL+D  S+  ++FF AM G+M+
Sbjct  174  FLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLME  210



>emb|CDP15344.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            ME      VW    LIP L+ LL R K S   RLPPGPPG P+ GNM DLG+ PH+T+A 
Sbjct  1    MELHVNQFVWGVAILIPSLL-LLLRHKKSSHNRLPPGPPGWPIFGNMFDLGSMPHRTLAG  59

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +KNKYG V+WL IG+++T A+ S+KAAAELF+NHD+SF +R V + MK   + K +L+LA
Sbjct  60   LKNKYGPVVWLRIGAMNTMAVQSSKAAAELFRNHDISFVERTVTENMKSHNFDKSSLSLA  119

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVHVAHF  574
            PYGSYWR+L+R+ TVE+ V+KRINETV +RRKC+DDM+ WI+KEA + +    G+H+AHF
Sbjct  120  PYGSYWRVLKRMMTVEMIVNKRINETVAIRRKCVDDMVSWIKKEAHAGKESWRGIHLAHF  179

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNL+LS+DLV+P  ++  +FF AM  + +
Sbjct  180  VFLASFNMLGNLMLSKDLVEPEKEEGVEFFSAMVRLAE  217



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 172/222 (77%), Gaps = 6/222 (3%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQTI  211
            ME E  Y+ WS+I ++P  + L+T+ K S S  +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  212  AEMKNKYGSVIWLTIGS-VSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            A +K KYG ++WL IGS ++T  + +A+AAAELFKNHDV+FADR ++D      +++ ++
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTGVH  562
            ALAPYG+YWR+ RRICTVE+FV+KRINETV +RRK +D ML WIEK+++  +V R +G+ 
Sbjct  121  ALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEKQSNLENVDR-SGIE  179

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            V  +VFL++FN LGNL+LS+DL DP S+K S+FF AMTGIM+
Sbjct  180  VTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIME  221



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 172/222 (77%), Gaps = 6/222 (3%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQTI  211
            ME E  Y+ WS+I ++P  + L+T+ K S S  +LPPGPPGLP++GNM DL G+ P++ +
Sbjct  1    MELEWSYIFWSSIIILPAFILLITKNKSSFSNVKLPPGPPGLPIVGNMFDLAGSEPYKKV  60

Query  212  AEMKNKYGSVIWLTIGS-VSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            A +K KYG ++WL IGS ++T  + +A+AAAELFKNHDV+FADR ++D      +++ ++
Sbjct  61   ANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNFYQVSM  120

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTGVH  562
            ALAPYG+YWR+ RRICTVE+FV+KRINETV +RRK +D ML WIEK+++  +V R +G+ 
Sbjct  121  ALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEKQSNLENVDR-SGIE  179

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            V  +VFL++FN LGNL+LS+DL DP S+K S+FF AMTGIM+
Sbjct  180  VTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIME  221



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 170/218 (78%), Gaps = 1/218 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSY-RlppgppglpVIGNMMDLGAFPHQTIA  214
            MEW   +LV+   FL+P L+FL+ R+  + S+ RLPPGPPGLPV GNM DLG  PH+T+ 
Sbjct  2    MEWPWNFLVYFIPFLLPALLFLIRRRSSNSSHHRLPPGPPGLPVFGNMFDLGTMPHKTLT  61

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
            ++ +K+G VIWL +G+ +T  I SAKAAA+LFK+HD+SFA R   +A +V  YHKG+LAL
Sbjct  62   DLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTEASRVLDYHKGSLAL  121

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
            APYG++WRMLRR+ TVE+ V+KRINET  +RRKC+D++ LWIE+EAS ++ G GVHVA F
Sbjct  122  APYGAHWRMLRRLMTVEMLVNKRINETTFIRRKCLDNLQLWIEEEASKLEEGHGVHVARF  181

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL +FN LGNL+LSRDLVDP S +  +FF AM G+M+
Sbjct  182  VFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLME  219



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V GNM +LG  PH+T+  +K KYGSV+WL +GS++T  ILSA+AAAE FKNHDV+FA+R 
Sbjct  46   VFGNMFELGNEPHKTLMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKNHDVAFAERS  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V + MK  GYHKG+LALAPYG+YWR+++RI TV++ V+KRINETV +RRKCIDD+  WI 
Sbjct  106  VTEVMKSHGYHKGSLALAPYGTYWRIMKRIMTVQMLVNKRINETVDIRRKCIDDLTEWIN  165

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             E   +    G+HVA F+FL++FN LGNL+LSR+LVDP S+K S+FF AM  +M+
Sbjct  166  NEG-RINSSGGIHVAKFIFLASFNMLGNLLLSRELVDPKSEKGSEFFTAMVELME  219



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
            + R+  S ++ LPPGPPG P+ GNM DLG  PH+T+ E+  K+G VIWL +G+ +T ++ 
Sbjct  25   IRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQ  84

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            SAKAA+E FKNHD+SFA+R + +A +V  YHKG+LALAPYGS+WR+LRR+ TV++ V+KR
Sbjct  85   SAKAASEFFKNHDLSFANRTINEACRVYDYHKGSLALAPYGSHWRVLRRLMTVDMVVNKR  144

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            INET  VRRKC D++ LWIE+EAS ++ G GVHVA FVFL TFN LGNL+LSRDLVDP S
Sbjct  145  INETAFVRRKCFDNLQLWIEEEASKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKS  204

Query  644  DKASKFFDAMTGIMQ  688
            ++  +FF AM G+M+
Sbjct  205  NEGLEFFKAMNGLME  219



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 160/218 (73%), Gaps = 3/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEWE  YL +S+I L+   +F+L   K + +Y LPPGPPGLPV GNM +LG   ++ +A 
Sbjct  1    MEWELSYLFFSSIILLS--IFILFFSKKNSTYNLPPGPPGLPVFGNMFELGTESYKKMAA  58

Query  218  MKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
            +K KYG V+ L +G S +   + +A+AAAELFKNHD SFADR  +D      Y++G+ AL
Sbjct  59   LKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQVDVNSAHNYYQGSPAL  118

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
            A YG +WR  RR+CTVE+FVHK+I+ETV VRRKC+DDML WIEK   S ++G+G+ V  F
Sbjct  119  ARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKAGCSAEKGSGIEVTRF  178

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            VFL++FN LGNLILS+DL DP S++AS+FF AM GIM+
Sbjct  179  VFLASFNMLGNLILSKDLADPESEEASEFFHAMKGIME  216



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  41   EWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEM  220
            +W    L+W  I +IP ++FLL R++ S S RLPPGPPG PV GNM DLGA PH+T+A +
Sbjct  13   DWASNILLWCIILVIP-VLFLLLRRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGL  71

Query  221  KNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAP  400
            ++KYG V+WL +G++ TT + S+KAAAELFKN D+ F+DR + + M+ QGYH+ +LALAP
Sbjct  72   RHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNKDLCFSDRTITETMRAQGYHESSLALAP  131

Query  401  YGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGTGVHVAHFV  577
            YG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G G+ VAHFV
Sbjct  132  YGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGRGIQVAHFV  191

Query  578  FLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FL++FN LGNL+LS DL+ P S + S+FF+ M  +M+
Sbjct  192  FLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  228



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   232 bits (591),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 160/213 (75%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            +LVW    L P ++FL  R++ S S  LPPGPPG PV+GNM DLG+ PH+T+A +K  YG
Sbjct  41   FLVWCIGILGP-VLFLFCRQRCSTSGGLPPGPPGWPVVGNMFDLGSMPHKTVAGLKKDYG  99

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             V+WL IGS++T A+L+AKAAAELFKNHD +FA+R + + MKV  +HK AL+L+PYGSYW
Sbjct  100  PVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITEVMKVHDFHKTALSLSPYGSYW  159

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG--VHVAHFVFLST  589
            R+++RI TVE+ V KRI ET P+RR+CI DM+ WI KEA +   G    +HVA FVFL++
Sbjct  160  RVMKRIMTVEMLVQKRIKETEPIRRRCIGDMVEWINKEAKAAAGGESGRIHVARFVFLAS  219

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FN LGNL+LSRDLV P S + S+FF AM  +M+
Sbjct  220  FNMLGNLMLSRDLVSPESVEGSEFFAAMIELME  252



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQTI  211
            ME E +Y+ WS I L+P L+ L+ + K S S  +LPPGPPGLP+ GNM DL G+ PH+ +
Sbjct  1    MELEWRYIFWSIIILLPALILLIAKNKSSSSNIKLPPGPPGLPIFGNMFDLAGSEPHKKV  60

Query  212  AEMKNKYGSVIWLTIGS-VSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            A  K KYG ++WL IGS ++T  + +A+AAAELFKNHDV+FADR ++D       ++G++
Sbjct  61   ANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNIVDVNLAHNIYQGSI  120

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHV  565
            +LAPYG+YWRM RRICT E+FV+KRINETV +RRK +D ML WIEK+A+ V    +G+ V
Sbjct  121  SLAPYGNYWRMQRRICTSEMFVNKRINETVQIRRKSMDKMLQWIEKQANLVNINRSGIEV  180

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             H+VFL++FN LGNLILS+DL DP SDK S+FF+AMTGIMQ
Sbjct  181  THYVFLASFNMLGNLILSKDLADPESDKGSEFFNAMTGIMQ  221



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 167/219 (76%), Gaps = 7/219 (3%)
 Frame = +2

Query  53   KYLVWSAI-FLIPGLVFLLTRKKPSCS--YRlppgppglpVIGNMMDLGAFPHQTIAEMK  223
            ++L+W+ +  +IP L+FL  R++ + S    LPPGPPG P+IGNM+DLG  PH+T  +++
Sbjct  2    EHLLWNFLSLIIPALLFLFIRRRSNSSKELELPPGPPGWPIIGNMLDLGQMPHKTQTKLR  61

Query  224  NKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPY  403
            + +G VIWL IG+ +T AILSAKAA E FKNHD+SFA+R V +  KV  YHKG+LALAPY
Sbjct  62   HTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERSVTEGSKVLDYHKGSLALAPY  121

Query  404  GSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQR-GT---GVHVAH  571
            GS+WR+LRR+ TV++  +KRIN+T  +R KC+D+M  WIE+EAS +Q  GT   GVH+A 
Sbjct  122  GSHWRLLRRLLTVDILTNKRINDTAAIRSKCVDNMQKWIEEEASKLQENGTSSRGVHLAR  181

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL +FN LGNL+LSRDLVDP S++  +FF+ M G+M+
Sbjct  182  FVFLMSFNLLGNLLLSRDLVDPNSEEGLEFFELMKGVME  220



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            ++V S + ++P L     RK  S   RLPPGPPG PV GN  DLG  PH+++A++++KYG
Sbjct  11   FIVMSFLLIMPHL-----RKGTSGHRRLPPGPPGWPVFGNTFDLGPMPHRSLAQLRHKYG  65

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             V+WL +G+++T  ILS+KAAAE FKNHD+SF +R V +  +V GYHKG++ALA YGSYW
Sbjct  66   DVLWLKLGAINTMVILSSKAAAEFFKNHDLSFVERTVTETSRVYGYHKGSVALANYGSYW  125

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R++RR+ TVE+ V+KRI ET  +RRKC+DDMLLWIE+EA       GVHVA FVFL TFN
Sbjct  126  RVMRRLVTVEMLVNKRIRETAFLRRKCVDDMLLWIEEEAGKAN--CGVHVARFVFLMTFN  183

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             LGNL+LS+DL  P S++ S+FF AM GIM+
Sbjct  184  LLGNLMLSKDLFGPDSEEGSEFFVAMEGIME  214



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 160/220 (73%), Gaps = 4/220 (2%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            M+W   +LV   IF    ++FL  R++ S   +LPPGPPG P+IGNM DLG  PH+T+  
Sbjct  90   MDWPTSFLVCLVIF-SSSVLFLFFRRRNSNPGKLPPGPPGWPIIGNMFDLGTMPHRTLTC  148

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++KYG VIWL +G+V+T  +LS KAA ELFKNHD+SFA+R + + M+   YHK +LALA
Sbjct  149  LRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAERNITEIMRAHDYHKSSLALA  208

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGT---GVHVA  568
            PYGSYWR+LRR+ TV++ V+KRINET  +RRKC+DDMLLWIE EA   Q  +   G+HVA
Sbjct  209  PYGSYWRVLRRLVTVDMLVNKRINETTCIRRKCVDDMLLWIEDEARKKQGDSHRDGIHVA  268

Query  569  HFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             FVFL TFN LGNL+LSRDL DP S + S+ F  M  +M+
Sbjct  269  RFVFLLTFNLLGNLMLSRDLFDPDSKEGSELFMVMLRLME  308



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 156/220 (71%), Gaps = 8/220 (4%)
 Frame = +2

Query  53   KYLVWSAIF--LIPGLVFLLTRKKPSCSYRlppgppgl--pVIGNMMDLGAFPHQTIAEM  220
            +YL W+ +   +IP L+FLL R + +        P     P++GNM+DLGA PH+T+ E+
Sbjct  2    EYLPWNFLVYVVIPSLLFLLIRWRSNSGGEQAFPPGPPGWPILGNMLDLGAMPHKTLTEL  61

Query  221  KNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAP  400
            ++++GSV+WL +G  +T  I SAKAA E FKNHD++F +R +    +V  YHKG+LALAP
Sbjct  62   RHRFGSVLWLRLGVRNTMVIQSAKAATEFFKNHDLTFVERNINIGARVHDYHKGSLALAP  121

Query  401  YGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG----TGVHVA  568
            YG+ WR+LRR+ TV++  +KRINET  +RRKC+++M  WIE+EA+ ++       GVHVA
Sbjct  122  YGTQWRVLRRLVTVDMLTNKRINETASIRRKCVENMQKWIEEEATKLEENGSSSEGVHVA  181

Query  569  HFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             FVFL TFN LGNL+LSRDLVDP S +  +FFDAM G+M+
Sbjct  182  RFVFLMTFNLLGNLMLSRDLVDPNSKEGLEFFDAMRGLME  221



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQTIA  214
            M+W   Y+ WS   ++  L+    R++ + + RL P      PV GNM +LG  PH+T+ 
Sbjct  1    MDWNWDYVFWSITSILILLLLHFHRRRSNKNGRLLPPGSRGWPVFGNMFELGNEPHKTLM  60

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
             +K KYG V+WL +GS++T  ILSA AA E FKNHDV+FA+R V + MK  GYHKG+LAL
Sbjct  61   GLKQKYGPVVWLKLGSINTMVILSADAATEFFKNHDVAFAERSVTEVMKSHGYHKGSLAL  120

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHF  574
            APYG+YWR+++RI TV++ ++KRIN+TV +RRKCIDD++ WI  E   V    G+HVA F
Sbjct  121  APYGTYWRIMKRIMTVQMLINKRINQTVDIRRKCIDDLIEWINNEG-RVNSSGGIHVAKF  179

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +FL++FN LG L+LSR+LVDP S+  S+FF AM   M+
Sbjct  180  IFLASFNMLGKLLLSRELVDPKSENGSEFFTAMVEFME  217



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN++DLG  PH+T+ +++ KYG VI L +GSV+T  ILSAK A+ELFK HD+SFA+R 
Sbjct  41   ILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNTMVILSAKPASELFKYHDLSFAERN  100

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + + M+  GY++G+LA+APYGSYWR+LRR+ TV++ V+KRINET  +RRKC+DDML WI 
Sbjct  101  ITETMRSHGYNEGSLAIAPYGSYWRVLRRLVTVDMLVNKRINETASIRRKCVDDMLRWI-  159

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            KE +      G+H+A FVFL TFNSLGNL+ S+DLVDP S + S+FF AM G+M+
Sbjct  160  KEETYEANDHGIHLARFVFLMTFNSLGNLMFSKDLVDPESKEGSEFFTAMMGLME  214



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 162/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  38   MEWERKYLVWSAI-FLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            MEW   Y+ +S I  L P L F       +   +LPPGP G PV G+M++LG  PH+T+ 
Sbjct  1    MEWIWGYIFFSIITVLFPFLHFRWRTLLYNVRQQLPPGPRGWPVFGSMLELGNEPHKTLM  60

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
            ++K KYG V+WL +GS++T  ILSAKAA E F+NHD++FA+R V + MK  GY KG+LAL
Sbjct  61   DLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTEVMKSHGYDKGSLAL  120

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE-KEASSVQRGTGVHVAH  571
            APYG+YWR+++RI TV++ V+KRI ETV VRRKCIDD++ WIE +E SS +   G+HVA 
Sbjct  121  APYGTYWRIMKRIMTVQMLVNKRITETVEVRRKCIDDLIEWIENREFSSSE---GIHVAK  177

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL++FN LG L+LSR+LVDP S+K ++FF AM G+M+
Sbjct  178  FVFLASFNMLGKLVLSRELVDPKSEKGTEFFAAMVGLME  216



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 156/213 (73%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            +++  A+F+   L+  L  KK S S RLPPGPPG P+ GNM +LG  PH+T+A ++ KYG
Sbjct  9    FVLICALFVSATLLVSLRWKK-SRSCRLPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYG  67

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             VIWL +GS+ T  ILS++ A E FKN D++FA+R V D M+   YH+G++ALAPYGSYW
Sbjct  68   PVIWLRLGSIDTMVILSSRVATEFFKNQDLNFAERTVTDLMRSHDYHEGSVALAPYGSYW  127

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  589
            RM RR+ TV++ V KR+NET P+RRKCID ML WI + AS+  V+ G G+H+A FVFL+T
Sbjct  128  RMSRRLLTVDMLVAKRLNETAPIRRKCIDKMLTWIGEAASAEKVRLGEGIHLARFVFLTT  187

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FN LGNL+LSRDL DP S   S FF AM G+M+
Sbjct  188  FNLLGNLMLSRDLFDPDSKVGSDFFVAMAGLME  220



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V GNM  LG+ PH+TIA +K+ YG V+WL IGS++T A+L+A AAAELFKNHD SFA+R 
Sbjct  40   VFGNMFQLGSMPHKTIAGLKSHYGPVVWLRIGSINTMALLTAGAAAELFKNHDASFAERT  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + D M    +HK AL+L+PYG YWR ++R+ TVE+ VHKRI ET P+RR+C+ +M+ WI+
Sbjct  100  ITDVMTSHNFHKAALSLSPYGPYWRSMKRMMTVEMLVHKRIVETEPIRRRCVSNMVQWIQ  159

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             E+SS   G GVHVA FVFL++FN LGNL+LSRDLV P S++ S+FF AM  +M+
Sbjct  160  NESSS-SGGHGVHVARFVFLASFNMLGNLMLSRDLVSPESEEGSEFFAAMIDMME  213



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 154/212 (73%), Gaps = 2/212 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            VIWL +GS+ T  ILS++ AAE FKNHD++F +R + D M+ Q Y KG++ALAPYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTF  592
            + RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G GVH+A FVFL  F
Sbjct  129  VSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAF  188

Query  593  NSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N LGNL+LSRDL+DP S   S+FF+AM+G+M+
Sbjct  189  NLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  220



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 154/212 (73%), Gaps = 2/212 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            LV   I  +   +F+    K S S+RLPPGP   P+ GN+ +LG  PH+T+A ++ KYG 
Sbjct  9    LVLICILFVSTTLFVSFCHKRSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGP  68

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            VIWL +GS+ T  ILS++ AAE FKNHD++F +R + D M+ Q Y KG++ALAPYG+YWR
Sbjct  69   VIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWR  128

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTF  592
            + RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G GVH+A FVFL  F
Sbjct  129  VSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAF  188

Query  593  NSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N LGNL+LSRDL+DP S   S+FF+AM+G+M+
Sbjct  189  NLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  220



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 138/178 (78%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFAD  337
            + GNM DL G+ P++  A +K KYG ++WL IG S++T  + +A+AAAELFKNHDV+FAD
Sbjct  44   IFGNMFDLAGSEPYKKAANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFAD  103

Query  338  RKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            R ++D       H+ ++ALAPYG+YWRMLRRICTVE+FV+KRINETV +RRK +D ML W
Sbjct  104  RYIVDVNLAHNNHQASMALAPYGNYWRMLRRICTVEMFVNKRINETVQIRRKSMDKMLQW  163

Query  518  IEKEASSVQRG-TGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            IEK+A+ V    +G+ V  +VFL++FN LGNLILS+DL DP S+K S+FF AMTGIMQ
Sbjct  164  IEKQANLVNTNRSGIEVTRYVFLASFNMLGNLILSKDLADPESEKGSEFFKAMTGIMQ  221



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            +++ S +FL   L F L RKK S S+ LPPGP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FILISIVFLSTALFFSLRRKK-SGSWVLPPGPSGWPIFGNIFSLGTMPHRTVAGLREKYG  67

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
              IWL +GS+ T  ILS++ AAE FKN D++FADR VID ++ + YH+G++A+APYG+YW
Sbjct  68   PTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  589
            R++RR+ T ++ V KR+NET  VRRKC+++ML WI + ASS   Q G G+H+A FVFL  
Sbjct  128  RVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQVGEGIHLARFVFLMN  187

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FN L NL+LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  220



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 154/213 (72%), Gaps = 1/213 (0%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEW   +LVW  I  +  L+ LL R K   +  LPPGPPG P+ GN+ DLG  PHQ +A 
Sbjct  1    MEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLAG  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++ YG V+WL +G + T  + S+KAAAELFKNHD+SF+DR + + M+V  Y++ +L+LA
Sbjct  61   LRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSLA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAHF  574
            PYG YWR LRR+ TV++   KRINETVP+RRKC+DD+LLWIE+EA  +    TG+ +  F
Sbjct  121  PYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEARGMDGTATGLELGRF  180

Query  575  VFLSTFNSLGNLILSRDLVDPMSDKASKFFDAM  673
             FL+TFN +GNL+LSRDL+DP S K S+FF AM
Sbjct  181  FFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  213



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = +2

Query  113  KKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAK  292
            K  S ++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL IG+++T AILSA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAE  91

Query  293  AAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINE  472
            AA   FK+HD +FADR + + M+V  Y K +LALAPYG YWR++RR+ TV++ V KRIN+
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRIND  151

Query  473  TVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKA  652
            T  +RRKC++DM+ W+ KEAS  + G GVHV+ FVFL TFN  GNL+LSRDL DP S+  
Sbjct  152  TASIRRKCVNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDG  211

Query  653  SKFFDAMTGIMQ  688
            S+FF AM G+M+
Sbjct  212  SEFFSAMMGLME  223



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = +2

Query  113  KKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAK  292
            K  S ++RLPPGPPG PV GNM  LG  PH+T+  +++K+G V+WL IG+++T AI SA+
Sbjct  32   KTSSSNHRLPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAE  91

