BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030N19

Length=653
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344463.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    233   2e-68   Solanum tuberosum [potatoes]
ref|XP_009798365.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    231   1e-67   Nicotiana sylvestris
ref|XP_004236257.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    231   1e-67   Solanum lycopersicum
ref|XP_011072176.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    229   5e-67   
ref|XP_009613740.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    229   5e-67   Nicotiana tomentosiformis
ref|XP_009798366.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    228   7e-67   Nicotiana sylvestris
ref|XP_009798364.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    229   1e-66   Nicotiana sylvestris
ref|XP_009613741.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    227   2e-66   
ref|XP_009613739.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    227   4e-66   Nicotiana tomentosiformis
gb|KHG18909.1|  Ferric reduction oxidase 8, mitochondrial -like p...    218   2e-62   Gossypium arboreum [tree cotton]
ref|XP_010037521.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    214   3e-61   Eucalyptus grandis [rose gum]
emb|CDP12742.1|  unnamed protein product                                212   2e-60   Coffea canephora [robusta coffee]
ref|XP_010037520.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    212   3e-60   Eucalyptus grandis [rose gum]
gb|KJB59689.1|  hypothetical protein B456_009G267500                    211   6e-60   Gossypium raimondii
gb|KJB59688.1|  hypothetical protein B456_009G267500                    210   9e-60   Gossypium raimondii
ref|XP_011464152.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    208   4e-59   Fragaria vesca subsp. vesca
ref|XP_007036321.1|  Ferric reduction oxidase 8 isoform 1               208   7e-59   
ref|XP_007210738.1|  hypothetical protein PRUPE_ppa021696mg             207   9e-59   
gb|KDO69496.1|  hypothetical protein CISIN_1g005126mg                   204   1e-57   Citrus sinensis [apfelsine]
ref|XP_006439912.1|  hypothetical protein CICLE_v10019061mg             204   2e-57   Citrus clementina [clementine]
gb|KDO69497.1|  hypothetical protein CISIN_1g005126mg                   204   2e-57   Citrus sinensis [apfelsine]
ref|XP_006476874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    203   3e-57   Citrus sinensis [apfelsine]
ref|XP_011046222.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    202   1e-56   Populus euphratica
gb|ADR70889.1|  ferric reductase oxidase                                202   1e-56   Manihot esculenta [manioc]
ref|XP_004515872.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    199   8e-56   
ref|XP_002321628.1|  ferric reductase-like transmembrane componen...    198   2e-55   Populus trichocarpa [western balsam poplar]
emb|CBI14963.3|  unnamed protein product                                197   4e-55   Vitis vinifera
gb|KDP31036.1|  hypothetical protein JCGZ_11412                         197   5e-55   Jatropha curcas
ref|XP_008459874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    197   7e-55   
gb|KEH31789.1|  oxidoreductase/ferric-chelate reductase                 197   7e-55   Medicago truncatula
ref|XP_002511330.1|  ferric-chelate reductase, putative                 196   1e-54   
ref|XP_010248638.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    195   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_004168892.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    194   4e-54   
ref|XP_004140645.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    194   5e-54   
ref|XP_010102484.1|  Ferric reduction oxidase 8                         193   1e-53   Morus notabilis
ref|XP_010663103.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    192   3e-53   Vitis vinifera
gb|EYU22175.1|  hypothetical protein MIMGU_mgv1a002211mg                191   6e-53   Erythranthe guttata [common monkey flower]