Query  293  AAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINE  472
            AA   FK+HD +FADR + + M+V  Y K +LALAPYG YWR++RR+ TV++ V KRIN+
Sbjct  92   AATVFFKHHDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRIND  151

Query  473  TVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKA  652
            T  +RRKC++DM+ W+ KEAS  + G GVHV+ FVFL TFN  GNL+LSRDL DP S+  
Sbjct  152  TASIRRKCVNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDG  211

Query  653  SKFFDAMTGIMQ  688
            S+FF AM G+M+
Sbjct  212  SEFFSAMMGLME  223



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 151/206 (73%), Gaps = 5/206 (2%)
 Frame = +2

Query  86   PGLVFLLTRKK---PSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTI  256
            P  +FLL R++    + + RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG ++WL I
Sbjct  16   PVFLFLLNRRRKISATKNRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLREKYGPILWLKI  75

Query  257  GSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRIC  436
            G+V+T AILSAK A   FKNHD +F+DR VI+ M+V  Y K +LALAPYGSYWR++RR+ 
Sbjct  76   GAVNTMAILSAKEATIFFKNHDHAFSDRTVIETMRVHNYDKSSLALAPYGSYWRLMRRLV  135

Query  437  TVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTFNSLGNL  610
            TV++ V KRIN+TV +RRKC++DML W+ KEA +  ++ G G+HVA F+F  +FN  GNL
Sbjct  136  TVDMLVLKRINDTVSIRRKCVNDMLAWVAKEARARELEDGRGLHVARFIFFMSFNMFGNL  195

Query  611  ILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +LSRDL D  S+  S+FF A+ G+M+
Sbjct  196  MLSRDLFDMESENGSEFFAAVMGMME  221



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 152/213 (71%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            +++ S +F+   L   L RKK S S  LP GP G P+ GN+  LG  PH+T+A ++ KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKK-SGSRVLPRGPSGWPIFGNIFSLGTMPHRTLAGLREKYG  67

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             +IWL +GS+ T  ILS++ AAE FKN D++FADR VID ++ + YH+G++A+APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  589
            R++RR+ T ++ V KR+NE  P+RRKC+++ML WI + ASS   + G G+H+A FVFL  
Sbjct  128  RVMRRLLTTDMLVTKRLNEMAPIRRKCVENMLAWIGEAASSDKARVGEGIHLARFVFLMN  187

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FN L NL+LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  220



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 155/214 (72%), Gaps = 1/214 (0%)
 Frame = +2

Query  35   EMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIA  214
            +MEW   +LVW  I  +  L+ LL R K   +  LPPGPPG P+ GN+ DLG  PHQ +A
Sbjct  530  QMEWTTNFLVWLIIPFLSALLLLLHRLKSGFNKHLPPGPPGWPIFGNIFDLGTLPHQKLA  589

Query  215  EMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALAL  394
             +++ YG V+WL +G + T  + S+KAAAELFKNHD+SF+DR + + M+V  Y++ +L+L
Sbjct  590  GLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHETMRVHQYNESSLSL  649

Query  395  APYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVHVAH  571
            APYG YWR LRR+ TV++   KRINETVP+RRKC+DD+LLWIE+EA  +    TG+ +  
Sbjct  650  APYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEARGMDGTATGLELGR  709

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAM  673
            F FL+TFN +GNL+LSRDL+DP S K S+FF AM
Sbjct  710  FFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  743


 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST  I S + A E+FKNHDV  A RK
Sbjct  62   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  121

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG  WRMLRR+CT E FV  R++    VR  CID M+ ++ 
Sbjct  122  IYEAMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVT  181

Query  524  KEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +  +S   GT  + V  F+FL  FN +GNL+ S+DL+DP S++ ++FF     +M+
Sbjct  182  EAGTS---GTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVME  234



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +2

Query  122  SCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            S S+RLPPGP   P+ GN+ +LG  P +T+A ++ KYG VIWL +GS+ T   LS++ AA
Sbjct  31   SRSHRLPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTLSSRVAA  90

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E FKNHD++F +R + D M+ Q Y+KG++ALAPYG+YWR+ RR+ T  + V +R+NET P
Sbjct  91   EFFKNHDLNFVERTITDLMQSQEYYKGSIALAPYGTYWRVSRRLLTAGILVARRLNETAP  150

Query  482  VRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS  655
            ++RKC+DDML WI + AS+  V+ G GVH+A FVFL  FN LGNL+LSRDL+DP S   S
Sbjct  151  IQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGS  210

Query  656  KFFDAMTGIMQ  688
            +FF+AM+G+M+
Sbjct  211  EFFEAMSGLME  221



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN+  LG  PH+T+A+++ K+G V+WL IG++ T  ILSA AA+  FK+HD +FADR 
Sbjct  44   IFGNLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSADAASVFFKHHDHAFADRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + + M+   Y+K +LALAPYG YWR++RR+ TV++ V KRINET  VRRKC++DM+ W+ 
Sbjct  104  ITETMRAHNYNKSSLALAPYGPYWRLMRRLVTVDMLVAKRINETASVRRKCVNDMITWLS  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            KEA  ++ G GV+VA FVFL +FN  GNL+LSRDL DP S+  S+FF AM G+++
Sbjct  164  KEAGKLEEGDGVYVARFVFLMSFNLFGNLMLSRDLFDPESETGSEFFAAMAGLLE  218



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +2

Query  86   PGLVFLLTR--KKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIG  259
            P  +FLL R  K  +   RLPPGPPG P+ GNM  LG  PH+T+  ++ KYG V+WL IG
Sbjct  27   PVFLFLLIRRAKISATKRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLRQKYGPVLWLKIG  86

Query  260  SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICT  439
            +V+T AILSAK A   FKNHD +F+DR VI+ M+   Y K +LALAPYG YWR++RR+ T
Sbjct  87   AVNTMAILSAKEATIFFKNHDHNFSDRTVIETMRAHNYDKSSLALAPYGPYWRLMRRLVT  146

Query  440  VELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILS  619
            V++ V KRIN+T  +RR+C++DML WI KEA  ++ G G+HV+ FVF  +FN  GNL+LS
Sbjct  147  VDMLVMKRINDTASIRRRCVNDMLTWIAKEARELEAGRGLHVSRFVFFMSFNLFGNLMLS  206

Query  620  RDLVDPMSDKASKFFDAMTGIMQ  688
            RD+ D  S+  S+FF A+ G+++
Sbjct  207  RDMFDMKSESGSEFFTAVMGLLE  229



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +2

Query  197  PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYH  376
            PH+T+A +++KYG V+WL +G++ TT + S+KAAAELFKN D+ F+DR + + M+ QGYH
Sbjct  2    PHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYH  61

Query  377  KGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSV-QRGT  553
            + +LALAPYG +WR LRR+ T+E+ V KRINET  VRRKC+DDML WIE+EA  V   G 
Sbjct  62   ESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGR  121

Query  554  GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            G+ VAHFVFL++FN LGNL+LS DL+ P S + S+FF+ M  +M+
Sbjct  122  GIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVME  166



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 162/224 (72%), Gaps = 7/224 (3%)
 Frame = +2

Query  38   MEWERKY--LVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQ  205
            M+WE  Y  ++ S I  +   +FL+ +KK S S + LPPGP GLP+ GNM DL G+ P++
Sbjct  1    MDWELNYFYILCSTIIFLLAFIFLIYQKKSSFSKFNLPPGPNGLPIFGNMFDLAGSEPYK  60

Query  206  TIAEMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKG  382
             IA +K+KYG ++WL IG S++T  I +A ++ ELFKNHD  F+DR +ID      ++KG
Sbjct  61   KIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELFKNHDAIFSDRNIIDVNLAHNFYKG  120

Query  383  ALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGV  559
            ++ALAPYG+YWR  RRICTVE+FVHKRINET  VR++ ++ ML WIEK+ASS      G+
Sbjct  121  SMALAPYGNYWRFSRRICTVEMFVHKRINETTLVRQESMNKMLGWIEKKASSGGAVLEGI  180

Query  560  HVAHFVFLSTFNSLGNLILSRDLV-DPMSDKASKFFDAMTGIMQ  688
             V  +VFL++FN LGNLILS+DLV DP S++ S FF+AM GIM+
Sbjct  181  EVTRYVFLASFNMLGNLILSKDLVTDPESEQGSMFFNAMMGIME  224



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +2

Query  197  PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYH  376
            PH+T+A ++ KYG VIWL +GS+ T  ILS++ AAE FKNHD++F +R + D M+ Q Y 
Sbjct  2    PHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYC  61

Query  377  KGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRG  550
            KG++ALAPYG+YWR+ RR+ T ++ V +R+NET P++RKC+DDML WI + AS+  V+ G
Sbjct  62   KGSIALAPYGTYWRVSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLG  121

Query  551  TGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             GVH+A FVFL  FN LGNL+LSRDL+DP S   S+FF+AM+G+M+
Sbjct  122  EGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGSEFFEAMSGLME  167



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 149/213 (70%), Gaps = 3/213 (1%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            +++ S +F+   L   L RKK S S  L PGP G P+ GN+  LG  PH+ +A +  KYG
Sbjct  9    FVLISIVFVSTALFVSLCRKK-SGSRVLRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYG  67

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             +IWL +GS+ T  ILS++ AAE FKN D++FADR VID ++ + YH+G++A+APYG+YW
Sbjct  68   PMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYW  127

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRGTGVHVAHFVFLST  589
            R++RR+ T ++ V KR+ ET P+RRKC+++ML WI + A S   + G G+H+A  VFL  
Sbjct  128  RVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIGEAAPSDKARVGEGIHLARIVFLMN  187

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FN LGNL+LSRDL DP S   S+FF AM G+M+
Sbjct  188  FNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLME  220



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN+  LG  PH+ +A +  KYG +IWL +GS+ T  ILS++ AAE FKN D++FADR 
Sbjct  15   IFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRT  74

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            VID ++ + YH+G++A+APYG+YWR++RR+ T ++ V KR+ ET P+RRKC+++ML WI 
Sbjct  75   VIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIG  134

Query  524  KEASS--VQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            + A S   + G G+H+A  VFL  FN LGNL+LSRDL DP S   S+FF AM G+M+
Sbjct  135  EAAPSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLME  191



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN++DLG+ PH T+ +++ KYG ++ L +G+++T  ILSAKAA+ELFKNHD++FA+R 
Sbjct  43   ILGNLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVILSAKAASELFKNHDLTFAERF  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            +   M+V GY +G+LALAPYGSYWR+++R+ TV++ V K+INET  VRRKC+DDML WIE
Sbjct  103  LTITMRVHGYDQGSLALAPYGSYWRVMKRLVTVDMLVSKKINETAFVRRKCMDDMLRWIE  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             E+    +G G  VA FVFL + N LGNL+LS +LVDP S + ++FF ++TG+ +
Sbjct  163  GES---YKGCGSQVARFVFLMSTNLLGNLMLSCNLVDPESREGTQFFRSITGLTE  214



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 161/223 (72%), Gaps = 6/223 (3%)
 Frame = +2

Query  38   MEWERK-YLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQT  208
            M+WE   Y++ S I  +   +FL+ +K  S S Y LPPGP GLP+ GN  DL G+ P++ 
Sbjct  1    MDWEFNFYILCSTIIFLLAFIFLIYQKNSSFSKYNLPPGPNGLPIFGNXFDLAGSEPYKK  60

Query  209  IAEMKNKYGSVIWLTIG-SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
            IA +K+KYG ++WL IG S++   I ++ +++ELFK HDV+F+DR ++D      ++KG+
Sbjct  61   IASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNIVDVNLAHNFYKGS  120

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG-TGVH  562
            +ALAPYG+YWR  RRICTVE+FVHKRINET  +R+K ++ ML WIEK+ASS      G+ 
Sbjct  121  MALAPYGNYWRFSRRICTVEMFVHKRINETTLIRQKSMNRMLGWIEKKASSGGGVIEGIE  180

Query  563  VAHFVFLSTFNSLGNLILSRDLV-DPMSDKASKFFDAMTGIMQ  688
            V  +VFL++FN LGN+ILS+DLV DP S+K S FF+AM GIM+
Sbjct  181  VTRYVFLASFNMLGNMILSKDLVTDPESEKGSMFFNAMMGIME  223



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 150/219 (68%), Gaps = 3/219 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEW     +W AIFLI   +F + +++   + RLPPGP GLP+IGNM DLG  PH+ +A+
Sbjct  1    MEWPFSIPLW-AIFLIFLPIFTIIQQRIRTTRRLPPGPRGLPIIGNMFDLGTMPHRALAK  59

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +  K+G VIWL +GS     IL+A+ AAE FK+HD+SF DR + + M+V  YHKG+L LA
Sbjct  60   LGTKHGPVIWLRLGSQRIMVILTAEIAAEFFKHHDLSFVDRNINETMRVLDYHKGSLILA  119

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG--TGVHVAH  571
            PYG +WR+++++C +E+   KRI E+  VR KC+ D++ WIE  A     G    + VAH
Sbjct  120  PYGPHWRVMKKLCVIEMLTSKRIRESASVREKCVADLIKWIEDAARVDDDGEIQAIEVAH  179

Query  572  FVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            FVFL+ FN LGNL+LS++L+DP S + S+F+ AM G+ Q
Sbjct  180  FVFLAEFNLLGNLLLSKNLLDPSSMRGSEFYAAMNGLTQ  218



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 125/166 (75%), Gaps = 2/166 (1%)
 Frame = +2

Query  197  PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYH  376
            PH+T+A ++ KYG  IWL +GS+ T  ILS++ AAE FKN D++FADR VID ++ + YH
Sbjct  2    PHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYH  61

Query  377  KGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASS--VQRG  550
            +G++A+APYG+YWR++RR+ T ++ V KR+NET  VRRKC+++ML WI + ASS   Q G
Sbjct  62   EGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQVG  121

Query  551  TGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             G+H+A FVFL  FN L NL+LSRDL DP S   S+FF AM G+M+
Sbjct  122  EGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLME  167



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AAAE FK HD +FADRK
Sbjct  8    VIGNILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  67

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+   GY +G+LA+  YGSYWR+LRR+C+ EL V KR+NET  +R+KC+D+M +++E
Sbjct  68   CPHALTALGYDQGSLAIGRYGSYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMAMYLE  127

Query  524  KEASSVQRGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E ++ Q  T  G+ ++HF+FL TFN +GN++LSRDL+DP S    +FFDAM   M+
Sbjct  128  EEMAAKQVTTEQGIDLSHFLFLMTFNVVGNMVLSRDLLDPKSKDGPEFFDAMNWFME  184



>gb|KJB62266.1| hypothetical protein B456_009G409000 [Gossypium raimondii]
Length=512

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            M+    +L+   +F    L   + R+  S + +LPPGPPG P+ GNM DLG  PH+T+  
Sbjct  1    MDLSPSFLLCFIVFASSALFLFIQRRNNSVTGKLPPGPPGWPIFGNMFDLGTMPHRTLTR  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
            +++KYG VIWL +G+V+T  ILS KAA E FKN+D++FA+R + + M+  GYHK ++ALA
Sbjct  61   LRDKYGQVIWLRLGAVNTMVILSTKAATEFFKNYDLTFAERHITEIMRAHGYHKSSVALA  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRG----TGVHV  565
            PYGSYWR+LRR+ TV++ V+KRINET  VRRKC+DDML WIE EAS + RG     G+HV
Sbjct  121  PYGSYWRVLRRLVTVDMLVNKRINETACVRRKCLDDMLGWIEDEASKI-RGESNRNGIHV  179

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            A F+FL + N LGNL+LS+DL DP S + S+FF  +  +M
Sbjct  180  ARFMFLLSLNLLGNLMLSQDLFDPNSKEGSEFFLVILRLM  219



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 147/210 (70%), Gaps = 5/210 (2%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            LVW   FL+  LV ++++++   + + PPGPPG PVIGN+ DLG  PHQ++  +++KYG 
Sbjct  9    LVWGG-FLLAALVVMVSKRE---NKQRPPGPPGWPVIGNLFDLGTMPHQSLYHLRSKYGP  64

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            V+WL  GS++T  I S KAAA+LFKNHD++F+DRK    +K   Y +G LA   YG YWR
Sbjct  65   VLWLKFGSMNTMVIQSPKAAAQLFKNHDLNFSDRKCPGVLKAHDYFQGTLAFGRYGPYWR  124

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
            +LRR+C+ E+ V KRINE  P+R+KCID M+ WIEK+A   + G  V +  F+F  TFN 
Sbjct  125  VLRRLCSSEMLVTKRINEIAPLRQKCIDAMIGWIEKDAREKESGE-VKLPDFLFPMTFNV  183

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +GNL+LSRDL+D  S +   F++AM GIM+
Sbjct  184  VGNLMLSRDLLDLNSKEGHDFYNAMGGIME  213



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 147/215 (68%), Gaps = 5/215 (2%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKP--SCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKY  232
            L+W + F    L+ LL R KP    +   PPGP G P++GN+ DLG  PHQT+  ++++Y
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWPILGNIFDLGTMPHQTLYRLRSQY  63

Query  233  GSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSY  412
            G V+WL +G+++T  I SAK AAELFKNHD+ F+DRKV  A+    Y++G++A++ YG+Y
Sbjct  64   GPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGTY  123

Query  413  WRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTG-VHVAHFVFL  583
            WR LR++C+ EL V KRINE  P+R KC+D M+ WIE +A+   VQ G+G V V+H VF 
Sbjct  124  WRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDATMARVQGGSGEVEVSHLVFC  183

Query  584  STFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
              FN + NL+LSRD  D    + ++F+DAM  IM+
Sbjct  184  VAFNLIANLMLSRDFFDMKPKEGNEFYDAMNKIME  218



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +  ++ K+G V+WL +GSV+T  I SA+AA ELFK HD  FADRK
Sbjct  40   VIGNILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A    GY +G+LAL  +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  524  KEASSVQ--RGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  +G G+ ++HF+FL  FN +GN++LSRDL+DP S    +F+DAM   M+
Sbjct  160  EEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFME  216



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 147/215 (68%), Gaps = 5/215 (2%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKP--SCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKY  232
            L+W + F    L+ LL R KP    +   PPGP G P++GN+ DLG  PHQT+  ++++Y
Sbjct  4    LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWPILGNIFDLGTMPHQTLYRLRSQY  63

Query  233  GSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSY  412
            G V+WL +G+++T  I SAK AAELFKNHD+ F+DRKV  A+    Y++G++A++ YG+Y
Sbjct  64   GPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGTY  123

Query  413  WRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS--SVQRGTG-VHVAHFVFL  583
            WR LR++C+ EL V KRINE  P+R KC+D M+ WIE +A+   VQ G+G V V+H VF 
Sbjct  124  WRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDATMARVQGGSGEVEVSHLVFC  183

Query  584  STFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
              FN + NL+LSRD  D    + ++F++AM  IM+
Sbjct  184  VAFNLIANLMLSRDFFDMKPKEGNEFYBAMNKIME  218



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 141/196 (72%), Gaps = 2/196 (1%)
 Frame = +2

Query  95   VFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTT  274
            VF    KK S SY+LPPGP GLP++GNM DLG  PH  +  M+N+YG V+WL IG+++T 
Sbjct  20   VFFFLLKKTSRSYKLPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTL  79

Query  275  AILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFV  454
             I SA+AA   FKNHD +F +R V++  +V  Y +G+LALAPYG+YWRMLRRIC++ELFV
Sbjct  80   VIQSAQAATAFFKNHDANFLERVVVEVNRVCNYLQGSLALAPYGNYWRMLRRICSMELFV  139

Query  455  HKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDL-V  631
            H RIN +  +RRK +D M+ WIE      Q G G+ +  FVFL++FN LGNLI+S++L  
Sbjct  140  HSRINNSESIRRKSVDKMIQWIETHGKKEQ-GQGIEITRFVFLASFNMLGNLIMSKELAA  198

Query  632  DPMSDKASKFFDAMTG  679
            DP S  AS+FFDAM G
Sbjct  199  DPDSTTASEFFDAMMG  214



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AAAE FK HD +FADRK
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRK  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+   GY +G+LA+  YG YWR+LRR+C+ EL V KR+NET  +R+KC+D+M++++E
Sbjct  99   CPHALTALGYDQGSLAIGRYGGYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMVVYLE  158

Query  524  KEASSVQRGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  T  G+ ++HF+FL  FN +GN++LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFME  215



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+ DLG  PHQ +  ++ K+G V+WL +GSV+T  I SA+AA ELFK HD  FADRK
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A    GY +G+LAL  +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  524  KEASSVQ--RGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  +G G+ ++HF+FL  FN +GN++LSRDL+DP S    +F+DAM   M+
Sbjct  160  EEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFME  216



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+ DLG  PHQT+ +++ KYG V+WL +GS +T  I SA AA ELFKNHD SF DR 
Sbjct  42   VIGNIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNHDSSFCDRS  101

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
             +D +    Y KG+LA+  YG +WR+LRRICT+EL  +KR+NET P+RRKCID M+ +IE
Sbjct  102  SLDVLTSHNYCKGSLAIGRYGPFWRVLRRICTMELMTNKRVNETAPLRRKCIDQMIKYIE  161

Query  524  KE---ASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +    AS+ +  T V + H +FL+ FN +GNL LSRDL+DP   +   F+ AM   M
Sbjct  162  ENVAAASAREEATEVDLVHLLFLTAFNVVGNLTLSRDLLDPHCKEGHDFYKAMDKFM  218



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG   HQ +  ++ K+G V+WL +GSV+T AI SA+AA ELFK HD  FADRK
Sbjct  40   VIGNILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKGHDFVFADRK  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+   GY +G+LA+  YG YWR LRR+C+ ELFV+KR+N+   +R+KC+D M+++IE
Sbjct  100  CPHALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAHLRQKCVDSMIMYIE  159

Query  524  KEASSVQ--RGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  +  G+ ++HF+FL  FN +GN++LSRDL+DP S    +F+DAM  +M+
Sbjct  160  EEMAVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNLVME  216



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AAAE FK HD +FADRK
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+    Y +G+LA+  YG YWR+LRR+C+VE  V KR+NETV +R+KC+D++++++E
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETVHLRQKCVDNVIVYLE  158

Query  524  KEASSVQRGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  T  G+ ++HF+FL  FN +GN++LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFME  215