ref|XP_003549599.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    189   3e-52   Glycine max [soybeans]
ref|XP_008373358.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    189   5e-52   
ref|XP_008373357.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    189   5e-52   
ref|XP_002318065.1|  ferric reductase-like transmembrane componen...    180   6e-49   
ref|XP_007155475.1|  hypothetical protein PHAVU_003G204400g             177   5e-48   Phaseolus vulgaris [French bean]
ref|XP_011047810.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    175   4e-47   Populus euphratica
ref|XP_009406362.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    174   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009114914.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    172   3e-46   Brassica rapa
ref|XP_009114915.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    172   4e-46   Brassica rapa
gb|KFK26648.1|  hypothetical protein AALP_AA8G275500                    171   1e-45   Arabis alpina [alpine rockcress]
emb|CDY22585.1|  BnaC05g24230D                                          171   1e-45   Brassica napus [oilseed rape]
ref|XP_010678862.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    170   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010906716.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    169   4e-45   Elaeis guineensis
ref|XP_008777197.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    169   7e-45   Phoenix dactylifera
gb|KGN46442.1|  hypothetical protein Csa_6G093620                       164   4e-43   Cucumis sativus [cucumbers]
ref|XP_010533458.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    163   6e-43   Tarenaya hassleriana [spider flower]
ref|XP_010533455.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    163   7e-43   Tarenaya hassleriana [spider flower]
ref|XP_008238075.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    157   1e-41   
dbj|BAB09387.1|  FRO1 and FRO2-like protein                             158   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199827.2|  ferric reduction oxidase 8                            158   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442496.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    158   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010442495.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    158   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002864039.1|  ATFRO8/FRO8                                        157   7e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010482321.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010482319.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    157   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008239582.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    155   3e-40   
ref|XP_006280084.1|  hypothetical protein CARUB_v10025968mg             155   5e-40   
ref|XP_006280085.1|  hypothetical protein CARUB_v10025968mg             154   1e-39   Capsella rubella
ref|XP_010472423.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...    150   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006402177.1|  hypothetical protein EUTSA_v10012790mg             148   2e-37   Eutrema salsugineum [saltwater cress]
emb|CDY12264.1|  BnaA09g24640D                                          147   4e-37   Brassica napus [oilseed rape]
ref|XP_007215241.1|  hypothetical protein PRUPE_ppa014585mg             125   9e-30   
ref|XP_010678863.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    125   1e-29   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN79355.1|  hypothetical protein VITISV_010064                     109   3e-24   Vitis vinifera
ref|XP_010255644.1|  PREDICTED: uncharacterized protein LOC104596257    105   4e-22   
gb|AES62463.2|  oxidoreductase/ferric-chelate reductase                 102   4e-21   Medicago truncatula
ref|XP_003592212.1|  NADPH oxidase                                      101   5e-21   