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 125/177 (71%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AA E FK HD +FADRK
Sbjct  39   VIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKGHDFAFADRK  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+    Y +G+LA+  YG YWR+LRR+C+VE  V KR+NET  +R+KC+D+M++++E
Sbjct  99   CPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETAHLRQKCVDNMVVYLE  158

Query  524  KEASSVQRGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  T  G+ ++HF+FL  FN +GNL+LSRDL+DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLFLMAFNVVGNLVLSRDLLDPKSKDGPEFFDAMNRFME  215



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 154/221 (70%), Gaps = 7/221 (3%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLL-TRKKP---SCSYRlppgppglpVIGNMMDLGAFPHQ  205
            MEW+   LV+S + L    + L+ +R KP   + S +LPPGPPG P+ GNM DLG+ P++
Sbjct  1    MEWDLILLVFSTVCLATAFLLLIPSRIKPKPNAGSRKLPPGPPGWPLFGNMFDLGSTPNE  60

Query  206  TIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
             +A +  KYG V+WL +G  +T  I S +AA E+FKNHD++F +R + +A++V  YH+GA
Sbjct  61   ALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRNITEALRVHSYHQGA  120

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHV  565
            ++   YG YWRMLRRI T ELF + RI+ +  +R+KC+D+M+ WI  E  S+++G  V +
Sbjct  121  ISTMNYGPYWRMLRRITTTELFSNNRIDNSENLRQKCVDNMIKWISNE--SMEKGV-VEI  177

Query  566  AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            AHF+ L +FN +GNL+LSRDLVDP S +A++FF A   ++Q
Sbjct  178  AHFISLMSFNVIGNLMLSRDLVDPSSIRAAEFFTAAEKVVQ  218



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 150/225 (67%), Gaps = 8/225 (4%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLL-----TRKKPSCSYRlppgppglpVIGNMMDLGAFPH  202
            MEW  K L    I +  GLV LL      R +   S R PPGPPG P+ GNM DLG  PH
Sbjct  1    MEWTLKSLNPITIAISAGLVILLLISFIKRSRNGSSKRKPPGPPGWPIFGNMFDLGDLPH  60

Query  203  QTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKG  382
            QT+  +++KYG VIWL +GS++T  + +A AAAELFK HDV FADRKV DA+    +++G
Sbjct  61   QTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKHDVPFADRKVPDALTAFEFNQG  120

Query  383  ALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG  556
            +L +  +G +WR+LRR+C++E  V+K++NET  +RR+  D+M+ WIE E  +S  Q G G
Sbjct  121  SLGMNTFGGHWRVLRRLCSMEFLVNKKMNETTDLRRRIEDNMIRWIEDECVSSKAQGGNG  180

Query  557  -VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             V ++  +FL  FN +GNL+LSRDL+D    ++ +FFD+M  I++
Sbjct  181  AVQLSRLLFLMAFNLVGNLMLSRDLLDNRDPESKEFFDSMNEILE  225



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 144/213 (68%), Gaps = 10/213 (5%)
 Frame = +2

Query  77   FLIPGLVFLLTRKK--PSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWL  250
            FL+P +V L  R++   S + RLPPGP G PV GNM +LG  PH+TIA +  ++G V+WL
Sbjct  11   FLVPFVVLLHYRRQRAGSSASRLPPGPRGWPVFGNMFELGPMPHKTIAGLSREHGPVVWL  70

Query  251  TIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRR  430
             IGS+ T  + +A AAA+LFKNHD SF +R + + M+  G+ + A++L+P G YWR ++R
Sbjct  71   RIGSIDTMVVQTAAAAADLFKNHDASFVERTITEVMRAHGFDRAAVSLSPPGPYWRAMKR  130

Query  431  ICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--------ASSVQRGTGVHVAHFVFLS  586
            + T E+ V KRI E+  VRR+C+ DM+ WI +E        AS    G GVHVA FVFL+
Sbjct  131  MMTAEMLVQKRIGESEAVRRRCVGDMVEWIGREAGKGNAVRASRTCDGGGVHVARFVFLA  190

Query  587  TFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +FN L NL+LS+DLV P +++ S+FF AM  +M
Sbjct  191  SFNMLANLMLSQDLVSPDAEEGSEFFAAMIELM  223



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 137/195 (70%), Gaps = 15/195 (8%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
            + R+  S ++ LPPGPPG P+ GNM DLG  PH+T+ E+  K+G VIWL +G+ +T ++ 
Sbjct  23   IRRRSKSGNHLLPPGPPGWPIFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQ  82

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            SAKAA+E FKNHD+SFA+R   +  +V  YHKG               R+ TV++ V+KR
Sbjct  83   SAKAASEFFKNHDLSFANRTTNEVCRVYDYHKG---------------RLMTVDMVVNKR  127

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            INET  VRRKC D++ LWIE+EAS ++ G GVHVA FVFL TFN LGNL+LSRDLVDP S
Sbjct  128  INETAFVRRKCFDNLQLWIEEEASKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKS  187

Query  644  DKASKFFDAMTGIMQ  688
            ++  +FF AM G+M+
Sbjct  188  NEGLEFFKAMNGLME  202



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 124/177 (70%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AAAE FK HD +FADRK
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               AM    Y +G+LA+  YG YWR+LRR+C+VEL V KR+NET  +R+KC+D+M+ ++E
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKCVDNMVAYLE  158

Query  524  KEASSVQRGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E +  Q  T  G+ ++HF+ L  FN +GN++LSRDL DP S    +FFDAM   M+
Sbjct  159  EEMAVKQVTTEQGIDLSHFLLLMGFNVVGNMVLSRDLWDPKSKDGPEFFDAMNRFME  215



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 139/212 (66%), Gaps = 4/212 (2%)
 Frame = +2

Query  65   WSAIFLIPGLVFL-LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSV  241
            WS  F    L+FL L +     +   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLHRLRPQHGPV  70

Query  242  IWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRM  421
            +WL +G+++T  + SAKAAAELFKNHD+ F+DR V   +    Y +G++AL  YG YWRM
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLPFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  422  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS---SVQRGTGVHVAHFVFLSTF  592
            +R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+   +  R   V + HF+F   F
Sbjct  131  IRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAF  190

Query  593  NSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N +GN+ LSRD+VD  S    +FF AM G+M+
Sbjct  191  NLIGNITLSRDVVDIKSKDGHEFFQAMNGVME  222



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 140/212 (66%), Gaps = 4/212 (2%)
 Frame = +2

Query  65   WSAIFLIPGLVFL-LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSV  241
            WS  F    L+FL L +     +   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  11   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  70

Query  242  IWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRM  421
            +WL +G+++T  + SAKAAAELFKNHD+SF+DR V   +    Y +G++AL  YG YWRM
Sbjct  71   LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  130

Query  422  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS---SVQRGTGVHVAHFVFLSTF  592
            +R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+   +  R   V + HF+F   F
Sbjct  131  IRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAF  190

Query  593  NSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N +GN+ LSRD+VD  S    +FF AM G+++
Sbjct  191  NLIGNITLSRDVVDIKSKDGHEFFQAMNGVVE  222



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = +2

Query  68   SAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIW  247
            SA FL+  L+ +  + +   S R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  248  LTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLR  427
            L +GS++T  + +A +AAELFK HDV F DRKV D +    +++G+L +  YG +WR+LR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  134

Query  428  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNS  598
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FN 
Sbjct  135  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  194

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +GNL+LSRDL+D    +  +FFD M  I++
Sbjct  195  VGNLMLSRDLMDNKDPEGREFFDCMNEILE  224



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = +2

Query  68   SAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIW  247
            SA FL+  L+ +  + +   S R PPGPPG P+ GNM DLG  PHQT+ ++K+KYG ++W
Sbjct  17   SAGFLL--LLIIFVKSRTGSSKRKPPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVW  74

Query  248  LTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLR  427
            L +GS++T  + +A +AAELFK HDV F DRKV D +    +++G+L +  YG +WR+LR
Sbjct  75   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  134

Query  428  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNS  598
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FN 
Sbjct  135  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  194

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +GNL+LSRDL+D    +  +FFD M  I++
Sbjct  195  VGNLMLSRDLMDNKDPEGREFFDCMNEILE  224



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 133/177 (75%), Gaps = 4/177 (2%)
 Frame = +2

Query  170  GNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGS-VSTTAILSAKAAAELFKNHDVSFADRK  343
            GNM DL G+ P++ IA +K KYG ++WL IGS ++T  I +A +A+ELF+NHDVSF+DR 
Sbjct  2    GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP  61

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDML-LWI  520
            ++D      Y+KG++ALAPYG+YWR  RRICTVE+FVHKRINET  +R++ +D ML L  
Sbjct  62   IVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDE  121

Query  521  EKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLV-DPMSDKASKFFDAMTGIMQ  688
            EK +SS   G G+ V  ++FL++FN +GN+I S+DLV DP S + S+FF+AM GIM+
Sbjct  122  EKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIME  178



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 147/210 (70%), Gaps = 5/210 (2%)
 Frame = +2

Query  68   SAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIW  247
            S  FL+  ++F+  R++   S R PPGPPG P+ GNM DLG  PHQT+ ++++KYG ++W
Sbjct  16   SVGFLLLLVIFVKARRR--SSKRTPPGPPGWPIFGNMFDLGDLPHQTLYKLRSKYGPIVW  73

Query  248  LTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLR  427
            L +GS++T  + +A +AAELFK HDV F DRKV D +    +++G+L +  YG +WR+LR
Sbjct  74   LQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLR  133

Query  428  RICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNS  598
            R+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FN 
Sbjct  134  RLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNL  193

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +GNL+LSRDL+D    +  +FFD M  I++
Sbjct  194  VGNLMLSRDLLDNKDPEGREFFDCMNEILE  223



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 149/223 (67%), Gaps = 6/223 (3%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLT---RKKPSCSYRlppgppglpVIGNMMDLGAFPHQT  208
            MEW    +    I +  G + LL    + +   S R PPGPPG P+ GNM DLG  PHQ+
Sbjct  1    MEWTFDSVNSVTIAVSAGFLLLLVSFVKARSGSSKRRPPGPPGWPIFGNMFDLGDLPHQS  60

Query  209  IAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            + ++++KYG ++WL +GS++T  + +A +AAELFK HDV F DRKV D +    +++G+L
Sbjct  61   MYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPDTLTAFDFNRGSL  120

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-V  559
             +  YG +WR+LRR+C++E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V
Sbjct  121  GMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKAQGGTGAV  180

Query  560  HVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             ++ F+FL  FN +GNL+LSRDL+D    ++ +FFD M  I++
Sbjct  181  QLSRFLFLMAFNLVGNLMLSRDLLDSKDPESREFFDCMNEILE  223



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 127/178 (71%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GNM DLG  PHQT+ + ++KYG V+WL +GS++T  + +A +AAELFK HDV F+DRK
Sbjct  46   IFGNMFDLGDLPHQTLYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKHDVPFSDRK  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V D +    +++G+L +  YG +WR+LRR+C++E  V+KR+NET  +RR+  D+M+ WIE
Sbjct  106  VPDTLTAFQFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIE  165

Query  524  KE--ASSVQRGTG-VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++  AS  Q GTG V ++ F+FL  FN +GNL+LSRDL+D    +  +FFD M  I++
Sbjct  166  EDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDCMNEILE  223



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = +2

Query  89   GLVFLLT---RKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIG  259
            G +FLL    + +   S R PPGPPG PV GNM DLG  PHQT+ ++++KYG ++WL +G
Sbjct  18   GFLFLLAIFLKSRTGSSKRRPPGPPGWPVFGNMFDLGDLPHQTLYKLRSKYGPIVWLQLG  77

Query  260  SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICT  439
            S++T  + +A AA ELFK HDV F DRKV D +    ++  +L +  YG +WR+LRR+C+
Sbjct  78   SINTMVVQNAVAAGELFKKHDVPFCDRKVPDTLTTFNFNSSSLGMNTYGGHWRVLRRLCS  137

Query  440  VELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG-VHVAHFVFLSTFNSLGNL  610
            +E  V+KR+NET  +RR+  D+M+ WIE++  AS  Q GTG V ++ F+FL  FN +GNL
Sbjct  138  MEFLVNKRMNETTDLRRRIEDNMVRWIEEDSLASKSQGGTGAVQLSRFLFLMAFNLVGNL  197

Query  611  ILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +LSRDL+D    ++ +FFD+M  I++
Sbjct  198  MLSRDLLDNKDPESREFFDSMNEILE  223



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 143/222 (64%), Gaps = 4/222 (2%)
 Frame = +2

Query  35   EMEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQTI  211
            E  +    L W  +     +  LLT+++P    +  P  P   P+IGN+ DLGA PHQ +
Sbjct  2    EFRYSTYSLAWFTLLFSVTIAVLLTKRRPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNL  61

Query  212  AEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             ++  KYG V+WL +G ++T  I SAKAA ELF++HD+SF DRKV  +     Y K ALA
Sbjct  62   YKLGIKYGPVLWLRLGYINTMVIQSAKAAEELFRHHDISFCDRKVPQSFTACNYSKAALA  121

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTG--VH  562
            L  Y S+WR  RR  T+EL  +KRINET  +R+KCID M+ +IE++AS+ + RG    + 
Sbjct  122  LGRYDSHWRFHRRFVTLELMTNKRINETAVLRQKCIDKMIQYIEEDASAARARGESGELV  181

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++H+VF+ +FN +GNL  SRDL++  S++ ++FFDAM  +M+
Sbjct  182  ISHYVFVMSFNLIGNLAFSRDLLNSHSEEGTEFFDAMDKVME  223



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/214 (45%), Positives = 142/214 (66%), Gaps = 4/214 (2%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQTIAEMKNKYG  235
            L W  +     +V LL +++P    +  P  P   P+IGN+ DLGA PHQ + ++  KYG
Sbjct  10   LAWFTLLFSVTIVVLLKKRRPRHDAKQRPPGPPAWPIIGNIFDLGANPHQNLYKLGFKYG  69

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             V+WL +G ++T  I SAKAA ELFK+HD+SF DRKV  +   + Y K ALAL  Y S+W
Sbjct  70   PVLWLRLGYINTMVIQSAKAAEELFKHHDISFCDRKVPQSFTARNYCKAALALGRYDSHW  129

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTG--VHVAHFVFLS  586
            R  RR  T+EL  +KRINET  +R+KCID M+ +I+++AS+ + RG    + ++H+VF+ 
Sbjct  130  RFHRRFVTLELMTNKRINETAVLRQKCIDKMIRYIDEDASAARARGESGELVISHYVFVM  189

Query  587  TFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +FN +GNL LSRDL++  S++ ++FFDAM   M+
Sbjct  190  SFNLIGNLALSRDLLNSHSEEGTEFFDAMDKAME  223



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 146/224 (65%), Gaps = 5/224 (2%)
 Frame = +2

Query  32   KEMEWE-RKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppgl-pVIGNMMDLGAFPHQ  205
            KEM+     +LV   +  +  +V LL +++P  + +  P  P   P+IGN+ DLG  PHQ
Sbjct  3    KEMDGSYSNFLVRFTLLFVLTIVVLLKKRRPRHNAKQRPPGPPAWPIIGNIFDLGGNPHQ  62

Query  206  TIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGA  385
             + +++ KYG V+WL +G ++T  I S KAA ELFK HD+SF+DRKV  +     ++K +
Sbjct  63   NLYKLRFKYGPVLWLRLGCINTLVIQSTKAAEELFKRHDISFSDRKVPQSFTAHNFNKAS  122

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTGVH  562
            LAL  Y S+WR  RR  T+EL   KR++ET  +R+KCID+M+ +IE +AS+ + RG    
Sbjct  123  LALGQYDSHWRFHRRFVTLELMTKKRVHETAAIRQKCIDNMIRYIEDDASAARARGESGE  182

Query  563  --VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
              ++H VF+ +FN +GNL+LSRDL++  S++ +KFFDAM   M+
Sbjct  183  LVISHHVFVLSFNLIGNLVLSRDLLNSHSEEGTKFFDAMGKAME  226



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN  DLG  PHQ++ +++ KYG V+WL +GSV+T  I SAKAA E+FKN D  F DRK
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+  + Y++G+LA   YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  524  KEASSVQ-RGTG--VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             + +  Q RG    V ++H++FL  F+ +GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN  DLG  PHQ++ +++ KYG V+WL +GSV+T  I SAKAA E+FKN D  F DRK
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+  + Y++G+LA   YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  524  KEASSVQ-RGTG--VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             + +  Q RG    V ++H++FL  F+ +GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN  DLG  PHQ++ +++ KYG V+WL +GSV+T  I SAKAA E+FKN D  F DRK
Sbjct  46   IFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRK  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+  + Y++G+LA   YG YWR+LRR+C  EL V++RINET P+RRKCID  +  IE
Sbjct  106  VPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIE  165

Query  524  KEASSVQ-RGTG--VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             + +  Q RG    V ++H++FL  F+ +GNL LSR+L++  S +  +FF AM   M+
Sbjct  166  NDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCME  223



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 140/220 (64%), Gaps = 5/220 (2%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLT--RKKPSCSYRlppgppglpVIGNMMDLGAFPHQTI  211
            MEW    L     FL    VFLL   RK  S +   PPGP    + GN+ +LG  PHQ +
Sbjct  1    MEWRYSNLFTWFSFLFLATVFLLLKHRKSKSGAKLRPPGPKPWLIFGNIFNLGTTPHQNL  60

Query  212  AEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALA  391
             + + KYG ++WL +GS++T  I SAKAA ELFKNHD SF DRKV +      Y++ +++
Sbjct  61   YKYRFKYGPILWLRLGSINTLVIQSAKAAEELFKNHDFSFCDRKVPECYTAHNYNQSSVS  120

Query  392  LAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQ-RGTG--VH  562
            L  YGS WR  RR+ TVEL  +KRIN+T  +R+KC+++ML +IE++ SS Q RG    V 
Sbjct  121  LGQYGSRWRFHRRLVTVELMTNKRINDTTSIRQKCVNNMLQFIEEDISSAQARGESMEVE  180

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            VA +VF+ +FN +GNL+LS DL++  S +  +FFDA+  +
Sbjct  181  VARYVFIMSFNLIGNLVLSWDLLNSQSKEGPEFFDALNKV  220



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V GNM +LG  PHQT+ ++++KYG ++WL +GS+ T  + S  AAAELFK HDV+F+DRK
Sbjct  46   VFGNMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKHDVAFSDRK  105

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+    ++ G+L +  YG +WR+LRR+C++E  V+KR+N+T  +RR+ +D+M+ WIE
Sbjct  106  VPDALTAFNFNAGSLGMNAYGGHWRVLRRLCSMEFLVNKRMNDTTALRRRIMDNMVHWIE  165

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+    R   V ++ F+FL  FN +GNL+LSRDL++    +  +FFD+M  +++
Sbjct  166  EESQGGTR--EVQLSRFLFLMAFNLVGNLMLSRDLLNAGDPEGREFFDSMNKVLE  218



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 128/178 (72%), Gaps = 3/178 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN++ LG+ PH+T+  ++ KYG V+WL++G  +T  I SAKAA ELFKNHD++F+DRK
Sbjct  47   IFGNILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNHDITFSDRK  106

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V ++     Y++G+LA   YGSYW+ LRR  TVEL   K+IN++  +R+KCID M+ +IE
Sbjct  107  VPESWTAHNYYQGSLAFGRYGSYWQFLRRTVTVELMTSKKINDSALIRQKCIDKMIEYIE  166

Query  524  KE-ASSVQRGTG--VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++ A++  +G    V VA +VF+  FN +GNL+LS+DL++  S + ++FFDAM  +M+
Sbjct  167  EDVATANAKGDSGEVVVARYVFVMAFNLIGNLVLSKDLLNAQSKEGTEFFDAMDKVME  224



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = +2

Query  167  IGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKV  346
            +GN+ DLG  PHQT  +++ KYG VIWL +G+V+T  + SA+ A ELFK  D+ FADRK 
Sbjct  45   VGNIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADRKA  104

Query  347  IDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  526
             D++    YH+G++A+  Y  YWR LRRIC  E  VHKR++ ++P+RR C++  + WI++
Sbjct  105  PDSLTALDYHQGSVAIGAYREYWRTLRRICMTEFLVHKRVDASIPIRRNCLEKTIKWIKE  164

Query  527  EASSVQRGTG---VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDA  670
            +    ++  G   + +  F+FL++FN +GNL+LSR++++   DKA +FFDA
Sbjct  165  DVEKSKKNGGSGEIQLDRFLFLNSFNIIGNLMLSREVMESKLDKAGEFFDA  215



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 3/177 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN+ DLG   H+ + E+K KYG V+ L +GSV T  I SAKAA ELFKNHD SF DR 
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V   +    Y  G+LAL  +G YWR LRRIC +EL  ++R+NETV +RRKCID M+  IE
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMIRSIE  163

Query  524  KE--ASSVQRGTG-VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             +  A      +G VH+ H++F+ TFN +GNL+LS+DL D    +  +FF+AM  +M
Sbjct  164  DDMAAGKASGESGIVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 116/177 (66%), Gaps = 3/177 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN+ DLG   H+ + E+K KYG V+ L IGSV T  I SAKAA ELFKNHD SF  R 
Sbjct  44   LVGNIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNHDASFCART  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V        Y +G+LAL  +G YWR LRRIC +EL  ++RINETV +RRKCID M+  IE
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMIRSIE  163

Query  524  KE--ASSVQRGTG-VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             +  A      +G VH+ H++FL +FN +GNL+LS+DL D    +  +FF+AM  +M
Sbjct  164  DDMAAGKASGESGKVHIPHYLFLMSFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 142/220 (65%), Gaps = 3/220 (1%)
 Frame = +2

Query  38   MEWERKYLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAE  217
            MEW    +   AI +  GL+ L+   +P  S + PPGP G+P+ GN++ LG  PH+T+ +
Sbjct  1    MEWALTSINPLAISIFAGLLLLVLFLRPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHK  60

Query  218  MKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALA  397
             K  YG VIWL +GSV T  +  A +A+ELFK HD+ FADRKV D +    +++G L + 
Sbjct  61   WKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADRKVPDVLTAYDFNQGTLGMN  120

Query  398  PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI--EKEASSVQRGTG-VHVA  568
             +G +WR+LRR+C++E  V+KR+NET  +R +  ++M  WI  E  A+  Q GTG + ++
Sbjct  121  QFGGHWRVLRRLCSMEFLVNKRMNETTELRHRIRENMERWILEESAAARAQGGTGAIQLS  180

Query  569  HFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             F+FL  FN +GNL+LSRDL+D    ++ +FFD M  +++
Sbjct  181  RFLFLLAFNLVGNLMLSRDLLDAKDPESREFFDCMNKVLE  220



>gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 113/174 (65%), Gaps = 3/174 (2%)
 Frame = +2

Query  173  NMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVID  352
            N+ DLG   H+ + E+K KYG V+ L IG V T  I SAKA  ELFKNHD SF DR V  
Sbjct  47   NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRTVPC  106

Query  353  AMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEA  532
             +    Y +G++A+  +G YWR +RRIC +EL  ++RINETV +RRKCID M+  IE + 
Sbjct  107  VLTSHNYKEGSIAVGRFGPYWRTIRRICAIELLANRRINETVQIRRKCIDVMIRSIEDDM  166

Query  533  SSVQ---RGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            ++ +       VH+ H++F+ TFN +GNL+LS+DL D    +  +FF+AM  +M
Sbjct  167  AAGKASGESGKVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVM  220



>ref|XP_006381328.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
 gb|ERP59125.1| hypothetical protein POPTR_0006s11830g, partial [Populus trichocarpa]
Length=343

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 120/178 (67%), Gaps = 11/178 (6%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V GN+ DLGA PHQT+ ++K KYG VIWL +G  +T  I SA+ AA LFKNHD++F+DRK
Sbjct  19   VFGNIFDLGAIPHQTLYKLKEKYGPVIWLKLGYTNTLVIQSAETAAGLFKNHDLAFSDRK  78

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+       Y++G+LALA       +L +    +  + K+I++T  +R+KCIDDM+ +IE
Sbjct  79   VLLVFTAHNYYQGSLALA------SLLNKAH--DKLITKQIDQTAVLRQKCIDDMIRYIE  130

Query  524  KEASSVQ-RGTGVHV--AHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++ +  Q +G    +  AH++FL TFN +GNL+LSRDLV+P S    KF+DAM  +M+
Sbjct  131  EDVAEAQAQGESGEIKGAHYLFLMTFNLIGNLVLSRDLVNPRSKDGHKFYDAMNNVMK  188



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN+ DLG  PH+ + + + KYG V+WL +G  +T  I SA+AA ELFKNHD+SF DRK
Sbjct  56   IFGNIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDRK  115

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V D      Y +GA++L  YGS WR  RR+ T++L  +KRI E+  +R KCI+ M+ +IE
Sbjct  116  VPDCCTAHNYDQGAVSLGRYGSIWRFHRRLITLDLMTNKRIKESAFLRIKCINSMIQYIE  175

Query  524  KEASSVQ-RGT--GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            ++ ++ + RG    V +AH++F+ TFN +GNL+LS+DL +  S++  +F  AM  I
Sbjct  176  EDTAAARARGELGEVVIAHYLFVMTFNLIGNLVLSQDLANSQSNEGLEFSHAMDKI  231



>gb|KCW84357.1| hypothetical protein EUGRSUZ_B012102, partial [Eucalyptus grandis]
Length=166

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + ++G V WL +GSV+T  I SA+AAAE FK HD++FADRK
Sbjct  40   VIGNILDLGIMPHQNLHSFRAEHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDLAFADRK  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A+   GY +G+LA+  YG YWR+LRR+C+VEL V KRINET  +R+KC+D M+ ++E
Sbjct  100  CPHALTALGYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRINETAHLRQKCVDSMIGYLE  159

Query  524  KEASSVQ  544
            +E ++ Q
Sbjct  160  EEMAAKQ  166



>gb|KCW84346.1| hypothetical protein EUGRSUZ_B011962, partial [Eucalyptus grandis]
Length=169

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+ DLG  PHQ +  ++ K+G V+WL +GSV+T  I SA+AA ELFK HD  FADRK
Sbjct  40   VIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRK  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               A    GY +G+LAL  +G YWR LRR+C+ EL V+KR+N+T  +R+KC+D M+++IE
Sbjct  100  CSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIE  159

Query  524  KEASSVQ  544
            +E +  Q
Sbjct  160  EEMAVKQ  166



>ref|XP_008241321.1| PREDICTED: cytochrome P450 76A1 [Prunus mume]
Length=516

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 132/212 (62%), Gaps = 2/212 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLG-AFPHQTIAEMKNKYG  235
            L+W A+ +I  +  L  R+    +  LPPGP   PV+GN+  LG   PH++ A +   +G
Sbjct  3    LIWVALSIILLVTHLRRRRLEEVAGHLPPGPRWWPVVGNIFQLGLGPPHESFAILARNHG  62

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             ++ L +GS+ST  I S++ A E+FKNHDV  A RK+ +AMK    ++G+L  A YG +W
Sbjct  63   PIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGRKIYEAMKGDYGNEGSLITAQYGPHW  122

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTF  592
            RMLRR+CT E FV  R++    VR KCID M+ +IE  AS +   T G+ +  F+FL  F
Sbjct  123  RMLRRLCTTEFFVTSRLDAMCRVRAKCIDGMVQFIEDAASEMSTKTDGIDLGRFIFLMAF  182

Query  593  NSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N +GNL+ S+DL+DP S++ + FF     +M+
Sbjct  183  NLIGNLMFSKDLLDPKSERGAMFFYHAGKVME  214



>emb|CBI30229.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +2

Query  65   WSAIFLIPGLVFL-LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSV  241
            WS  F    L+FL L +     +   PPGP G P+ GN+ DLG  PHQT+  ++ ++G V
Sbjct  58   WSCFFSAALLLFLRLIKFTKGSTKSTPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPV  117

Query  242  IWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRM  421
            +WL +G+++T  + SAKAAAELFKNHD+SF+DR V   +    Y +G++AL  YG YWRM
Sbjct  118  LWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRM  177

Query  422  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS  535
            +R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+
Sbjct  178  IRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAA  215



>gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza]
Length=503

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 132/205 (64%), Gaps = 3/205 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            L W  I  +  L+F    K  S   RLPPGPPG P+IGN+ DLG  PH+    ++++YG 
Sbjct  7    LTWFTISFLVALLFWFKLKNRSSKLRLPPGPPGWPIIGNIFDLGTQPHRDFHILQSRYGP  66

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            V+WL +G+++T  + SA AAAELFK +D++FADRK  D+M    Y  G+LA APY  YWR
Sbjct  67   VLWLKLGNLNTVVVQSAAAAAELFKRNDLAFADRKTPDSMTACDYINGSLAQAPYNEYWR  126

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
            +LRR+ + EL V KRIN +   R+KCID M+ WI ++AS       + +  ++ + +FN 
Sbjct  127  ILRRLSSSELMVQKRINSSAQQRKKCIDKMIQWIREDASEFGE---IQLDRYLLIMSFNL  183

Query  599  LGNLILSRDLVDPMSDKASKFFDAM  673
            + N +L+RD++D  S+  ++F +AM
Sbjct  184  VSNFMLTRDIMDFKSEMGNEFLEAM  208



>ref|XP_007201998.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
 gb|EMJ03197.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
Length=528

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 114/177 (64%), Gaps = 2/177 (1%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            ++GN+  LG   PH++ A +   +G ++ L +GS+ST  I S++ A E+FKNHDV  A R
Sbjct  50   MVGNIFQLGLGPPHESFAMLARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGR  109

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK    ++G+L  A YG +WRMLRR+CT E FV  RI+    VR KCID M+ +I
Sbjct  110  KIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRIDAMCRVRAKCIDGMVQFI  169

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            E  AS +   T G+ +  F+FL  FN +GNL+ S+DL+DP S++ + FF     +M+
Sbjct  170  EDAASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSKDLLDPKSERGAMFFYHAGKVME  226



>ref|XP_011466802.1| PREDICTED: cytochrome P450 76A1-like [Fragaria vesca subsp. vesca]
Length=528

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 115/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  LG A PH++ A +  K+G ++ L +GS++T  I S+  A E+FKNHDV  A R
Sbjct  46   VVGNIFQLGWAPPHESFAILARKHGPIMTLWLGSMTTVVISSSNVAREMFKNHDVVLAGR  105

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK    ++G+L  A YGS+WRMLRR+C  E FV  R++    VR +CID M+ +I
Sbjct  106  KIYEAMKGDYGNEGSLITAQYGSHWRMLRRLCNTEFFVSSRLDAMRGVRGRCIDRMVQFI  165

Query  521  EKEASSVQRGTGVH-----VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            E  ++S +   GV+     V  F FL  FN +GNL+ S+DL+DP S++ + FF     +M
Sbjct  166  EDASTSDKSDNGVNVKSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSERGAGFFYHAGNVM  225

Query  686  Q  688
            +
Sbjct  226  E  226



>ref|XP_008392536.1| PREDICTED: cytochrome P450 76A1 [Malus domestica]
Length=529

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  LG   PH+++A +   +G ++ L +GS+ST  I S++ A E+FKNHDV+ A R
Sbjct  50   VVGNIFQLGLGPPHESLAVLARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVALAGR  109

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK    ++G+L  A YG +WRMLRR+CT E FV  R++    VR KCID ML +I
Sbjct  110  KIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRLDAMRGVRGKCIDGMLQFI  169

Query  521  ----EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
                 + +S +   T G+ +  F+FL  FN +GNLI S+DL+DP S++ + FF     +M
Sbjct  170  MDASSRTSSEISASTDGIDLGRFIFLMAFNLIGNLIFSKDLLDPKSERGAMFFYHAGKVM  229

Query  686  Q  688
            +
Sbjct  230  E  230



>ref|XP_004246575.1| PREDICTED: cytochrome P450 76A1-like [Solanum lycopersicum]
Length=514

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++ N+   G  PH + A++ NK+G ++ L +GS++T  I S + A E+FKNHD+  A RK
Sbjct  44   LLANIFQSGFAPHVSFAKLANKHGPMMTLWLGSMTTIVISSNEVAREMFKNHDIVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + ++MK    ++G+L    YG  WRMLRR+CT E F+  R++    VR KCID ML ++E
Sbjct  104  IYESMKGDIGNEGSLITNQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMLEFME  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
              A+S    T + V  F FL +FN +GNL++S+DLVDP SD+ +KFF     +M+
Sbjct  164  DAANSST--TSIDVGRFFFLMSFNLIGNLMISKDLVDPTSDRGAKFFYHAGKVME  216



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 112/175 (64%), Gaps = 19/175 (11%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN++DLG+ PH+T+ +++ KYG V+WL +G  +T  I SAKAA ELFKNHD++F+DRK
Sbjct  47   IFGNILDLGSMPHRTLYKLRFKYGPVLWLRLGCANTLVIQSAKAAEELFKNHDITFSDRK  106

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V ++     Y++G+L+L  YGSYWR LRRI TVEL   K+INE+  +R+KCID M  +IE
Sbjct  107  VAESWTAHNYYQGSLSLGRYGSYWRFLRRIVTVELMTSKKINESTLIRQKCIDKMTEYIE  166

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++ ++                  N+ G+     DL++  S + ++F  AM  +M+
Sbjct  167  EDVAAA-----------------NAKGD--SGEDLLNARSKEGTEFSGAMDEVME  202



>gb|EYU38602.1| hypothetical protein MIMGU_mgv1a006828mg [Erythranthe guttata]
Length=430

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  278  ILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVH  457
            + SA+AAAELFK +D+ +ADRKV D++    YHKG++A+  YG+YWR LRRICT E  VH
Sbjct  3    VQSAEAAAELFKKYDLPYADRKVPDSLTALDYHKGSVAIGAYGAYWRKLRRICTTEFLVH  62

Query  458  KRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDP  637
            KR+N ++ +R+KCIDD++ WI++E+     G G+ +  F+F+++FN++GN++LS+D+V  
Sbjct  63   KRVNASMKLRQKCIDDLVGWIKEESEKEYSGGGIRLDRFLFVTSFNAIGNIMLSKDVVQS  122

Query  638  MSDKASKFFD  667
                +S+FFD
Sbjct  123  KEKVSSEFFD  132



>ref|XP_007027586.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY08088.1| Cytochrome P450 [Theobroma cacao]
Length=1008

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A++  ++G ++ L +GS+ST  I S + A E+FKNHDV  A RK
Sbjct  43   VVGNIFQLGWAPHESFAKLARQHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    H+G+L  + YGS+WRMLRR+CT E FV  R++    VR +C+D M+ ++E
Sbjct  103  IYEAMKGDFGHEGSLITSQYGSHWRMLRRLCTTEFFVTSRLDAMQGVRERCVDRMVQFVE  162

Query  524  KEASSVQRGTG-VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
               ++   GT  V V  F FL  FN +GNLI S+DL+D  S++ +KFF     +M+
Sbjct  163  GAGAN---GTNSVDVGRFFFLMAFNLIGNLIFSKDLLDTKSERGAKFFYHAGKVME  215


 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 102/169 (60%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  VIGNMMDLG--AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFAD  337
            V GN+  L     PH +I ++  ++G +  L +GS+ T  I S + A E+FKNHDV  A 
Sbjct  542  VAGNIFQLSWREPPHLSITKLACQHGPITTLWLGSMCTVVISSGEVAREMFKNHDVVLAG  601

Query  338  RKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            RK+ ++MK    ++G++  + YGS+WRMLRR+CT+E FV  R++    VR KC+D M+ +
Sbjct  602  RKIYESMKGNYGNEGSIITSQYGSHWRMLRRLCTMEFFVSSRLDAMKGVRSKCVDQMVEF  661

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
            I+   +S      + +  F  L TFN +GNL+ S DL+DP S++ +   
Sbjct  662  IQN--ASAFGTNAIDIGRFFLLLTFNLIGNLLFSYDLLDPKSERGANLL  708



>gb|KCW84356.1| hypothetical protein EUGRSUZ_B01208 [Eucalyptus grandis]
Length=441

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN++DLG  PHQ +   + K+G V WL +GSV+T  I SA+AAAE FK HD +FADRK
Sbjct  39   VIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRK  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
               AM    Y +G+LA+  YG YWR+LRR+C+VEL V KR+NET  +R+KC+D+M+ ++E
Sbjct  99   CPHAMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKCVDNMVAYLE  158

Query  524  KEASSVQ  544
            +E +  Q
Sbjct  159  EEMAVKQ  165



>gb|KJB46481.1| hypothetical protein B456_007G371400 [Gossypium raimondii]
Length=513

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  LG A PH + A++  ++G ++ L +GS+ST  I S + A E+FKNHDV  A R
Sbjct  44   VVGNIFQLGLAPPHVSFAKLACRHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGR  103

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK    H+G+L  + YG +WRMLRR+CT E FV  R++    VRR+CID ML  +
Sbjct  104  KIYEAMKGDFGHEGSLITSQYGPHWRMLRRLCTTEFFVTSRLDAMRGVRRRCIDQMLQSV  163

Query  521  EKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +   +S      + V  FVFL  FN +GNLI S+DL+D  S+K  KFF     +M+
Sbjct  164  QD--ASANGTNPIDVGRFVFLMAFNLIGNLIFSKDLLDHKSEKGVKFFYHAGKVME  217



>ref|XP_002528643.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33746.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 116/176 (66%), Gaps = 4/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GNM  LG  PH++ A++   +G ++ + +GS+ T  I S +AA ++FKNHD+  A RK
Sbjct  45   IVGNMFQLGWSPHESFAKLARIHGPIMTIWLGSMCTVVISSDRAAHDMFKNHDMVLAGRK  104

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  + YGS+WRMLRR+C+ E FV  R++    VR +CID M+ +IE
Sbjct  105  IYEAMKGDIGNEGSIITSQYGSHWRMLRRLCSTEFFVTSRLDAMRGVRSRCIDGMVQFIE  164

Query  524  KEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             EAS    GT  + V  F FL +FN +GNL+ S+DL+DP S+K SKFF     +M+
Sbjct  165  -EASG--NGTQAIDVGRFFFLMSFNLIGNLLFSKDLLDPKSEKGSKFFYHAGKVME  217



>ref|XP_009613392.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=453

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +2

Query  347  IDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  526
            +D   V  Y+  +LALAPYG+YWRMLRRICT E+F +KRINETV +RRKCID ML WI+K
Sbjct  45   VDLEVVHNYNSSSLALAPYGTYWRMLRRICTTEMFTNKRINETVHLRRKCIDYMLQWIDK  104

Query  527  EASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            EA+S++ G GV V+ FV+L++FN +GNL+LS DLVDP S  AS FF  +  +++
Sbjct  105  EANSLENGKGVEVSRFVYLASFNMIGNLMLSHDLVDPESKTASDFFTTLKKVIE  158



>ref|XP_006341260.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=509

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 111/175 (63%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++ N+   G  PH + A++ NK+G ++ L +GS++T  I S + A E+FKNHD+  A RK
Sbjct  44   LVTNIFQSGFAPHVSFAKLANKHGPIMTLWLGSMTTVVISSNEVAREMFKNHDIVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + ++MK    ++G+L    YG  WRMLRR+CT E F+  R++    VR KCID M+ ++E
Sbjct  104  IYESMKGDIGNEGSLITNQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMIKFME  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
               +S    T + V  F FL +FN +GNL++S+DLVDP SD+ +KFF     +M+
Sbjct  164  DAGNSGT--TSIDVGRFFFLMSFNLIGNLLISKDLVDPTSDRGAKFFYHAGKVME  216



>ref|XP_002528644.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33747.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GNM  LG  P Q+ A++   +G ++ + +GS+ T  I S + A ++FKNHD   A RK
Sbjct  45   IVGNMFQLGLSPQQSFAKLAGIHGPIMTIWLGSMCTVVISSNEVARDMFKNHDAVLAGRK  104

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            +++AMK +G ++G++  A YG +WRMLRR+ T E F   R++    VR +CID M+ ++E
Sbjct  105  ILEAMKGEGNNEGSMITAQYGQHWRMLRRLSTTEFFAASRLDSFQGVRSRCIDRMVQFVE  164

Query  524  KEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +     + GT  + V  FVFL  FN LGNL+ S+DL+DP S+K +KFF     +M+
Sbjct  165  EAG---RNGTQAIDVGRFVFLMAFNLLGNLMFSKDLLDPKSEKGAKFFYHAGKVME  217



>ref|XP_011036815.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=517

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 110/175 (63%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A++   +G ++ + +GS+S   I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFQLGWAPHESFAKLARVHGPIMTIWLGSMSNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDSMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S    + + +  ++FL  FN +GNL+ S+DL+DP S++ +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSERGAKFFQHAGKVME  216



>emb|CAB86901.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = +2

Query  125  CSYRlppgppglpVIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            C  RLPPGP   PVIGN+  L G  PH ++ ++  ++G ++ L IGS+ T  I S++ A 
Sbjct  32   CRTRLPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAR  91

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E+FK HD + A RK+ +AMK      G+L  A YG+YWRMLRR+CT + FV +R++    
Sbjct  92   EIFKKHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSD  151

Query  482  VRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASK  658
            VR +C+D ML ++E+     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+
Sbjct  152  VRSRCVDQMLRFVEEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSE  208

Query  659  FFDAMTGIMQ  688
            FF     +M+
Sbjct  209  FFYHTGKVME  218



>ref|NP_190865.2| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79019.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = +2

Query  125  CSYRlppgppglpVIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            C  RLPPGP   PVIGN+  L G  PH ++ ++  ++G ++ L IGS+ T  I S++ A 
Sbjct  32   CRTRLPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAR  91

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E+FK HD + A RK+ +AMK      G+L  A YG+YWRMLRR+CT + FV +R++    
Sbjct  92   EIFKKHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSD  151

Query  482  VRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASK  658
            VR +C+D ML ++E+     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+
Sbjct  152  VRSRCVDQMLRFVEEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSE  208

Query  659  FFDAMTGIMQ  688
            FF     +M+
Sbjct  209  FFYHTGKVME  218



>ref|XP_007142620.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
 gb|ESW14614.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
Length=520

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 110/175 (63%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GNM  LG  PH++ A++  K+G ++ L +GS+ T  I S++ A E+FKNHDV  A RK
Sbjct  51   VVGNMFQLGWSPHESFAKLAQKHGPIMTLWLGSMCTVVISSSEVAGEMFKNHDVVLAGRK  110

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AM+ +   +G++  + Y S+WRMLRR+CT E FV  R++    VR KCI  ML  IE
Sbjct  111  IYEAMRGENGSEGSIVTSQYNSHWRMLRRLCTTEFFVTSRLDAMRGVRAKCIHRMLQLIE  170

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +   S  R   V V  F+FL  FN +GNLI S+DL++  +++  +F+     +M+
Sbjct  171  EAGESGTR--AVDVGRFLFLMDFNLIGNLIFSKDLLESETERGDRFYYHALKVME  223



>ref|XP_010112509.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33897.1| Cytochrome P450 76A2 [Morus notabilis]
Length=517

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 112/175 (64%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  L   PH++  ++   +G ++ L +GS+ST  I S + A E+FKNHD+  A RK
Sbjct  44   VVGNIFQLDRTPHKSFVKLAQTHGPIMTLWLGSMSTVVISSHEVAREMFKNHDMVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK +  ++G+L  A YG +WRMLRR+CT E FV  R++    VR +CID M+ +I+
Sbjct  104  IYEAMKGEQSNEGSLITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGVRARCIDRMVNFID  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
               +S    + V V  F FL +FN +GNL+ S+DL+DP S++ +KFF     +M+
Sbjct  164  D--ASAHGTSPVDVGRFFFLMSFNLIGNLMFSKDLLDPKSERGAKFFFHAGKVME  216



>gb|KCW47877.1| hypothetical protein EUGRSUZ_K01623, partial [Eucalyptus grandis]
Length=514

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T  I S + A E+FKNHDV  A RK
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+ T E FV +R++ T  VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S  +   + V  F FL  FN +GNL+ S+DL+DP S + +KFF     +M+
Sbjct  164  DAGESGTK--SIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>ref|XP_010036342.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=523

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T  I S + A E+FKNHDV  A RK
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+ T E FV +R++ T  VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S  +   + V  F FL  FN +GNL+ S+DL+DP S + +KFF     +M+
Sbjct  164  DAGESGTK--SIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>ref|XP_006382516.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
 gb|ERP60313.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
Length=505

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A +   +G ++ + +GS+    I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AM+    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID MLL+IE
Sbjct  104  IYEAMRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLLYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S    + + +  ++FL  FN +GNL+ S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>ref|XP_010654031.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=515