gb|KHN34351.1|  Ferric reduction oxidase 8, mitochondrial             98.6    2e-20   Glycine soja [wild soybean]
ref|XP_010112949.1|  Ferric reduction oxidase 2                         100   2e-20   Morus notabilis
emb|CDY07230.1|  BnaCnng02450D                                        99.8    2e-20   
ref|XP_009111537.1|  PREDICTED: ferric reduction oxidase 2-like       99.4    3e-20   Brassica rapa
gb|KHM99348.1|  Ferric reduction oxidase 3, mitochondrial             98.6    4e-20   Glycine soja [wild soybean]
ref|XP_003552408.1|  PREDICTED: ferric reduction oxidase 2-like i...  98.6    6e-20   
ref|XP_006602816.1|  PREDICTED: ferric reduction oxidase 2-like i...  98.6    7e-20   
ref|XP_010556561.1|  PREDICTED: ferric reduction oxidase 2            98.6    7e-20   Tarenaya hassleriana [spider flower]
emb|CDY38012.1|  BnaCnng08730D                                        94.7    1e-19   Brassica napus [oilseed rape]
ref|XP_011468990.1|  PREDICTED: ferric reduction oxidase 2-like i...  97.8    1e-19   Fragaria vesca subsp. vesca
ref|XP_002320814.1|  ferric-chelate reductase family protein          97.4    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009367867.1|  PREDICTED: ferric reduction oxidase 2-like       97.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_004308349.1|  PREDICTED: ferric reduction oxidase 2-like i...  97.1    2e-19   Fragaria vesca subsp. vesca
ref|XP_002511897.1|  ferric-chelate reductase, putative               96.7    3e-19   Ricinus communis
ref|XP_009363039.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  95.5    3e-19   
ref|XP_010669978.1|  PREDICTED: ferric reduction oxidase 2-like       96.3    4e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051741.1|  Ferric reduction oxidase 2, putative             96.3    4e-19   
ref|XP_008803959.1|  PREDICTED: ferric reduction oxidase 2-like       95.5    6e-19   Phoenix dactylifera
ref|XP_003548660.1|  PREDICTED: ferric reduction oxidase 2-like i...  95.1    8e-19   
ref|XP_003528842.1|  PREDICTED: ferric reduction oxidase 2-like i...  95.1    8e-19   
ref|XP_002875038.1|  hypothetical protein ARALYDRAFT_912220           95.1    8e-19   
ref|XP_010426833.1|  PREDICTED: ferric reduction oxidase 2-like       95.1    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004510756.1|  PREDICTED: ferric reduction oxidase 2-like       94.7    1e-18   Cicer arietinum [garbanzo]
ref|XP_009118816.1|  PREDICTED: ferric reduction oxidase 2            94.4    2e-18   Brassica rapa
gb|KFK42543.1|  hypothetical protein AALP_AA1G008100                  94.4    2e-18   Arabis alpina [alpine rockcress]
gb|AED02590.1|  ferric reductase                                      94.4    2e-18   Lotus japonicus
gb|AED02589.1|  ferric reductase                                      94.4    2e-18   Lotus japonicus
ref|XP_006598945.1|  PREDICTED: ferric reduction oxidase 2-like i...  94.4    2e-18   Glycine max [soybeans]
ref|XP_006287152.1|  hypothetical protein CARUB_v10000325mg           94.0    2e-18   
ref|XP_004510757.1|  PREDICTED: ferric reduction oxidase 2-like       94.0    2e-18   Cicer arietinum [garbanzo]
ref|XP_007139803.1|  hypothetical protein PHAVU_008G060100g           93.6    3e-18   Phaseolus vulgaris [French bean]
ref|XP_002272836.2|  PREDICTED: ferric reduction oxidase 4            93.6    3e-18   Vitis vinifera
gb|AES62461.2|  oxidoreductase/ferric-chelate reductase               93.6    3e-18   Medicago truncatula
ref|XP_003592210.1|  Ferric-chelate reductase                         93.6    3e-18   
gb|ADL59931.1|  ferric reductase                                      93.2    4e-18   Phaseolus vulgaris [French bean]
gb|AHW49435.1|  ferric reductase                                      93.2    4e-18   Phaseolus vulgaris [French bean]
gb|AHW49458.1|  ferric reductase                                      93.2    4e-18   Phaseolus vulgaris [French bean]
ref|XP_003528841.1|  PREDICTED: ferric reduction oxidase 2-like i...  93.2    4e-18   Glycine max [soybeans]