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH + A++  K+G ++ L +GS+ST  I S + A E+FKNHDV  A RK
Sbjct  44   VVGNIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG  WRMLRR+CT E FV  R++    VR  CID M+ ++ 
Sbjct  104  IYEAMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVT  163

Query  524  KEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +  +S   GT  + V  F+FL  FN +GNL+ S+DL+DP S++ ++FF     +M+
Sbjct  164  EAGTS---GTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVME  216



>ref|XP_002877896.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54155.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 118/190 (62%), Gaps = 5/190 (3%)
 Frame = +2

Query  125  CSYRlppgppglpVIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            C  RLPPGP   PVIGNM  L G+ PH ++ ++  ++G ++ L I S+ T  I S++ A 
Sbjct  32   CRARLPPGPNPWPVIGNMFQLAGSPPHDSLTKLSRRHGPIMSLRIASMLTVVISSSEVAR  91

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E+FK HD   A RK+ +AMK      G+L  A YG+YWRMLRR+CT + FV +R++    
Sbjct  92   EIFKKHDAVLAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSD  151

Query  482  VRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASK  658
            VR +C+D ML ++E+     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+
Sbjct  152  VRSRCVDQMLRFVEEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSE  208

Query  659  FFDAMTGIMQ  688
            FF     +M+
Sbjct  209  FFYHTGKVME  218



>ref|XP_011036810.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=516

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 109/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A++   +G ++ + +GS+    + S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFQLGWAPHESFAKLARVHGPIMTIWLGSMCNVVVSSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S    + + +  ++FL  FN +GNL+ S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>dbj|BAC42682.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=516

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 119/190 (63%), Gaps = 5/190 (3%)
 Frame = +2

Query  125  CSYRlppgppglpVIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            C  RLPPGP   PVIGN+  L G  PH ++ ++  ++G ++ L IGS+ T  I S++ A 
Sbjct  32   CRTRLPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAR  91

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E+FK HD + A R++ +AMK      G+L  A YG+YWRMLRR+CT + FV +R++    
Sbjct  92   EIFKKHDAALAGREIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSD  151

Query  482  VRRKCIDDMLLWIEKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASK  658
            VR +C+D ML ++E+     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+
Sbjct  152  VRSRCVDQMLRFVEEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSE  208

Query  659  FFDAMTGIMQ  688
            FF     +M+
Sbjct  209  FFYHTGKVME  218



>gb|KCW84353.1| hypothetical protein EUGRSUZ_B01205 [Eucalyptus grandis]
Length=423

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            ELFK HD  FADRK   A+   GY +G+LA+  YG YWR LRR+C+ ELFV+KR+N+   
Sbjct  2    ELFKGHDFVFADRKCPHALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAH  61

Query  482  VRRKCIDDMLLWIEKEASSVQ--RGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS  655
            +R+KC+D M+++IE+E +  Q  +  G+ ++HF+FL  FN +GN++LSRDL+DP S    
Sbjct  62   LRQKCVDSMIMYIEEEMAVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGP  121

Query  656  KFFDAMTGIMQ  688
            +F+DAM  +M+
Sbjct  122  EFYDAMNLVME  132



>ref|XP_006382524.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
 gb|ERP60321.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
Length=516

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 107/175 (61%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++   +   +G ++ + +GS+    I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S    + + +  ++FL  FN +GNL+ S+DL+DP S+K +KFF     +M+
Sbjct  164  D--GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVME  216



>emb|CBI30232.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKP--SCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKY  232
            L+W + F    L+ LL R KP    +   PPGP G P++GN+ DLG  PHQT+  ++++Y
Sbjct  10   LLWWSAFFSAALLVLLRRIKPRKGSTKLRPPGPQGWPILGNIFDLGTMPHQTLYRLRSQY  69

Query  233  GSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSY  412
            G V+WL +G+++T  I SAK AAELFKNHD+ F+DRKV  A+    Y++G++A++ YG+Y
Sbjct  70   GPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPCALTALNYNQGSMAMSNYGTY  129

Query  413  WRMLRRICTVELFVHKRINETVPVRRKC  496
            WR LR++C+ EL V KRINE  P+R KC
Sbjct  130  WRTLRKVCSSELLVIKRINEMAPLRHKC  157



>ref|XP_011101481.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
 ref|XP_011101482.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
Length=511

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +2

Query  164  VIGNMMDL--GAF-PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFA  334
            V+GN+  L   AF PHQ+ A++  K+G V+ L +GS++T  I S++AA  +FKNHDV  A
Sbjct  45   VVGNIFQLLGAAFAPHQSFAKLAKKHGPVMTLHLGSMTTVVISSSEAARVMFKNHDVVLA  104

Query  335  DRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
             RK+ ++MK +  ++G+L  A YG  WRMLRR+CT E F    ++    VR KC+  M+ 
Sbjct  105  GRKIYESMKSEIGNEGSLITAQYGPRWRMLRRLCTTEFFAAAPLDAMRGVRAKCVHQMVQ  164

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
            +I   A++   G G+ V  F FL  FN +GNLI S+DL+DP S+  +KFF
Sbjct  165  YIRDAAAN---GLGIDVGRFFFLMAFNLIGNLIFSKDLLDPESETGAKFF  211



>ref|XP_006293048.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
 gb|EOA25946.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
Length=517

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G+ PH ++ ++  +YG ++ L +GS+ T  I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHHSLTKLSGRYGPIMALRLGSMLTVVISSSEVAREIFKKHDAALAGR  103

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK +     +L  A YG+YWRMLRR+CT + FV +R++    VR +C++ ML ++
Sbjct  104  KIYEAMKGRDNSDASLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSAVRSECVEQMLRFV  163

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             +     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+FF     +M+
Sbjct  164  MEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  217



>ref|XP_010431310.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=515

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G+ PH ++ ++  ++G ++ L +GS+ T  I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFKKHDAALAGR  103

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK +     +L  A YG+YWRMLRR+CT + FV +R++    VR KC++ ML ++
Sbjct  104  KIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVEQMLQFV  163

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+FF     +M+
Sbjct  164  KEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGKVME  217



>ref|XP_006382522.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
 gb|ERP60319.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
Length=516

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++   +   +G ++ + +GS+    I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVSSRLDAMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
              +++  R   + +  ++FL  FN +GNL+ S+DL+DP S+K +KFF
Sbjct  164  DGSANGTR--AIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>ref|XP_010038981.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48371.1| hypothetical protein EUGRSUZ_K02081 [Eucalyptus grandis]
Length=523

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 108/175 (62%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  L   PH++ A +  +YG ++ L +GS+ T  I S + A E+F+NHDV  A RK
Sbjct  44   VVGNIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFRNHDVVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G++  A YG +WRMLRR+ T E FV +R++    VR +C+D M+ +IE
Sbjct  104  IYEAMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDAMESVRSRCVDRMVRFIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                S  +   + V  F FL  FN +GNL+ S+DL+DP S + +KFF     +M+
Sbjct  164  DAGESGTK--SIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVME  216



>emb|CDP15345.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 118/193 (61%), Gaps = 12/193 (6%)
 Frame = +2

Query  62   VWSAIFLIPGLVF-LLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            V S + L+    F L+ R+  S   R PPGP G P+ GNM +LG  PHQT+   KNKYG 
Sbjct  18   VSSGLLLVVLFAFSLIKRRFGSPDKRRPPGPLGWPIFGNMFELGELPHQTMYRWKNKYGP  77

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            V+WL +GS++T  + +A AAAELFK HDV FADRKV D +    +++G L +  +G +WR
Sbjct  78   VMWLQLGSINTMVVQNATAAAELFKKHDVPFADRKVPDTLTAFDFNQGTLGMNTFGGHWR  137

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE--ASSVQRGTG--------VHVA  568
            +LRR+C++E  V+KR+NET  +R +   +M+ WIE E   S  Q G G         +++
Sbjct  138  VLRRLCSMEFLVNKRMNETTDLRNRLERNMVAWIEDEHRTSKAQGGDGKILSLAGTPNIS  197

Query  569  HFV-FLSTFNSLG  604
             F+ FL   + LG
Sbjct  198  DFLPFLKKLDPLG  210



>ref|XP_009148756.1| PREDICTED: cytochrome P450 76A1 [Brassica rapa]
Length=516

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G  PH ++  +  ++G ++ L +GS+ T  I S++ A E+ K HD + A R
Sbjct  45   VIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILKKHDAALAGR  104

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK      G+L  A YG YWRMLRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            E+     Q GT  + V  + FL  FN +GNL+ SRDL+DP S + S+F      +M+
Sbjct  165  EEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFLYHTGKVME  218



>gb|EYU38601.1| hypothetical protein MIMGU_mgv1a004436mg [Erythranthe guttata]
Length=527

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 113/180 (63%), Gaps = 6/180 (3%)
 Frame = +2

Query  164  VIGNMMDLGAF-----PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVS  328
            V+GNM+ L A      PH++ AE+  ++GSV+ L +GS++T  + S++AA  +FKNHD  
Sbjct  44   VVGNMLQLAAAGSASAPHRSFAELAKQHGSVMTLHLGSMTTVVVSSSEAARVMFKNHDAV  103

Query  329  FADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDM  508
             A RK+ ++MK    ++G+L  A +G +WR LRR+CT E F    ++    VR +C+D M
Sbjct  104  LAGRKIYESMKGDIGNEGSLITAQHGHHWRTLRRLCTAEFFAAAPLDAMRGVRARCVDQM  163

Query  509  LLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            + +I ++ASS   G  V V  F FL  FN +GNL+ S+DL+ P S++ +KFF     +M+
Sbjct  164  VQYI-RDASSAGGGGSVDVGKFFFLMAFNLIGNLMFSKDLLGPESERGAKFFYHAGKVME  222



>ref|XP_006382521.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
 gb|ERP60318.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
Length=516

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 106/167 (63%), Gaps = 2/167 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A +   +G ++ + +GS+    I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +A++    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
             +  S    + + +  ++FL  FN +GNL+ S+DL+DP S+K +KFF
Sbjct  164  DD--SANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>ref|XP_010112512.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33900.1| Cytochrome P450 76A2 [Morus notabilis]
Length=184

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  278  ILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVH  457
            ILS+KA  ELFKN+D+SF +  V    +   +H+  +ALAPYG YW ++RR+ T  + V 
Sbjct  3    ILSSKATTELFKNNDMSFVECAVTATSRAHNFHELFVALAPYGLYWHLMRRLMTRNMLVG  62

Query  458  KRINETVPVRRKCIDDMLLWIEKEASSVQRG-------TGVHVAHFVFLSTFNSLGNLIL  616
            KR+++T P+R+KCI++M  WIE EA    R         GVH+A FVFL  FN L NL+L
Sbjct  63   KRVSKTTPLRQKCINNMSFWIEGEARKKARNREAVDHVQGVHLARFVFLMVFNLLANLML  122

Query  617  SRDLVDPMSDKASKFFDAMTGIMQ  688
            SRDLVD   +  SKFF  M  IM+
Sbjct  123  SRDLVDLNKEDRSKFFAVMERIME  146



>ref|NP_001190075.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79020.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=530

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 118/201 (59%), Gaps = 13/201 (6%)
 Frame = +2

Query  125  CSYRlppgppglpVIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAA  301
            C  RLPPGP   PVIGN+  L G  PH ++ ++  ++G ++ L IGS+ T  I S++ A 
Sbjct  32   CRTRLPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAR  91

Query  302  ELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVP  481
            E+FK HD + A RK+ +AMK      G+L  A YG+YWRMLRR+CT + FV +R++    
Sbjct  92   EIFKKHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSD  151

Query  482  VRRKCIDDMLLWIEKEASSVQRGT------------GVHVAHFVFLSTFNSLGNLILSRD  625
            VR +C+D ML ++E+   +    T             + V  + FL  FN +GNL+ SRD
Sbjct  152  VRSRCVDQMLRFVEEGGQNGMYYTINNIMTCIICTKTIDVGRYFFLMAFNLIGNLMFSRD  211

Query  626  LVDPMSDKASKFFDAMTGIMQ  688
            L+DP S + S+FF     +M+
Sbjct  212  LLDPDSKRGSEFFYHTGKVME  232



>ref|XP_010504051.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=516

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G+ PH ++ ++  ++G ++ L +GS+ T  I S++ A E+FK HD + A R
Sbjct  45   VIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK +     +L  A YG+YWRMLRR+CT + FV +R++    VR KC++ ML ++
Sbjct  105  KIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVEQMLRFV  164

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++     Q GT  + V  + FL  FN +GNL+ SRDL+D  S + S+FF     +M+
Sbjct  165  KEGG---QNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDADSKRGSEFFYHTGKVME  218



>gb|KDP24879.1| hypothetical protein JCGZ_25132 [Jatropha curcas]
Length=160

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN+ DLG   H+ + E+K KYG V+ L +GSV T  I SAKAA ELFKNHD SF DR 
Sbjct  44   LVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDML  511
            V   +    Y  G+LAL  +G YWR LRRIC +EL  ++R+NETV +RRKCID M+
Sbjct  104  VPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMI  159



>gb|KCW48752.1| hypothetical protein EUGRSUZ_K02392 [Eucalyptus grandis]
Length=354

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  356  MKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS  535
            M+ Q Y+KG++ALAPYG+YW   R++  V++ V +R+NET P+RRKC+DDML WI + AS
Sbjct  1    MRSQDYYKGSIALAPYGAYWWGSRQLLMVDMLVARRLNETAPIRRKCVDDMLTWIGEAAS  60

Query  536  S--VQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +  V+ G GVH+A FVFL TFN LGNL+LSRDL+DP S   S+ F+AM+G+M+
Sbjct  61   TDKVRLGEGVHLARFVFLMTFNLLGNLMLSRDLLDPDSKVGSELFEAMSGLME  113



>gb|KDP43103.1| hypothetical protein JCGZ_27052 [Jatropha curcas]
Length=330

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = +2

Query  209  IAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGAL  388
            I  ++      + L +G V T     AKAA ELFKNHD  F DR V   +    Y +G+L
Sbjct  4    ITNLQGHQDGRLSLRLGLVDTVVTQLAKAATELFKNHDARFCDRMVPYVLTSHNYCEGSL  63

Query  389  ALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG--VH  562
            A+  +G YWRMLRR+C  EL  +KRINETV +R KCID  +  IE   ++  +G    V 
Sbjct  64   AIGRFGPYWRMLRRVCAAELLANKRINETVHIRHKCIDQRIWSIEDNLTAANKGESGKVK  123

Query  563  VAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            VAH++FL +FN +GNL LS+DL+D    +  +FF+A+  I
Sbjct  124  VAHYLFLMSFNLIGNLSLSKDLLDSKCKEGYEFFEALDKI  163



>gb|KDO61005.1| hypothetical protein CISIN_1g0379902mg, partial [Citrus sinensis]
Length=283

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 107/169 (63%), Gaps = 7/169 (4%)
 Frame = +2

Query  164  VIGNMMDLGAFP---HQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFA  334
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T  + S + A ++FKNHDV  A
Sbjct  27   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  86

Query  335  DRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
             RK+ +AMK     +G++  + YG++WRMLRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  87   GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  146

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKF  661
            ++E+  +       + V  F+FL  FN +GNL+ S+DL+ P S++ +KF
Sbjct  147  FVEEAEACAP----IDVGRFIFLMAFNLIGNLMFSKDLLGPESERGAKF  191



>ref|XP_006382520.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
 gb|ERP60317.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
Length=516

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 105/167 (63%), Gaps = 2/167 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN+  LG  PH++ A +   +G ++ + +GS+    I S++ A E+FKNHD   A RK
Sbjct  44   VVGNIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +A++    ++G++  A YG +WRMLRR+CT E FV  R++     R +CID ML +IE
Sbjct  104  IYEAIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIE  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
             +  S    + + +  + FL  FN +GNL+ S+DL+DP S+K +KFF
Sbjct  164  DD--SANGTSAIDLGRYFFLMAFNLIGNLMFSKDLLDPKSEKGAKFF  208



>gb|KDP29244.1| hypothetical protein JCGZ_16633 [Jatropha curcas]
Length=518

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 106/176 (60%), Gaps = 3/176 (2%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  LG   PH++  E+   +G ++ L +GS+ T  + S K A E+FKNHD   A R
Sbjct  48   VVGNIFQLGHRSPHESFTELALTHGPIMTLWLGSMCTIVVSSDKMAREMFKNHDAVLAGR  107

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK    H G++  + YG +WRMLRR+ T E FV  R++    VR +CID+++ +I
Sbjct  108  KIYEAMKGNHGHDGSMITSQYGPHWRMLRRLATTEFFVTSRLDAMRTVRCRCIDELIKFI  167

Query  521  EKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            E+   + +    V V  F FL  FN +GNL+ S+DL+DP S+  + FF     +M+
Sbjct  168  EEACGNGK--NAVDVGRFFFLMAFNLIGNLMFSKDLLDPKSETGATFFYHAGKVME  221



>ref|XP_009626046.1| PREDICTED: cytochrome P450 76A1 [Nicotiana tomentosiformis]
Length=506

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 105/175 (60%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++ N+   G  PH + A++  KYG ++ L +GS+ST  I S   A E+FKNHD+  A RK
Sbjct  44   LVTNIFQSGFAPHVSFAKLATKYGPIMTLWLGSMSTVVISSNDVAREMFKNHDMVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G+L    YG +WRMLRR+ T E FV  R++     R KCID M+ +I 
Sbjct  104  IYEAMKGDFGNEGSLITNQYGPHWRMLRRLSTKEFFVTSRLDVMRGTRTKCIDQMVKFIG  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
               +S    T + V  F FL  FN +GNL+ S+DL+DP S++ +KFF     +M+
Sbjct  164  DAGNSGT--TSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSNRGAKFFYHAGKVME  216



>emb|CDP18467.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
             +WL  GS+ T  I S + A E+FKNHDV  A RK+ +AMK    ++G+L  A YG +WR
Sbjct  2    TLWL--GSMCTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDIGNEGSLITAQYGPHWR  59

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
            MLRR+CT E FV  R++ TV VR KCID M+ +I  EA+      G+ V  F FL  FN 
Sbjct  60   MLRRLCTAEFFVTSRLDATVDVRAKCIDQMVKYI--EAAGGSGANGIDVGKFFFLLAFNL  117

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +GNL+ S+DL+DP S++ +KFF     +M+
Sbjct  118  IGNLMFSKDLLDPSSERGAKFFYHAGKVME  147



>gb|KDP26150.1| hypothetical protein JCGZ_22831 [Jatropha curcas]
Length=162

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN+  LG   H+ + E K KYG V+ L IGS+ T  I SAKAA ELFKNHD SF DR 
Sbjct  44   LVGNIFYLGTLAHRILYEHKFKYGPVLRLRIGSMDTVVIQSAKAAMELFKNHDASFCDRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDML  511
            V        Y +G+LAL  +G YWR LRRIC +EL  ++RINETV +RRKCID M+
Sbjct  104  VPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMI  159



>emb|CDX76245.1| BnaA04g05090D [Brassica napus]
Length=530

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 107/191 (56%), Gaps = 19/191 (10%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G  PH ++  +  ++G ++ L +GS+ T  I S++ A E+ K HD + A R
Sbjct  45   VIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILKKHDAALAGR  104

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK      G+L  A YG YWRMLRR+CT + FV +R++    VR +C+D ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVDQMLRFV  164

Query  521  EKEASSVQRGT---------------GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS  655
            E+     Q GT                + V  + FL  FN +GNL+ SRDL+DP S + S
Sbjct  165  EEGG---QNGTLWNTVVFTARYSCTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGS  221

Query  656  KFFDAMTGIMQ  688
            +F      +M+
Sbjct  222  EFLYHTGKVME  232



>ref|XP_006482365.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=508

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 107/169 (63%), Gaps = 7/169 (4%)
 Frame = +2

Query  164  VIGNMMDLGAFP---HQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFA  334
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T  + S + A ++FKNHDV  A
Sbjct  43   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  102

Query  335  DRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
             RK+ +AMK     +G++  + YG++WRMLRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  103  GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  162

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKF  661
            ++E+  +       + V  F+FL  FN +GNL+ S+DL+ P S++ +KF
Sbjct  163  FVEEAEACAP----IDVGRFIFLMAFNLIGNLMFSKDLLGPESERGAKF  207



>gb|AJD25184.1| cytochrome P450 CYP76G16 [Salvia miltiorrhiza]
Length=508

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 111/170 (65%), Gaps = 4/170 (2%)
 Frame = +2

Query  164  VIGNMMDLG---AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFA  334
            V+GNM+ L    + PHQ+ AE+  K+G+V+ L +GS++T  + SA+AA  +FK+HD + A
Sbjct  38   VVGNMLQLARSASAPHQSFAELAGKHGAVMTLWLGSMTTVVVSSAEAARAMFKHHDAALA  97

Query  335  DRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
             RK+ ++MK    ++G+L  A YG +WR LRR+CT E F    ++    VR +C+  ML 
Sbjct  98   GRKIYESMKGDVGNEGSLITAQYGPHWRTLRRLCTAEFFAAGPLDAMRGVRARCVAQMLH  157

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFF  664
            ++ +EA++   G G  V  F FL  FN +GNL+ S+DL+DP S++ ++FF
Sbjct  158  YV-REAAAADDGAGTDVGRFFFLMAFNLIGNLMFSKDLLDPASERGAEFF  206



>ref|XP_006439139.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
 gb|ESR52379.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
Length=512

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 106/169 (63%), Gaps = 7/169 (4%)
 Frame = +2

Query  164  VIGNMMDLGAFP---HQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFA  334
            V+GN+  LG  P   H + A + +K+G ++ L +GS+ T  + S + A ++FKNHDV  A
Sbjct  47   VVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLA  106

Query  335  DRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
             RK+ +AMK     +G++  + YG++WRMLRR+CT E FV  R++ T  VR KCID M+ 
Sbjct  107  GRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQ  166

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKF  661
            ++E+  +       + V  F FL  FN +GNL+ S+DL+ P S++ +KF
Sbjct  167  FVEEAGACAP----IDVGRFTFLMAFNLIGNLMFSKDLLGPESERGAKF  211



>ref|XP_009793679.1| PREDICTED: cytochrome P450 76A1 [Nicotiana sylvestris]
Length=506

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 104/175 (59%), Gaps = 2/175 (1%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++ N+   G  PH + A++  KYG ++ L +GS+ST  I S   A E+FKNHD+  A RK
Sbjct  44   LVTNIFQSGFAPHVSFAKLATKYGPIMTLWLGSMSTVVISSNDVAREMFKNHDMVLAGRK  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK    ++G+L    YG +WRMLRR+ T E FV  R++     R KCID M+ +I 
Sbjct  104  IYEAMKGDFGNEGSLITNQYGPHWRMLRRLSTKEFFVTSRLDAMRGTRTKCIDQMVQFIG  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
               +     T + V  F FL  FN +GNL+ S+DL+DP S++ +KFF     +M+
Sbjct  164  DAGNFGT--TSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSNRGAKFFYHAGKVME  216



>gb|KHN37270.1| Cytochrome P450 76A2 [Glycine soja]
Length=491

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  L G  PH+++A++ +K+G ++ L +GS+ T  I S++ A  +FKNHDV  A R
Sbjct  21   VVGNIFQLAGWLPHESLAKLAHKHGPIMTLWLGSMCTVVISSSQVARHMFKNHDVILAGR  80

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AM+     +G+L  + Y S+WRML+R+CT ELFV  R++    VR KCI  ML  I
Sbjct  81   KIYEAMRGDHGSEGSLITSQYNSHWRMLKRLCTTELFVTTRLDAMQGVRAKCIHRMLHLI  140

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++     Q GT  V V  F FL  FN +GNLI S+DL+D   ++   F+     +M+
Sbjct  141  QQAG---QSGTCAVDVGRFFFLMDFNLIGNLIFSKDLLDSEMERGDCFYYHALKVME  194



>ref|XP_003535793.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=510

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  L G  PH+++A++ +K+G ++ L +GS+ T  I S++ A  +FKNHDV  A R
Sbjct  40   VVGNIFQLAGWLPHESLAKLAHKHGPIMTLWLGSMCTVVISSSQVARHMFKNHDVILAGR  99

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AM+     +G+L  + Y S+WRML+R+CT ELFV  R++    VR KCI  ML  I
Sbjct  100  KIYEAMRGDHGSEGSLITSQYNSHWRMLKRLCTTELFVTTRLDAMQGVRAKCIHRMLHLI  159

Query  521  EKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            ++     Q GT  V V  F FL  FN +GNLI S+DL+D   ++   F+     +M+
Sbjct  160  QQAG---QSGTCAVDVGRFFFLMDFNLIGNLIFSKDLLDSEMERGDCFYYHALKVME  213



>ref|XP_006403743.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
 gb|ESQ45196.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
Length=496

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 103/176 (59%), Gaps = 22/176 (13%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIGNM  L G+ PH ++ ++  ++G ++ L +GS+ T  I S++ A E+FK HD + A R
Sbjct  44   VIGNMFQLAGSPPHDSLTKLSRRHGPIMTLRLGSMLTVVISSSQVAREIFKKHDAALAGR  103

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK     +G+L  A YG+YWRMLRR+CT + FV +R++    VR KC+D ML ++
Sbjct  104  KIYEAMKGGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVDQMLRFV  163

Query  521  EKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            E+   +                     GNL+ SRDL+DP S + S+FF     +M+
Sbjct  164  EEGGQN---------------------GNLMFSRDLLDPDSKRGSEFFYHTGKVME  198



>ref|XP_003592855.1| Cytochrome P450 [Medicago truncatula]
 gb|AES63106.1| cytochrome P450 family protein [Medicago truncatula]
Length=522

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 110/178 (62%), Gaps = 4/178 (2%)
 Frame = +2

Query  164  VIGNMMDLG-AFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            V+GN+  LG + PH++   +  ++G ++ L +GS+ T  + S +AA ++FKN+D + A R
Sbjct  43   VVGNIFQLGLSPPHESFTILSRRHGPIMTLWLGSMCTVVVSSCEAARDMFKNNDAALAGR  102

Query  341  KVIDAMKVQGYH--KGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLL  514
            KV +AMK    H  +G+L  + Y ++WRMLRR+ T E FV  R++    VR KCID M+ 
Sbjct  103  KVYEAMKGNHNHGSEGSLITSQYDAHWRMLRRLSTTEFFVTSRLDAMQGVRAKCIDRMVH  162

Query  515  WIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             I+ EA++      V V  F FL  FN +GNLI S+DL+DP  ++ ++F+     +M+
Sbjct  163  LID-EAAAESSNCAVDVGKFFFLMAFNLIGNLIFSKDLLDPEMERGARFYYHAIKVMK  219



>ref|XP_010558964.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1 [Tarenaya 
hassleriana]
Length=514

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 112/182 (62%), Gaps = 10/182 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFP---HQTIAEM-KNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSF  331
            V+GNM  L   P   HQT++++ +  +G  + L +GS+ T    S+ AA E+ ++ DV+ 
Sbjct  42   VVGNMFQLAISPLPPHQTLSKLARGVHGPFMTLRLGSMLTVVASSSSAAREVLRDCDVAL  101

Query  332  ADRKVIDAMKVQ--GYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDD  505
            A RK+ +AMK +     +G+L  A YG+YWRMLRR+CT + FV +R++    VR +C+D 
Sbjct  102  AGRKIYEAMKGERGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDSMCNVRARCMDQ  161

Query  506  MLLWIEKEASSVQRGT-GVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            M+ ++E+     Q GT  V +  + FL  FN +GNL+ S+DL+DP S + SKFF     +
Sbjct  162  MVRFVEEAG---QNGTKTVDIGRYFFLMAFNLIGNLMFSKDLLDPDSKQGSKFFYHAGKV  218

Query  683  MQ  688
            M+
Sbjct  219  ME  220



>ref|XP_004138005.1| PREDICTED: cytochrome P450 76A2-like [Cucumis sativus]
 gb|KGN59047.1| hypothetical protein Csa_3G748270 [Cucumis sativus]
Length=523

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 101/175 (58%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN++ L    H++  ++  KYG ++ L +GS+ T  + S+  A E+FK HDV  + R 
Sbjct  41   VVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVVSSSTVAREMFKTHDVPLSGRM  100

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK     +G+L  + YG +WRMLRR+ T E FV +++     VRR CID M+  +E
Sbjct  101  IYEAMKGNHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHCIDAMIRHVE  160

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +          + V  FVF+  FN +GNLI S+DL++  S +  +F+     +M+
Sbjct  161  EGCDPCGNAPALDVGKFVFVMGFNLIGNLIFSKDLLEANSKRGKEFYYHTRKVME  215



>ref|XP_008442789.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A2 [Cucumis 
melo]
Length=519

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 102/175 (58%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN++ L    H++  ++  KYG ++ L +GS+ T  I S+ AA E+FK HD   + R 
Sbjct  38   VVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVISSSTAAREMFKTHDAPLSGRM  97

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK     +G+L  + YG +WRMLRR+ T E FV +++     VRR CID M+  ++
Sbjct  98   IYEAMKGDHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHCIDAMIRHVQ  157

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +          + V  F+F+ +FN +GNLI S+DL++  S +  +F+     +M+
Sbjct  158  EGCDPCGNAQALDVGKFMFVMSFNLIGNLIFSKDLLEANSKRGKEFYYHTRKVME  212



>ref|XP_004168914.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A2-like [Cucumis 
sativus]
Length=523

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 100/175 (57%), Gaps = 0/175 (0%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            V+GN++ L    H++  ++  KYG ++ L +GS+ T  + S+  A E+FK HDV  + R 
Sbjct  41   VVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVVSSSTVAREMFKTHDVPLSGRM  100

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +AMK     +G+L  + YG +WRMLRR+ T E FV +++     VRR CID M+  +E
Sbjct  101  IYEAMKGNHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHCIDAMIRHVE  160

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +          + V  FVF+  FN +GN I S+DL++  S +  +F+     +M+
Sbjct  161  EGCDPCGNAPALDVGKFVFVMGFNLIGNXIFSKDLLEANSKRGKEFYYHTRKVME  215



>gb|KDO63687.1| hypothetical protein CISIN_1g040285mg, partial [Citrus sinensis]
Length=298

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 110/195 (56%), Gaps = 3/195 (2%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
             +R   S S RLPPGP   PVIGN+++LG  PH+++A++   +G ++ L  G V+T    
Sbjct  23   FSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFS  82

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            SA  A E+ +N D SF +R + DA+   G+H+  +   P  + WR LR+IC    F  ++
Sbjct  83   SAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQ  142

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            ++    +RRK I D+L ++++   +   GT +H+    F +T N + N I S DL DP S
Sbjct  143  LDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTS  199

Query  644  DKASKFFDAMTGIMQ  688
              A +F     G+M+
Sbjct  200  KTAREFKQTNWGMME  214



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 124/208 (60%), Gaps = 7/208 (3%)
 Frame = +2

Query  65   WSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVI  244
            W++I+++    F   R +   +++LPPGP  LP+IG++++LG  PH+++A +   YG ++
Sbjct  14   WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM  69

Query  245  WLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRML  424
             L +G V+T  I SA  A E+ +  D+SF +R + DA++   +++ ++A  P  + WR L
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPDAIRAAKHNQLSMAWIPVSTTWRAL  129

Query  425  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLG  604
            RR C   LF  ++++    +R + + ++L  +E+   S Q G  V +    F ++ N L 
Sbjct  130  RRTCNSHLFTSQKLDSNTHLRHQKVQELLANVEQ---SCQAGGPVDIGQEAFRTSLNLLS  186

Query  605  NLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N I S DLVDP+S+ A +F + + G+M+
Sbjct  187  NTIFSVDLVDPISETAQEFKELVRGVME  214



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 124/208 (60%), Gaps = 7/208 (3%)
 Frame = +2

Query  65   WSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVI  244
            W++I+++    F   R +   +++LPPGP  LP+IG++++LG  PH+++A +   YG ++
Sbjct  14   WTSIYIM----FSARRGRKHAAHKLPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIM  69

Query  245  WLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRML  424
             L +G V+T  I SA  A E+ +  D+SF +R + DA++   +++ ++A  P  + WR L
Sbjct  70   TLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPDAIRAAKHNQLSMAWLPVSTTWRAL  129

Query  425  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLG  604
            RR C   LF  ++++    +R + + ++L  +E+   S Q G  V +    F ++ N L 
Sbjct  130  RRTCNSHLFTPQKLDSNTHLRHQKVQELLANVEQ---SCQAGGPVDIGQEAFRTSLNLLS  186

Query  605  NLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N I S DLVDP+S+ A +F + + G+M+
Sbjct  187  NTIFSVDLVDPISETAQEFKELVRGVME  214



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 126/210 (60%), Gaps = 7/210 (3%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            + W++I+++    F + R     +Y+LPPGP  LP+IGN+++LG  PH+++AE+   YG 
Sbjct  12   VAWTSIYIM----FSVRRGSQHTAYKLPPGPVPLPIIGNLLNLGNRPHESLAELAKTYGP  67

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            ++ L +G V+T  I SA  A E+ +  D+SF +R V DA++   +++ ++A  P  + WR
Sbjct  68   IMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRFVPDAIRATNHNQLSMAWMPVSTTWR  127

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
            +LR+IC   LF  ++++    +R   + ++L  +E+   S Q G  V++    F ++ N 
Sbjct  128  VLRKICNSHLFTTQKLDSNTHLRHHKVQELLAKVEE---SRQAGDAVYIGREAFRTSLNL  184

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            L N I S DLVDP+S+   +F + +  I++
Sbjct  185  LSNTIFSVDLVDPISETVLEFQELVRCIIE  214



>ref|XP_007034575.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY05501.1| Cytochrome P450, putative [Theobroma cacao]
Length=551

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 106/175 (61%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN++DLG  PH+++AE+   +G ++ L +GS++T  + SA  A E+ +NHD++F++R 
Sbjct  98   ILGNLLDLGDKPHKSLAELAKTHGPLMSLKLGSLTTIVVSSAAMAKEVLQNHDLTFSNRT  157

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + DA++V  + +  L   P    WR LR++C+   F +K+++    +RRK I+++L ++ 
Sbjct  158  IGDALRVNQHDEVGLPWMPVSPLWRTLRKVCSSHFFSNKKLDAHQYLRRKKIEELLSYVH  217

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            K   +   G  +++    F S+ N L + + S+DLVDP S  A  F   +  IM+
Sbjct  218  KHCRA---GEAINIGQAAFNSSINLLSDTVFSKDLVDPNSKDAQAFKHTVCSIME  269



>ref|XP_004497404.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=516

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 103/165 (62%), Gaps = 8/165 (5%)
 Frame = +2

Query  164  VIGNMMDLGAF----PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSF  331
            ++GN++ L       PH++ A +  K+G ++ L +GS+ T  + S++ A ++FKN+DV  
Sbjct  39   IVGNILQLARLSSSPPHESFAILARKHGPIMTLWLGSMCTVVVSSSEVARQMFKNNDVVL  98

Query  332  ADRKVIDAMK---VQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCID  502
            A RKV +AMK     G  +G+L  + Y S+WRML+R+ T E FV  R++    VR KC+D
Sbjct  99   AGRKVYEAMKGNYENGIIEGSLITSQYNSHWRMLKRLATHEFFVTSRLDAMRDVRAKCVD  158

Query  503  DMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDP  637
             ML  IE E+ +   G GV V +F+F  +FN +GNLI S+DL+ P
Sbjct  159  RMLNLIEHESVN-SVGVGVDVGNFLFTMSFNLIGNLIFSKDLLGP  202



>ref|XP_006440464.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
 gb|ESR53704.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
Length=499

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 110/195 (56%), Gaps = 3/195 (2%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
             +R   S S RLPPGP   PVIGN+++LG  PH+++A++   +G ++ L  G V+T    
Sbjct  23   FSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFS  82

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            SA  A E+ +N D SF +R + DA+   G+H+  +   P  + WR LR+IC    F  ++
Sbjct  83   SAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQ  142

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            ++    +RRK I D+L ++++   +   GT +H+    F +T N + N I S DL DP S
Sbjct  143  LDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTS  199

Query  644  DKASKFFDAMTGIMQ  688
              A +F     G+M+
Sbjct  200  KTAREFKQTNWGMME  214



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 131/223 (59%), Gaps = 12/223 (5%)
 Frame = +2

Query  32   KEMEWERKYLVWSAIFLIP-----GLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAF  196
            +EM +   +L++   FL+P      L ++L R K   S +LPPGP  LP++GN+ DLG  
Sbjct  18   REMNFFISFLLY---FLLPFAVIQSLDYILRRSK-RKSGKLPPGPSRLPIVGNLWDLGDK  73

Query  197  PHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYH  376
            PH+++A++   +G ++ L +G V+T  + SA  A E+ + HD++F +R ++DA++   +H
Sbjct  74   PHKSLAKLAKTHGQLMSLKLGQVTTIVVSSAAMAKEVLQKHDLTFCNRTIVDAVRALDHH  133

Query  377  KGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTG  556
            +  +A  P  + WR LRRIC   +F  ++++    +RRK + D+L  +++       G  
Sbjct  134  ESGIAWLPVATRWRNLRRICNSHIFTAQKLDANQDLRRKKVQDILAEVQERCLV---GEA  190

Query  557  VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            V + H  F +T N+L N +LS +L D  SD A +F + ++ IM
Sbjct  191  VDLRHAAFTATLNALSNTVLSLNLTDLSSDIAREFKERISCIM  233



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 104/174 (60%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN++DLG  PH+++A++   +G ++ L +G V+T  + SA  A E+ + HD++F +R 
Sbjct  44   IVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSATMAKEVLQKHDLTFCNRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+DA++   +H+  +A  P  + WR LR+IC   +F  ++++    +RRK + D+L  ++
Sbjct  104  VVDAVRALDHHEAGIAWLPVATRWRNLRKICNSHIFTSQKLDANQDLRRKKVQDLLAEVQ  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +       G  V +    F +T N+L N +LS DL D  SD A +F + ++ IM
Sbjct  164  ERCLV---GEAVDLRQAAFTATLNALSNTVLSLDLTDLSSDIAREFKEHISCIM  214



>ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 109/195 (56%), Gaps = 3/195 (2%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
             +R   S S RLPPGP   PVIGN+++LG  PH+++A++   +G ++ L  G V+T    
Sbjct  23   FSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFS  82

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            SA  A E+ +N D SF +R + DA+   G+H+  +   P  + WR  R+IC    F  ++
Sbjct  83   SAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQ  142

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            ++    +RRK I D+L ++++   +   GT +H+    F +T N + N I S DL DP S
Sbjct  143  LDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTS  199

Query  644  DKASKFFDAMTGIMQ  688
              A +F     G+M+
Sbjct  200  KTAREFKQINWGMME  214



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 104/174 (60%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++GN+ DLG  PH+++A++   +G ++ L +G V+T  + SA  A E+ + HD++F +R 
Sbjct  44   IVGNLWDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSAAMAKEVLQKHDLTFCNRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            ++DA++   +H+  +A  P  + WR LRRIC   +F  ++++    +RRK + D+L  ++
Sbjct  104  IVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFTAQKLDANQDLRRKKVQDILAEVQ  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +       G  V + H  F +T N+L N +LS +L D  SD A +F + ++ IM
Sbjct  164  ERCLV---GEAVDLRHAAFTATLNALSNTVLSLNLTDLSSDIAREFKERISCIM  214



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 111/187 (59%), Gaps = 12/187 (6%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFL----LTRKKPSCSYRlppgppglpVIGNMMDL-GAFPHQTIAEMK  223
            + +++IF +   VF+    LT+K  S +  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    ICFTSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIGSLPHHRLRDLS  65

Query  224  NKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPY  403
             KYG ++ L +G VST  + SA+ A E+ KNHD+ FA R  I A K+  Y    LA APY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFAPY  125

Query  404  GSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVF-  580
            G YWR LR+ICT+EL   KR+    P+R + + +++ WI     S + G+ ++    VF 
Sbjct  126  GDYWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWI-----SSKEGSQINFTKEVFS  180

Query  581  -LSTFNS  598
             +ST  S
Sbjct  181  TISTITS  187



>ref|XP_002276053.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN++ LG  PHQ++  +   YG V+ L +GS+ST  + S + A E+   +D +F+ R+
Sbjct  43   IIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSISTIVVSSPETAKEVLHRNDQAFSGRE  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+ A+K   +H+ ++  +P  +YWR +R+ICT E+F  +R+N +  +R+K + ++L  +E
Sbjct  103  VLGAVKAHNHHESSVIWSPTSAYWRKIRKICTREMFSVQRLNASQGLRKKIVQELLDHVE  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +      RG  V +    F ++ N L N I S +L    S  + +F D + G+M+
Sbjct  163  E---CCGRGCAVDIGAATFTASLNLLSNTIFSTNLAHHDSTFSQEFKDIVWGVME  214



>ref|XP_002528651.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33754.1| cytochrome P450, putative [Ricinus communis]
Length=230

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 90/140 (64%), Gaps = 16/140 (11%)
 Frame = +2

Query  278  ILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVH  457
            I SAKAA ELF+ HD+SF DRKV  +     Y K AL L               +EL  +
Sbjct  3    IQSAKAAEELFRRHDISFCDRKVPQSFTACNYSKAALGLG-------------RLELMTN  49

Query  458  KRINETVPVRRKCIDDMLLWIEKEASSVQ--RGTG-VHVAHFVFLSTFNSLGNLILSRDL  628
            KRINET  +R+KCID M+ +IE++AS+ +  R +G + ++H+VF+ +FN +GNL LSRDL
Sbjct  50   KRINETAVLRQKCIDKMIQYIEEDASAARARRESGELVISHYVFVMSFNLIGNLALSRDL  109

Query  629  VDPMSDKASKFFDAMTGIMQ  688
            ++  S++ ++FFDAM   M+
Sbjct  110  LNSNSEEGTEFFDAMDKTME  129



>ref|XP_007040049.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24550.1| Cytochrome P450, putative [Theobroma cacao]
Length=500

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 100/175 (57%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            + GN+ DLG  PH++++E+   +G ++ L IGS+ T  I S   A ++ + HD++F++R 
Sbjct  44   IFGNLFDLGDKPHKSLSELAKIHGPLMSLKIGSLITVVISSENMAKQVLQKHDLTFSNRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            ++DA++   + +  L   P    WR LR++C   LF  ++++    +RRK I +++  ++
Sbjct  104  IVDAVRASQHDEVGLPWIPVSPLWRTLRKVCNTHLFASQKLDANQYLRRKKIQELIAIVQ  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            K   S   G  +++    F +T N L N I S DLVDP S  A +F   + GIM+
Sbjct  164  K---SCHAGEVINIGQAAFNTTINLLSNTIFSMDLVDPNSPTAQEFKKTVWGIME  215



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 119/210 (57%), Gaps = 3/210 (1%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            L++ A +L+   V L  R K + S +LPPGP  LP+IGN++ L   PH+++A++   +G 
Sbjct  11   LLFVATYLLVNHVILRGRSKNNGSTKLPPGPRPLPIIGNLLALRDKPHKSLAKLARVHGP  70

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            ++ L +G V+T  + S   A E+ + HD + ++R +IDA++ QG+H+  LA  P G  WR
Sbjct  71   LVTLKLGQVTTVVVSSPATAREILQKHDATLSNRYIIDAIRAQGHHEAGLAWVPVGPTWR  130

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
              R++C   +F ++++N +  VR++ I  +L    +   S + G  + V    F +  +S
Sbjct  131  KFRKVCYSHIFTNQKLNSSQHVRQRTIQQLL---AEARESCRVGEAMDVGKAAFRAALSS  187

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            L   ++S DL D  SD A +F +    IM 
Sbjct  188  LSISVMSLDLADAASDTAREFKELARCIMN  217



>ref|XP_010053381.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77659.1| hypothetical protein EUGRSUZ_D01958 [Eucalyptus grandis]
Length=499

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 123/212 (58%), Gaps = 11/212 (5%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            YL WS   L+  L F+ T+K       LPPGPP LPVIGN+++LG  PH+++A++ + YG
Sbjct  11   YLAWS---LVQALRFI-TKKTKPSPSNLPPGPPPLPVIGNLLELGNLPHKSLAKLAHTYG  66

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKV--QGYHKGALALAPYGS  409
             +I L +G+++T  I S   + E+ + HDVSFA+R + DA+    QG H  +L   P   
Sbjct  67   PIIKLQLGAITTVVISSPTLSREILQTHDVSFANRMIPDAVTAFNQGMH--SLPWVPVSP  124

Query  410  YWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLST  589
             WR LRRI  V LF + +++ T  +RRK + ++L  +E   +S + G  V +    F ++
Sbjct  125  LWRNLRRIFNVHLFSNMKLDSTQHLRRKKVQELLAHVE---TSARVGGEVEIGEAAFTTS  181