gb|KHN26943.1|  Ferric reduction oxidase 2                            93.2    4e-18   Glycine soja [wild soybean]
ref|XP_009411425.1|  PREDICTED: ferric reduction oxidase 2-like       93.2    4e-18   
gb|AHW49440.1|  ferric reductase                                      93.2    4e-18   Phaseolus vulgaris [French bean]
ref|XP_007143462.1|  hypothetical protein PHAVU_007G073900g           93.2    4e-18   Phaseolus vulgaris [French bean]
emb|CBI22668.3|  unnamed protein product                              93.6    4e-18   Vitis vinifera
gb|KDP28592.1|  hypothetical protein JCGZ_14363                       92.8    6e-18   Jatropha curcas
emb|CAN74772.1|  hypothetical protein VITISV_024875                   92.8    8e-18   Vitis vinifera
ref|XP_010477584.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  92.4    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009119709.1|  PREDICTED: ferric reduction oxidase 2            92.4    8e-18   Brassica rapa
ref|XP_010456303.1|  PREDICTED: ferric reduction oxidase 2-like       91.7    1e-17   
ref|XP_006418435.1|  hypothetical protein EUTSA_v10006930mg           91.3    2e-17   Eutrema salsugineum [saltwater cress]
gb|ADR70886.1|  ferric reductase oxidase                              90.9    2e-17   Manihot esculenta [manioc]
ref|XP_010472415.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  84.7    2e-17   
ref|XP_009367868.1|  PREDICTED: ferric reduction oxidase 2-like       90.9    2e-17   
ref|XP_010661833.1|  PREDICTED: ferric reduction oxidase 2 isofor...  90.9    3e-17   Vitis vinifera
gb|ADR70891.1|  ferric reductase oxidase                              90.5    3e-17   Manihot esculenta [manioc]
ref|XP_002975964.1|  hypothetical protein SELMODRAFT_51485            90.1    3e-17   
ref|XP_010424035.1|  PREDICTED: ferric reduction oxidase 2-like       90.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002968520.1|  hypothetical protein SELMODRAFT_145556           90.1    4e-17   
ref|XP_006490654.1|  PREDICTED: ferric reduction oxidase 4-like       90.1    5e-17   Citrus sinensis [apfelsine]
ref|XP_002892053.1|  hypothetical protein ARALYDRAFT_470119           89.7    5e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_002272804.1|  PREDICTED: ferric reduction oxidase 2            89.7    5e-17   Vitis vinifera
emb|CAN76960.1|  hypothetical protein VITISV_029500                   89.7    5e-17   Vitis vinifera
emb|CBI22669.3|  unnamed protein product                              89.7    6e-17   Vitis vinifera
ref|XP_003622505.1|  Ferric-chelate reductase                         89.7    6e-17   
ref|XP_002275993.1|  PREDICTED: ferric reduction oxidase 2 isofor...  89.7    6e-17   Vitis vinifera
emb|CAN74771.1|  hypothetical protein VITISV_024874                   89.7    6e-17   Vitis vinifera
emb|CBI40432.3|  unnamed protein product                              89.7    6e-17   Vitis vinifera
ref|XP_010460078.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  89.4    8e-17   
gb|AAB72168.1|  unknown                                               89.4    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270349.1|  PREDICTED: probable ferric reduction oxidase 1   89.4    9e-17   Nelumbo nucifera [Indian lotus]
gb|ABJ16556.1|  Fe(III)-chelate reductase                             89.0    9e-17   Citrus junos [kuzu]
gb|AAF81316.1|AC061957_12  Identical to FRO2 protein from Arabido...  89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173715.2|  ferric reduction oxidase 3                          89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAK95654.2|AF405422_1  ferric-chelate reductase                    89.0    1e-16   Pisum sativum [garden pea]
gb|KDO86264.1|  hypothetical protein CISIN_1g005553mg                 89.0    1e-16   Citrus sinensis [apfelsine]
ref|NP_171664.1|  ferric reduction oxidase 2                          89.0    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006444982.1|  hypothetical protein CICLE_v10019053mg           89.0    1e-16   Citrus clementina [clementine]
gb|KHN21778.1|  Ferric reduction oxidase 4                            88.6    1e-16   Glycine soja [wild soybean]