Query  590  FNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             N L + + S DLVD  S  A +F + +  IM
Sbjct  182  INFLADAMFSLDLVDRSSGSAKEFKETVWQIM  213



>ref|XP_010692297.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LG  PH+++AE+   YG ++ L +GS++T  I S + A E+F  HD+ F+ R 
Sbjct  37   IIGNIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRA  96

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
              DA++   + + ++   P G  WR LR+I TV+LF  KR++ +  +R+K +D++   IE
Sbjct  97   NTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDEL---IE  153

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                  +RG  +++    F +T N L +   S+DL    S  + +F D  + IM+
Sbjct  154  YARHCSERGLPLNIGKAAFTTTLNLLSSTFFSKDLASHDSSSSQEFKDIASNIME  208



>ref|XP_006423671.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
 gb|ESR36911.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
Length=495

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L +G V+T  I S   A  + K HD  F DRK
Sbjct  41   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVISSPSMAKAILKEHDSLFCDRK  100

Query  344  VIDAMKVQGY--HKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +++  Q Y  H+ +L   P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  101  VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFSNQKLDANQDLRRKKIKDLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  S+   G  +      F ++ N L N I S DLVDP      +F D + GIM+
Sbjct  161  VEENCSA---GKAIDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKDTVWGIME  211



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 121/210 (58%), Gaps = 8/210 (4%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            + W++I+++     +  R+  S + +LPPGP   P+IGN+++LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            V+ L +G V+T  I SA  A E+ +  D SF +R + DA++   +++ ++   P  + WR
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWR  126

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
             LR+IC   +F +++++ +  +R + + D+L  +E+   S Q G  V +    F +T N 
Sbjct  127  TLRKICNSHIFTNQKLDSSNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNL  183

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            L N   S DLV+P SD   +F + +  +M+
Sbjct  184  LSNTTFSVDLVEPSSDTVQEFKELVRHMME  213



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   YG ++ L +G V+T  + S   A  + +NHD+SF DRK
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  344  VIDAMKVQGYHKGALALA--PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +A+  + Y +   +L   P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAIMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+   +   G  + V    F ++ N L N I S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>ref|XP_003536316.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN37833.1| Cytochrome P450 76C1 [Glycine soja]
Length=497

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 98/175 (56%), Gaps = 4/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+++LG  PHQ++A++   +G V+ L +G+V+T  I SA  A E+   HD S ++R 
Sbjct  41   IIGNLLELGQNPHQSMAKLAKIHGPVMSLKLGTVTTIVISSADMAKEVLVTHDESLSNRP  100

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            +  ++ V  +   +LA  P    WR +R+IC  +LF HK ++E+  VRRK +  +L  + 
Sbjct  101  IPQSVSVLNHEHYSLAFLPVSPLWREMRKICNGQLFAHKTLDESQDVRRKIVQQLLSDVH  160

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            K   S Q G  V V    F +T N L N I S DLV      A +F D +T I +
Sbjct  161  K---SCQIGEAVDVGRQAFKTTLNLLSNTIFSEDLVL-SKGTAGEFKDLVTNITK  211



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   YG ++ L +G V+T  + S   A  + +NHD+SF DRK
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  344  VIDAMKVQGYHKGALALA--PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +A+  + Y +   +L   P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+   +   G  + V    F ++ N L N I S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>ref|XP_006487694.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 102/177 (58%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   YG ++ L +G V+T  + S   A  + +NHD+SF DRK
Sbjct  41   VIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQNHDLSFCDRK  100

Query  344  VIDAMKVQGYHKGALALA--PYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +A+  + Y +   +L   P  + W+ LR+IC   +F +++++    +RR  I D+L +
Sbjct  101  VPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRRNKIKDLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+   +   G  + V    F ++ N L N I S DLV+P   K  +F + +  IM+
Sbjct  161  VEENCRA---GKAIDVGQAAFNTSLNLLSNTIFSIDLVNP---KEREFKNIVCRIME  211



>emb|CDP11721.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 120/207 (58%), Gaps = 10/207 (5%)
 Frame = +2

Query  74   IFLIPGLVFLLTRKKP----SCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSV  241
            +F I   VF++   KP    S S + PPGP GLP+IG++++LG  P+Q++A +   +G +
Sbjct  7    LFCISLFVFIM---KPFFHGSSSRKTPPGPKGLPIIGSLLELGPRPNQSLAALAKIHGPI  63

Query  242  IWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRM  421
            + L +GS++T    S +AA E+ +  +  F+DR V   +  Q YHK +LA AP    WR 
Sbjct  64   MTLKLGSITTIVASSPEAAKEILQKQEQVFSDRTVPCVVTAQPYHKTSLAWAPGDQRWRS  123

Query  422  LRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSL  601
             RRIC  ++F ++R++   P+R K ++D++L+ +K + S      V +    F +  N +
Sbjct  124  YRRICATQMFTNQRLDLLQPLRHKKVEDLMLYFKKHSDST---APVDIGRASFATALNVI  180

Query  602  GNLILSRDLVDPMSDKASKFFDAMTGI  682
             + + S D+VD  S+ A +F D + GI
Sbjct  181  SSTMFSIDIVDLDSENAQEFKDLILGI  207



>ref|XP_002276576.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 95/172 (55%), Gaps = 3/172 (2%)
 Frame = +2

Query  170  GNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVI  349
            GN+++LG  PHQ+   +   YG ++ L +GS +T  I S K A E+    D +FA R V+
Sbjct  48   GNLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVL  107

Query  350  DAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  529
            +A+++Q +HK ++   P  ++WR LR+IC++++F  +R+  +  +RRK +  +L   E  
Sbjct  108  NAIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHA  164

Query  530  ASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
              S   G  V V    F +T N L N   S DL    S+ + +F D +  IM
Sbjct  165  RESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIM  216



>emb|CBI33813.3| unnamed protein product [Vitis vinifera]
Length=594

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 121/210 (58%), Gaps = 8/210 (4%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            + W++I+++     +  R+  S + +LPPGP   P+IGN+++LG  PH+++A +   YG 
Sbjct  12   VAWTSIYIV-----VSARRSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGP  66

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            V+ L +G V+T  I SA  A E+ +  D SF +R + DA++   +++ ++   P  + WR
Sbjct  67   VMSLKLGCVTTVVITSATMAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWR  126

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
             LR+IC   +F +++++ +  +R + + D+L  +E+   S Q G  V +    F +T N 
Sbjct  127  TLRKICNSHIFTNQKLDSSNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNL  183

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            L N   S DLV+P SD   +F + +  +M+
Sbjct  184  LSNTTFSVDLVEPSSDTVQEFKELVRHMME  213



>ref|XP_009362819.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=501

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 116/210 (55%), Gaps = 7/210 (3%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTR-KKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            L W+   L+  L + L R KK S S +LPPGP   PVIGN+  LG  PH+++A++  K+G
Sbjct  12   LTWA---LLEALFYSLGRGKKSSRSKQLPPGPKPFPVIGNLHQLGDKPHKSLAKLAQKHG  68

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             ++ L +G V++  I SA  A E+ + HD  F +R + D+++   +H   L   P  + W
Sbjct  69   PLMSLKLGQVTSIVISSAAMAKEVLQTHDHFFCNRTIPDSLRAHDHHTIGLPWLPVSTMW  128

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R LR+IC  +LF +K ++    +RR+ + ++L  + + + S   G  + +    F +  N
Sbjct  129  RNLRKICNTQLFANKMLDSNENLRRRKLQELLEEVRQSSVS---GQALDIGKAAFTTVLN  185

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             L N I S DL DP S+ A  F + +  IM
Sbjct  186  LLSNTIFSIDLADPNSEMARNFKEMVCNIM  215



>emb|CBI38803.3| unnamed protein product [Vitis vinifera]
Length=1702

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN++ LG  PHQ++  +   YG V+ L +GS+ST  + S + A E+   +D +F+ R+
Sbjct  73   IIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSISTIVVSSPETAKEVLHRNDQAFSGRE  132

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+ A+K   +H+ ++  +P  +YWR +R+ICT E+F  +R+N +  +R+K + ++L  +E
Sbjct  133  VLGAVKAHNHHESSVIWSPTSAYWRKIRKICTREMFSVQRLNASQGLRKKIVQELLDHVE  192

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +      RG  V +    F ++ N L N I S +L    S  + +F D + G+M+
Sbjct  193  E---CCGRGCAVDIGAATFTASLNLLSNTIFSTNLAHHDSTFSQEFKDIVWGVME  244


 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 101/175 (58%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN++ LG  PHQ++  +   YG V+ L +GSVST  I S++ A E+   ++ +F+ R 
Sbjct  490  IIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSVSTIVISSSETAKEVLHRNNQAFSGRV  549

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+DA+K   +H+ ++  +P  +YWR +R+ICT E+F  +R+  +  +RRK + ++L   +
Sbjct  550  VLDAVKAHNHHESSVVWSPASAYWRKIRKICTREMFSVQRLEASQGLRRKIVQELL---D  606

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
                   RG  V +    F ++ N L N I S +LV   S  + +F D +  +M+
Sbjct  607  HAEECCGRGCAVDIGAATFTASLNLLSNTIFSINLVHHASTFSQEFKDIVWRVME  661


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 90/175 (51%), Gaps = 22/175 (13%)
 Frame = +2

Query  164   VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
             +IGN++ LG  PH+++A +   YG V+ L +GS++T  I S++ A E+   +D +F+ R 
Sbjct  955   IIGNILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRT  1014

Query  344   VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
             V DA++   +H+ ++   P                     ++ +  +RRK + ++L  +E
Sbjct  1015  VPDAVRAHNHHESSVVWVPAS-------------------LDASQGLRRKIVQELLDHVE  1055

Query  524   KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             +  S   RG  V +   VF ++ N L N I S +L    S+ + +F +   G+M+
Sbjct  1056  ECCS---RGCAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIARGVME  1107



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 114/208 (55%), Gaps = 7/208 (3%)
 Frame = +2

Query  74   IFLIPGLVFLLTRK---KPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVI  244
            +F IP + FL  R    + S + RLPPGP G+P++GN++ LG  PH+++ EM   YG ++
Sbjct  9    LFSIP-IFFLFIRPFILRKSDTKRLPPGPRGIPILGNLLQLGPRPHESLHEMAKLYGPLM  67

Query  245  WLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRML  424
             L +GSV+T    S   A EL  NHD  FA+R + D++  Q  H+G LA  P    WR  
Sbjct  68   TLRLGSVTTVVASSPDMARELLHNHDQVFANRPIPDSVTAQPNHQGTLAWVPGDHRWRNR  127

Query  425  RRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLG  604
            RRIC+ +LF  +R++     R + ++ +L  I K   +    T V +    F +T N + 
Sbjct  128  RRICSSQLFTAQRLDILQHFRHRKVEQVLGHIRKHCDA---ATPVDIGSLSFAATLNLMS  184

Query  605  NLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            N I S D++D     A +F D +  IM+
Sbjct  185  NTIFSVDIIDAEFGTAQEFKDVVWSIME  212



>ref|XP_006494410.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=488

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L +G V+T  + S   A  + K HD  F DRK
Sbjct  34   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  93

Query  344  VIDAMKVQGY--HKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +++  Q Y  H+ +L   P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  94   VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLLAY  153

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  S+   G  +      F ++ N L N I S DLVDP      +F + + GIM+
Sbjct  154  VEENCSA---GKALDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKETVWGIME  204



>ref|XP_006494407.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L +G V+T  + S   A  + K HD  F DRK
Sbjct  41   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  100

Query  344  VIDAMKVQGY--HKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +++  Q Y  H+ +L   P    WR LR+IC + +F +++++    +RRK I D+L +
Sbjct  101  VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKDLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  S+   G  +      F ++ N L N I S DLVDP      +F + + GIM+
Sbjct  161  VEENCSA---GKALDFGQAAFNTSLNLLSNTIFSMDLVDP---NEREFKETVWGIME  211



>ref|XP_003636948.1| Cytochrome P450 [Medicago truncatula]
Length=333

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 107/182 (59%), Gaps = 6/182 (3%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLL----TRKKPSCSYRlppgppglpVIGNMMDL-GAFPHQTIAEMK  223
            L +++IF +   VF++    T+K  S +  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    LYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLPHHRLRDLS  65

Query  224  NKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPY  403
             KYG ++ L +G VST  + SA+ A E+ K HD+ FA R  I A K+  Y+   L+ +PY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPY  125

Query  404  GSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI-EKEASSVQRGTGVHVAHFVF  580
            G YWR LR+IC +EL   KR+    P+R + + +++ WI  KE S +     V+   F+ 
Sbjct  126  GDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWIASKEGSEINLTKEVNSRIFLI  185

Query  581  LS  586
             S
Sbjct  186  TS  187



>ref|XP_007209932.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
 gb|EMJ11131.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
Length=500

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 116/209 (56%), Gaps = 6/209 (3%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            L W+   LI  +++ ++R + S   +LPPGP   P+IGN++ LG  PH+++AE+  K+G 
Sbjct  12   LTWT---LIQTILYSISRSQKSSRPKLPPGPKPFPLIGNLLQLGDKPHKSLAELAKKHGP  68

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWR  418
            ++ L +G V+   + SA  A E+ + HD   ++R + D+++   +H   L   P  + WR
Sbjct  69   LMSLKLGKVTAIVVSSAAMAKEVLQTHDQFLSNRTIPDSIRAYDHHIVGLPWIPVSTLWR  128

Query  419  MLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNS  598
             LR+IC  ELF +K ++    +RR  + +++  + +   S Q    V +    F +T N 
Sbjct  129  NLRKICNTELFANKMLDSNQNLRRNKVQELIGQVHR---SSQADEAVDIGRAAFTTTLNL  185

Query  599  LGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            L N I S DL +P S+ A +F + +  IM
Sbjct  186  LSNTIFSIDLANPSSEMAREFQEMVCNIM  214



>ref|XP_008447652.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=297

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 95/174 (55%), Gaps = 3/174 (2%)
 Frame = +2

Query  167  IGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKV  346
            IGN++DLG  PH+++A M   +G +I L +G V+   I S+  A E+ + +D    +R V
Sbjct  40   IGNLLDLGDKPHKSLATMAKVHGQIISLKLGRVTAVVISSSAMAKEVLQTNDQFLCNRTV  99

Query  347  IDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEK  526
             DA+    +H+      P  S WR  R+IC   LF  K ++    +RRK +++++  + K
Sbjct  100  PDALTAHSHHELGFPWIPVSSLWRNYRKICNNMLFAGKILDMNENLRRKKVEELVEIVRK  159

Query  527  EASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             A    +G  V +   VF +T N L N ILS DL DP S+ A +F   + GIM+
Sbjct  160  SA---LKGEAVDLGRLVFTTTLNLLSNTILSVDLADPSSELAKEFKKYVWGIME  210



>ref|XP_010108078.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXC17810.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 108/195 (55%), Gaps = 3/195 (2%)
 Frame = +2

Query  104  LTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAIL  283
            +TR  P+ S +LPPGP  LPVIGN+  LG  PH++++ +   +G ++ L +G V+   + 
Sbjct  23   ITRPNPNISGKLPPGPKPLPVIGNLHQLGDKPHKSLSRLAQLHGPLMSLKLGQVTAIVVS  82

Query  284  SAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKR  463
            S   A E+ + HD   ++R + DA+ + G+    L   P  ++WR LR+IC  +LF  K 
Sbjct  83   SPAMAKEVLQTHDQHLSNRTIPDALHILGHQHTGLPWIPVSNHWRTLRKICNTQLFAVKV  142

Query  464  INETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMS  643
            ++    +RR+ + ++   + +  S+   G  V +    F +T N L N I S DL DP S
Sbjct  143  LDTNQELRRRKVRELFEGVRRSGSA---GESVDIGSEAFTTTLNLLSNTIFSVDLADPKS  199

Query  644  DKASKFFDAMTGIMQ  688
            + A +F +   GIM+
Sbjct  200  ELAREFKEVAWGIMK  214



>gb|KGN58318.1| Cytochrome P450 [Cucumis sativus]
Length=302

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = +2

Query  65   WSAIFLIPGLVFLLTRKK---PSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            W+ I  +  L F+ + K     S S +LPPGP  LP+IGN++DLG  PH+++A M   +G
Sbjct  4    WTCILFLSLLFFISSLKSKWSTSTSKKLPPGPNPLPLIGNLLDLGDKPHKSLATMAKLHG  63

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             +I L +G V+   + S+  A E+ + +D    +R V DA+    +H+      P  S W
Sbjct  64   PIISLKLGRVTAVVVSSSAMAKEVLQTNDQFLCNRVVPDALTAHSHHEVGFPWIPVSSLW  123

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R  R+IC   LF  K ++    +RRK +++++  + K A    +G  V +   VF +T N
Sbjct  124  RNYRKICNNTLFAGKILDMNENLRRKKVEELVEIVRKSA---LKGEAVDLGRLVFATTLN  180

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             L N I S DL DP S+ A +F   + GI++
Sbjct  181  LLSNTIFSVDLADPSSELAKEFKKYVRGILE  211



>gb|AHF22835.1| drimenol oxidase 1 [Persicaria hydropiper]
Length=503

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 122/210 (58%), Gaps = 6/210 (3%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            YL+     ++ GL+   +R   +   +LPPGPPGLP++GN+ DLG+ PH+++A++   +G
Sbjct  3    YLILMICIVVSGLLLYSSR---TSKMKLPPGPPGLPIVGNLFDLGSLPHRSLAKLAKLHG  59

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             V+ L +G +    I S  AA E+ +  D  F +R V D++    +H  ++AL P  + W
Sbjct  60   PVMCLRMGRLRVVVISSDSAAKEVLQTSDTLFCNRFVYDSLTASQHHTFSMALLPPTALW  119

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            + LR+I   +LF + R+N +  +RRK ++D+L ++E   S  + GT +++A   F ++ N
Sbjct  120  KSLRKISASQLFTNARMNASQHLRRKQLEDLLSYVE---SCSRSGTAINIAQAAFNTSVN  176

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             L     S DL+DP S  + +F + +  IM
Sbjct  177  LLSKTFFSVDLIDPSSSNSVEFKEMVWQIM  206



>sp|O23976.1|C76B1_HELTU RecName: Full=7-ethoxycoumarin O-deethylase; Short=ECOD; AltName: 
Full=Cytochrome P450 76B1; AltName: Full=Phenylurea dealkylase 
[Helianthus tuberosus]
 emb|CAA71054.1| 7-ethoxycoumarin O-deethylase [Helianthus tuberosus]
Length=490

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 99/174 (57%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LGA PHQ++A++   +G ++ L +G ++T  I SA AA E+ K  D++F+ R 
Sbjct  37   IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN  96

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + +++     + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct  97   VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR  156

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            K A S +    VH+    F ++ N L N I S+DL DP  D   +F + +T IM
Sbjct  157  KAALSNE---NVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIM  207



>ref|XP_006440463.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
 gb|ESR53703.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
Length=536

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 98/173 (57%), Gaps = 3/173 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LGA PH+++A++   YG V+ L  G V+T  I SA  A E+ +N D SF +R 
Sbjct  80   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  139

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + ++A  P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  140  VPDALRAHQHDEFSMAWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  199

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            +   +   G  + +    F +T N L N I S DL D  SD A +F D ++GI
Sbjct  200  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMISGI  249



>ref|XP_006477329.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 98/175 (56%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LGA PH+++A++   YG V+ L  G V+T  I SA  A E+ +N D SF +R 
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + ++   P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +   +   G  + +    F +T N L N I S DL D  SD A +F D ++GI +
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDIISGITE  214



>ref|XP_006487469.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=506

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 104/174 (60%), Gaps = 5/174 (3%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++AE+   YG ++ L +G V+T  + SA  A  + ++HD SF +R 
Sbjct  52   VIGNLLELGEKPHKSLAELAKIYGPILSLKLGEVTTVVVSSAPMAKYILQDHDSSFYNRM  111

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+    +++  + L P  + W+ LR++C + +F  ++++    +RRK I ++L ++E
Sbjct  112  VKDAIFPHQHNEFGMVLLPVSTTWKNLRKLCNLHIFTTQKLDANQELRRKKIKNLLSYVE  171

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +   +   G  + ++  VF ++ N L N I S DL D  +++  KF D ++ I+
Sbjct  172  ENCRA---GKAIDISQVVFNTSLNLLSNTIFSVDLADDTTER--KFKDTVSSIL  220



>ref|XP_006423672.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
 gb|ESR36912.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
Length=495

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L +G V+T  + S   A  + K HD  F DRK
Sbjct  41   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  100

Query  344  VIDAMKVQGY--HKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +++  Q Y  H+ +L   P    WR LR+IC + +F +++++    +RRK I  +L +
Sbjct  101  VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLDANQDLRRKKIKGLLAY  160

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  S+   G  +      F ++ N L N I S DLVDP      +F D + GIM+
Sbjct  161  VEENCSA---GKAIDFGQAAFNTSLNLLSNTIFSIDLVDP---NEREFKDTVWGIME  211



>ref|XP_002276121.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Vitis vinifera]
Length=465

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 104/175 (59%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN++ LG  PH+++A +   YG V+ L +GS++T  I S++ A E+   +D +F+ R 
Sbjct  43   IIGNILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRT  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   +H+ ++   P   +WR +R+ICT E+F  ++++ +  +RRK + ++L  +E
Sbjct  103  VPDAVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELLDHVE  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +  S   RG  V +   VF ++ N L N I S +L    S+ + +F +   G+M+
Sbjct  163  ECCS---RGCAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIARGVME  214



>gb|ACU20890.1| unknown [Glycine max]
Length=516

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 110/191 (58%), Gaps = 3/191 (2%)
 Frame = +2

Query  116  KPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKA  295
            KP  S + PPGP   P+IGN+++LG  PHQ +A++   YG ++ L +G ++T  I S + 
Sbjct  26   KPLKSSKNPPGPRPFPIIGNILELGNQPHQALAKLSQIYGPIMSLKLGKITTIVISSPQV  85

Query  296  AAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINET  475
            A E+ + HD  FA+R V D ++   +H  ++   P  + WR LRR+C  ++F  ++++ T
Sbjct  86   AKEVLQKHDQIFANRTVPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDST  145

Query  476  VPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS  655
               R++ + D++ ++++     ++G  + +    F +  NS+ N   S DL    SDK+ 
Sbjct  146  QVFRQRKVQDLMDYVKERC---EKGEALDIGEASFTTVLNSISNTFFSMDLAYYTSDKSQ  202

Query  656  KFFDAMTGIMQ  688
            +F D + GIM+
Sbjct  203  EFKDIVWGIME  213



>ref|XP_010661587.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Vitis vinifera]
Length=496

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 104/175 (59%), Gaps = 3/175 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN++ LG  PH+++A +   YG V+ L +GS++T  I S++ A E+   +D +F+ R 
Sbjct  43   IIGNILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRT  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   +H+ ++   P   +WR +R+ICT E+F  ++++ +  +RRK + ++L  +E
Sbjct  103  VPDAVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELLDHVE  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +  S   RG  V +   VF ++ N L N I S +L    S+ + +F +   G+M+
Sbjct  163  ECCS---RGCAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIARGVME  214



>ref|XP_003600322.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=499

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 107/182 (59%), Gaps = 6/182 (3%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLL----TRKKPSCSYRlppgppglpVIGNMMDL-GAFPHQTIAEMK  223
            L +++IF +   VF++    T+K  S +  LPPGP  LP+IGN+ +L G+ PH  + ++ 
Sbjct  6    LYFTSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIGSLPHHRLRDLS  65

Query  224  NKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPY  403
             KYG ++ L +G VST  + SA+ A E+ K HD+ FA R  I A K+  Y+   L+ +PY
Sbjct  66   TKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPY  125

Query  404  GSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI-EKEASSVQRGTGVHVAHFVF  580
            G YWR LR+IC +EL   KR+    P+R + + +++ WI  KE S +     V+   F+ 
Sbjct  126  GDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWIASKEGSEINLTKEVNSRIFLI  185

Query  581  LS  586
             S
Sbjct  186  TS  187



>ref|XP_010692296.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 99/174 (57%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LG  PH+++AE+   YG ++ L +GS++T  I S + A E+F  HD+ F+ R 
Sbjct  37   IIGNIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRA  96

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
              DA++   + + ++   P G  WR LR+I TV+LF  KR++ +  +R+K +D++   IE
Sbjct  97   NTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDEL---IE  153

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
                  +RG  +++    F +T N L +   S DL   +S  + +F D +  +M
Sbjct  154  YARHCSERGLPLNIGKAAFTTTLNLLSSTFFSMDLASHVSSDSQEFKDLVWQMM  207



>ref|XP_006419188.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
 gb|ESR32428.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
Length=499

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 97/173 (56%), Gaps = 3/173 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LGA PH+++A++   YG V+ L  G V+T  I SA  A E+ +N D SF +R 
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + ++   P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGI  682
            +   +   G  + +    F +T N L N I S DL D  SD A +F D ++GI
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMISGI  212



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 116/203 (57%), Gaps = 3/203 (1%)
 Frame = +2

Query  80   LIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIG  259
            L+  L F+    K   S +LPPGP  LP+IG+++DLG  PH+++A +   +G ++ L +G
Sbjct  17   LVKILHFIARGSKTESSGKLPPGPAALPIIGSLLDLGDKPHKSLARLAKTHGPLMSLKLG  76

Query  260  SVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICT  439
             ++T  I S   A E+ + HDVSF++R + DA++   +H+  L   P    WR LR++C 
Sbjct  77   QITTIVISSPTLAKEVLQKHDVSFSNRTIPDALRAHKHHELGLPWVPIAMRWRNLRKVCN  136

Query  440  VELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILS  619
              +F +++++    +RRK I +++  +++   +   G  + +    F +  N+L N I S
Sbjct  137  SYIFTNQKLDANQDLRRKKIQELVALVQEHCLA---GEAMDIGQAAFTTALNALSNSIFS  193

Query  620  RDLVDPMSDKASKFFDAMTGIMQ  688
             +L D  S+ AS+  + + GIM+
Sbjct  194  LNLSDSNSETASQLKEVVGGIME  216



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 106/181 (59%), Gaps = 7/181 (4%)
 Frame = +2

Query  56   YLVWSAIFLIPGLVFLLTRKKPSCS-YRlppgppglpVIGNMMDL-GAFPHQTIAEMKNK  229
            YL +   F++  L+    RKK S S Y +PPGP  LP+IGN+ +L  + PHQ + ++  K
Sbjct  7    YLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLSSQPHQKLRDLAKK  66

Query  230  YGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGS  409
            YG V+ L +G VS   I S + A+E+ K HD+ F+ R  I A ++  Y+  ++A APYG+
Sbjct  67   YGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFAPYGN  126

Query  410  YWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLST  589
            YWR LR+ICT+EL   KR+N   P+R +   ++  WI     + Q G  +++   V  S 
Sbjct  127  YWRQLRKICTLELLSLKRVNSYQPIREEVFFNLAKWI-----ASQVGIPINITEAVRSSI  181

Query  590  F  592
            +
Sbjct  182  Y  182



>ref|XP_006477330.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 97/174 (56%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LGA PH+++A++   YG V+ L  G V+T  I SA  A E+ +N D SF +R 
Sbjct  43   VIGNLLELGAKPHRSLAKLSKIYGPVMSLKFGQVTTVVISSATTAREILQNQDTSFCNRT  102

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + ++   P  +    LR+IC   +F  ++++    +RRK I  +L + +
Sbjct  103  VPDALRAHQHDEFSMGWLPLSTPRTNLRKICNSHIFTTQKLDANQHLRRKRIQQLLAYAQ  162

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +   +   G  + +    F +T N L N I S DL D  SD A +F D + GIM
Sbjct  163  ENCRA---GKAIDIGQAAFNTTLNFLWNTIFSVDLADHSSDTAREFRDMVWGIM  213



>ref|XP_006423711.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
 gb|ESR36951.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
Length=506

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 104/174 (60%), Gaps = 5/174 (3%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++AE+   YG ++ L +G V+T  + SA  A  + ++HD SF +R 
Sbjct  52   VIGNLLELGEKPHKSLAELAKIYGPILSLKLGEVTTVVVSSAPMAKYILQDHDSSFYNRM  111

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+    +++  + + P  + W+ LR++C + +F  ++++    +RRK I ++L ++E
Sbjct  112  VKDAIFPHQHNEFGMVILPVSTTWKNLRKLCNLHIFTTQKLDANQELRRKKIKNLLSYVE  171

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +   +   G  + ++  VF ++ N L N I S DL D  +++  KF D ++ I+
Sbjct  172  ENCRA---GKAIDISQVVFNTSLNLLSNTIFSVDLADDTTER--KFKDTVSSIL  220



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 96/174 (55%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LG  PH+++A++  KYG ++ L +G V+T  I S+  A E+ +  D++F+ R 
Sbjct  39   IIGNLHLLGEQPHKSLAKLSKKYGPIMGLQLGRVTTVVISSSGVAKEVLQKQDLAFSSRS  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA+      + ++   P  S WR LR+I    +F   R++    +R + +++++ +  
Sbjct  99   VPDALHAHNQFQFSVVWLPVASQWRSLRKILNSNIFSGNRLDANQHLRSRKVEELIAYCR  158

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            K +   Q G  V V    F ++ N L N I S+DL DP SD A +F D +  IM
Sbjct  159  KNS---QTGEAVDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIM  209



>ref|XP_004152069.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis sativus]
Length=493

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 114/211 (54%), Gaps = 6/211 (3%)
 Frame = +2

Query  65   WSAIFLIPGLVFLLTRKK---PSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            W+ I  +  L F+ + K     S S +LPPGP  LP+IGN++DLG  PH+++A M   +G
Sbjct  4    WTCILFLSLLFFISSLKSKWSTSTSKKLPPGPNPLPLIGNLLDLGDKPHKSLATMAKLHG  63

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             +I L +G V+   + S+  A E+ + +D    +R V DA+    +H+      P  S W
Sbjct  64   PIISLKLGRVTAVVVSSSAMAKEVLQTNDQFLCNRVVPDALTAHSHHEVGFPWIPVSSLW  123

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R  R+IC   LF  K ++    +RRK +++++  + K   S  +G  V +   VF +T N
Sbjct  124  RNYRKICNNTLFAGKILDMNENLRRKKVEELVEIVRK---SALKGEAVDLGRLVFATTLN  180

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             L N I S DL DP S+ A +F   + GI++
Sbjct  181  LLSNTIFSVDLADPSSELAKEFKKYVRGILE  211



>ref|XP_004164278.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis sativus]
Length=474

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 113/211 (54%), Gaps = 6/211 (3%)
 Frame = +2

Query  65   WSAIFLIPGLVFLLTRKK---PSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYG  235
            W+ I  +  L F+ + K     S S +LPPGP  LP+IGN++DLG  PH+++A M   +G
Sbjct  4    WTCILFLSLLFFISSLKSKWSTSTSKKLPPGPNPLPLIGNLLDLGDKPHKSLATMAKLHG  63

Query  236  SVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYW  415
             +I L +G V+   + S+  A E+ + +D    +R V DA+    +H+      P  S W
Sbjct  64   PIISLKLGRVTAVVVSSSAMAKEVLQTNDQFLCNRDVPDALTAHSHHEVGFPWIPVSSLW  123

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R  R+IC   LF  K ++    +RRK +++++  + K   S  +G  V +   VF +T N
Sbjct  124  RNYRKICNNTLFAGKILDMNENLRRKKVEELVEIVRK---SALKGEAVDLGRLVFATTLN  180

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             L N I S DL DP S+ A +F   + GI +
Sbjct  181  LLSNTIFSVDLADPSSELAKEFKKYVRGIFE  211



>ref|XP_003521519.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN04086.1| Cytochrome P450 76C4 [Glycine soja]
Length=516

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 109/191 (57%), Gaps = 3/191 (2%)
 Frame = +2

Query  116  KPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKA  295
            KP  S + PPGP   P+IGN+++LG  PHQ +A++   YG ++ L +G  +T  I S + 
Sbjct  26   KPLKSSKNPPGPRPFPIIGNILELGNQPHQALAKLSQIYGPIMSLKLGKTTTIVISSPQV  85

Query  296  AAELFKNHDVSFADRKVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINET  475
            A E+ + HD  FA+R V D ++   +H  ++   P  + WR LRR+C  ++F  ++++ T
Sbjct  86   AKEVLQKHDQIFANRTVPDTLRALDHHILSVVWMPPLAQWRTLRRVCATKVFSSQQLDST  145

Query  476  VPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS  655
               R++ + D++ ++++     ++G  + +    F +  NS+ N   S DL    SDK+ 
Sbjct  146  QVFRQRKVQDLMDYVKERC---EKGEALDIGEASFTTVLNSISNTFFSMDLAYYTSDKSQ  202

Query  656  KFFDAMTGIMQ  688
            +F D + GIM+
Sbjct  203  EFKDIVWGIME  213



>emb|CBI38806.3| unnamed protein product [Vitis vinifera]
Length=1183

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 95/172 (55%), Gaps = 3/172 (2%)
 Frame = +2

Query  170  GNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVI  349
            GN+++LG  PHQ+   +   YG ++ L +GS +T  I S K A E+    D +FA R V+
Sbjct  671  GNLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVL  730

Query  350  DAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  529
            +A+++Q +HK ++   P  ++WR LR+IC++++F  +R+  +  +RRK +  +L   E  
Sbjct  731  NAIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHA  787

Query  530  ASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
              S   G  V V    F +T N L N   S DL    S+ + +F D +  IM
Sbjct  788  RESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIM  839


 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 93/172 (54%), Gaps = 3/172 (2%)
 Frame = +2

Query  170  GNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVI  349
            GN+++LG  PH +   +  KYG ++ L +GS++T  I S + A ++    D +F+ R V 
Sbjct  48   GNLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVP  107

Query  350  DAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKE  529
            +A++V  +H  ++   P  ++WR LR+IC++++F  +R++    +R+K +  +L    + 
Sbjct  108  NAIQVASHHHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRQKVVQQLLDHAHES  167

Query  530  ASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
             SS   G  V +    F    N L N + S DL    S+ + +F + +  I+
Sbjct  168  CSS---GRAVDIGRAAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSIL  216



>gb|KHM99472.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            +IGN+ +L  + PH+ + +M  KYG +++L +G VST  I S + A E+ K HD++FA R
Sbjct  47   IIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVISSPECAKEVMKTHDINFATR  106

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
              + A+ +  Y+   +A APYG+YWR LR+ICT+EL   KR+N   P+R + + +++ WI
Sbjct  107  PKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWI  166

Query  521  EKEASSVQRGTGVHVAHFVFLSTF  592
            +       +G+ +++   V  S +
Sbjct  167  DS-----HKGSSINLTQAVLSSIY  185



>emb|CAA71178.1| 7-ethoxycoumarin O-deethylase [Helianthus tuberosus]
Length=477

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 101/176 (57%), Gaps = 5/176 (3%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LGA PHQ++A++   +G ++ L +G ++T  I SA AA E+ K  D++F+ R 
Sbjct  22   IIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRN  81

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA++   + + +++     + WR LRRI +  +F +  +     +R K +++++ +  
Sbjct  82   VPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCR  141

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKAS--KFFDAMTGIM  685
            K A S +    VH+    F ++ N L N I S+DL DP  D AS  +F + +T IM
Sbjct  142  KAALSNE---NVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSASGKEFREVITNIM  194



>ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51039.1| cytochrome P450, putative [Ricinus communis]
Length=377

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 104/174 (60%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+ DLG  PH+++A++   +G ++ L +G ++T  I S+  A E+ + HD+SF++R 
Sbjct  40   IIGNLFDLGDKPHRSLAKLAKIHGPLMSLKLGQITTVVISSSSLAKEVLQKHDLSFSNRT  99

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V+ A++   +H+ ++   P G+ WR LR+IC+  +F +++++    +R K I ++L  ++
Sbjct  100  VVQAIQALDHHEASMPWLPVGAPWRNLRKICSFYIFTNQKLDANQDLRCKKIQELLADVQ  159

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +   +   G  V +    F +  N+L + + S DL D  S+   +F +A+ GIM
Sbjct  160  ECCCA---GAVVDIGEAAFKTMLNTLSSSVFSLDLTDSSSETVREFKEAVRGIM  210



>emb|CAN76783.1| hypothetical protein VITISV_028822 [Vitis vinifera]
Length=259

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +2

Query  386  LALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEAS---SVQRGTG  556
            +AL  YG YWRM+R++C  EL V+KRINE   +RRKC+DDM+ WIE++A+   +  R   
Sbjct  1    MALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDAAKSGAEGRAGE  60

Query  557  VHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            V + HF+F   FN +GN+ LSRD+VD  S    +FF AM G+ +
Sbjct  61   VELPHFLFCMAFNLIGNITLSRDVVDIKSKDGHEFFQAMNGVXE  104



>ref|XP_003530792.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=512

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            +IGN+ +L  + PH+ + +M  KYG +++L +G VST  I S + A E+ K HD++FA R
Sbjct  47   IIGNIYNLLSSQPHRKLRDMALKYGPLMYLQLGEVSTIVISSPECAKEVMKTHDINFATR  106

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
              + A+ +  Y+   +A APYG+YWR LR+ICT+EL   KR+N   P+R + + +++ WI
Sbjct  107  PKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWI  166

Query  521  EKEASSVQRGTGVHVAHFVFLSTF  592
            +       +G+ +++   V  S +
Sbjct  167  DS-----HKGSSINLTQAVLSSIY  185



>ref|XP_010667620.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=265

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 115/211 (55%), Gaps = 8/211 (4%)
 Frame = +2

Query  59   LVWSAIFLIPGLVFLLTRKKPSCSYRlppgppglpVIGNMMDLGAFPHQTIAEMKNKYGS  238
            L W  I L+     L T KK S     PPGP  LP+ GN+  LG  PH ++ E+  +YG 
Sbjct  12   LTWVTIHLL-----LSTVKKLSKPRNFPPGPYPLPIFGNLFCLGNKPHISLTELAKRYGP  66

Query  239  VIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRKVIDAMKVQGYHKGALALAP-YGSYW  415
            ++ L +G V T  I SA  A E  + +D S A+R V+DA++   +H+ ++   P   S W
Sbjct  67   LMMLQLGQVPTVVISSAAVAKEAHQKNDQSLANRYVVDAIRALNHHQYSIGWLPATSSEW  126

Query  416  RMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIEKEASSVQRGTGVHVAHFVFLSTFN  595
            R LR++C   +F   +++ET  +RR  I+D+L ++E+  SS + G  V +    F ++ N
Sbjct  127  RNLRKVCNSLVFSPSKLDETQSLRRDKINDLLTFVER--SSSKGGKAVDIGQVAFTTSLN  184

Query  596  SLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
             L +   S DL DP S+ A +  + +  +++
Sbjct  185  LLSSAFFSMDLGDPSSEYACQLRETIRSLLE  215



>gb|KDO43348.1| hypothetical protein CISIN_1g039787mg, partial [Citrus sinensis]
Length=278

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L  G V+T  + SA  A  + +NHD SF +R 
Sbjct  49   VIGNLLELGDKPHKSLAKLAKIHGPIMTLKFGQVTTVVVSSASMAKAILQNHDSSFCNRM  108

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V DA     + +  +   P  + W+ LR+IC + +F   +++    +RRK I  +L ++E
Sbjct  109  VPDAACSYNHQEIGMVWLPVSTPWKNLRKICNLHIFSSHKLDANQDIRRKKIKHLLAYVE  168

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            +   + + G  + +   VF ++ N L N I S DLVDP    A +F D + GIM
Sbjct  169  E---NCRVGQAIVIGQAVFNTSLNVLSNTIFSVDLVDPT---AREFKDIVWGIM  216



>emb|CDY58284.1| BnaCnng32860D [Brassica napus]
Length=174

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            VIG+M  L G+ PH ++  +   +G ++ L +GS+ T  I S++ A E+FK HD + A R
Sbjct  45   VIGSMFQLSGSPPHHSLTNLSQCHGPIMTLRLGSMLTVVISSSEVAREIFKKHDAALAGR  104

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
            K+ +AMK      G+L  A YG YWRMLRR+CT + FV +R++    VR +C+  ML ++
Sbjct  105  KIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSRCVHQMLRFV  164

Query  521  EK  526
            E+
Sbjct  165  EE  166



>ref|XP_006853497.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
 gb|ERN14964.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
Length=512

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 103/175 (59%), Gaps = 6/175 (3%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            ++G++  LG+ PH+ +A +   +GS++ L +G ++T  + S++ A E+ + +D+ F  R 
Sbjct  44   MVGSLHRLGSRPHEALAALAETHGSLMTLQLGFMTTVVVSSSEMAKEVLQKNDLVFGGRT  103

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            VI+ +K++ Y +G+L  A  G  WR LRRICT +LF  +R++    +R + + +M+  I 
Sbjct  104  VIEVLKMRSYPEGSLVWAQTGPRWRALRRICTTQLFTPQRLDSLQALRCQKVHEMVELIR  163

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +   +V  G         F+++ N + N+I S D+V+P S  A +F D +  IM+
Sbjct  164  QAEPAVDIGRA------AFVTSMNIISNMIFSADMVNPNSGSAQEFRDVVWAIME  212



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 88/156 (56%), Gaps = 5/156 (3%)
 Frame = +2

Query  164  VIGNMMDL-GAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADR  340
            +IGN+  L G+ PH T+ +M N+YG ++ L  G V T  + SA+AA E+ K HD+ FADR
Sbjct  45   LIGNLHQLMGSLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADR  104

Query  341  KVIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWI  520
              I    + GY+   +  +PYG +WR LR+IC  EL   KR+     +R++ ++D++   
Sbjct  105  PKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESIRQEEVEDLI---  161

Query  521  EKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDL  628
             K  SS   GT ++++  +F  T N +      R L
Sbjct  162  -KTISSNPSGTTINLSQMIFTLTNNIIARAAFGRKL  196



>ref|XP_006358804.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 97/174 (56%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LGA PH ++A +  KYG ++ L +G ++T  I S+  A ++ K  D +F+ R 
Sbjct  37   IIGNIHLLGAKPHVSLANLAKKYGPIMSLKLGQITTVVISSSPIAKQVLKTQDQAFSSRS  96

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            V +A++   ++K ++A  P    WRMLRRI    L    R++    +R + + +++ + E
Sbjct  97   VPNALQAHNHYKFSVAWLPVCPQWRMLRRILNTNLLSSNRVDANQHLRSQKVKELIAYCE  156

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            K +   Q+G  V V   VF +  N + N + S+DLVD  SD   +  DA+  I+
Sbjct  157  KCS---QQGEAVDVGQIVFKTNLNLVSNTLFSKDLVDLCSDLKLELTDAILSIV  207



>ref|XP_006494538.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=739

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 99/177 (56%), Gaps = 8/177 (5%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            VIGN+++LG  PH+++A++   +G ++ L +G V+T  + S   A  + K HD  F DRK
Sbjct  38   VIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKTILKEHDSLFCDRK  97

Query  344  VIDAMKVQGY--HKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLW  517
            V +++  Q Y  H+ +L   P    WR LR+IC + +F  ++++    +RRK I  +L +
Sbjct  98   VPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTTQKLDANQDLRRKKIKGLLAY  157

Query  518  IEKEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIMQ  688
            +E+  S+   G  +      F ++ N L N I S DLVDP      +F D + GIM+
Sbjct  158  VEENCSA---GKAIDFGQAAFNTSLNLLSNTIFSIDLVDP---NEREFKDTVWGIME  208



>gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina]
Length=493

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 98/174 (56%), Gaps = 3/174 (2%)
 Frame = +2

Query  164  VIGNMMDLGAFPHQTIAEMKNKYGSVIWLTIGSVSTTAILSAKAAAELFKNHDVSFADRK  343
            +IGN+  LG  PH+++A++  K+G ++ L +G ++T  + S+  A E+ + HD++F+ R 
Sbjct  39   IIGNLHMLGDQPHKSLAKLSKKHGPIMSLKLGQITTVVVSSSGMAKEVLQKHDLAFSSRS  98

Query  344  VIDAMKVQGYHKGALALAPYGSYWRMLRRICTVELFVHKRINETVPVRRKCIDDMLLWIE  523
            + +A+     ++ ++   P  S WR LR+     +F   R++    +R + +++++ +  
Sbjct  99   IPNALHAHNQYQFSVVWLPVASRWRSLRKTLNSNIFSGNRLDANQHLRSRKVEELIAYCR  158

Query  524  KEASSVQRGTGVHVAHFVFLSTFNSLGNLILSRDLVDPMSDKASKFFDAMTGIM  685
            K   + Q G  V V    F ++ N L NLI S+DL DP SD A +F D +  IM
Sbjct  159  K---NCQTGEAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNIM  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700