ref|XP_011036851.1|  PREDICTED: ferric reduction oxidase 2            88.2    2e-16   Populus euphratica
ref|XP_007143461.1|  hypothetical protein PHAVU_007G073800g           88.2    2e-16   Phaseolus vulgaris [French bean]
ref|XP_010498794.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  87.8    3e-16   Camelina sativa [gold-of-pleasure]
gb|KJB41380.1|  hypothetical protein B456_007G101800                  87.8    3e-16   Gossypium raimondii
gb|EMT07839.1|  Superoxide-generating NADPH oxidase heavy chain s...  87.4    3e-16   
ref|XP_010474762.1|  PREDICTED: ferric reduction oxidase 2-like i...  87.8    3e-16   Camelina sativa [gold-of-pleasure]
gb|KDP22239.1|  hypothetical protein JCGZ_26070                       87.4    3e-16   Jatropha curcas
ref|XP_008233004.1|  PREDICTED: ferric reduction oxidase 2 isofor...  87.4    3e-16   
gb|KJB41381.1|  hypothetical protein B456_007G101800                  87.4    4e-16   Gossypium raimondii
ref|XP_008233005.1|  PREDICTED: ferric reduction oxidase 2 isofor...  87.4    4e-16   
emb|CDY38014.1|  BnaCnng08750D                                        87.4    4e-16   Brassica napus [oilseed rape]
gb|KDP28593.1|  hypothetical protein JCGZ_14364                       87.4    4e-16   Jatropha curcas
ref|XP_011043855.1|  PREDICTED: ferric reduction oxidase 4-like i...  87.4    4e-16   Populus euphratica
ref|XP_007220622.1|  hypothetical protein PRUPE_ppa002203mg           87.4    4e-16   
ref|XP_011043854.1|  PREDICTED: ferric reduction oxidase 4-like i...  87.0    4e-16   Populus euphratica
ref|XP_010060545.1|  PREDICTED: ferric reduction oxidase 4-like       87.0    4e-16   
ref|XP_011043852.1|  PREDICTED: ferric reduction oxidase 4-like i...  87.0    4e-16   Populus euphratica
gb|KJB34152.1|  hypothetical protein B456_006G050400                  87.0    5e-16   Gossypium raimondii
ref|XP_006418436.1|  hypothetical protein EUTSA_v10006972mg           87.0    5e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002513661.1|  ferric-chelate reductase, putative               87.4    5e-16   
gb|KCW90645.1|  hypothetical protein EUGRSUZ_A02749                   87.0    6e-16   Eucalyptus grandis [rose gum]
ref|XP_002893257.1|  ATFRO3/FRO3                                      86.7    7e-16   
ref|XP_007038788.1|  Ferric reduction oxidase 2                       86.3    8e-16   
ref|XP_003622477.1|  Ferric reductase                                 84.7    9e-16   
ref|XP_009757787.1|  PREDICTED: ferric reduction oxidase 2-like       85.9    1e-15   Nicotiana sylvestris
gb|EYU32157.1|  hypothetical protein MIMGU_mgv1a019436mg              85.9    1e-15   Erythranthe guttata [common monkey flower]
gb|AAU94355.1|  iron reductase                                        85.9    1e-15   Pisum sativum [garden pea]
ref|NP_001185067.1|  ferric reduction oxidase 3                       85.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KEH18825.1|  oxidoreductase/ferric-chelate reductase               85.1    2e-15   Medicago truncatula
ref|XP_006339613.1|  PREDICTED: ferric reduction oxidase 2-like       85.1    2e-15   Solanum tuberosum [potatoes]
ref|XP_009118818.1|  PREDICTED: probable ferric reduction oxidase...  84.7    2e-15   Brassica rapa
gb|KEH18826.1|  oxidoreductase/ferric-chelate reductase               85.1    2e-15   Medicago truncatula
ref|XP_009118817.1|  PREDICTED: probable ferric reduction oxidase...  84.7    2e-15   Brassica rapa
ref|XP_009118820.1|  PREDICTED: probable ferric reduction oxidase...  84.7    2e-15   Brassica rapa
emb|CDP08775.1|  unnamed protein product                              84.7    3e-15   Coffea canephora [robusta coffee]
gb|AAR15416.1|  ferric reductase                                      84.7    3e-15   Medicago truncatula
gb|EYU20558.1|  hypothetical protein MIMGU_mgv1a002085mg              84.7    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_008803960.1|  PREDICTED: ferric reduction oxidase 2-like       84.7    3e-15   
ref|XP_010055096.1|  PREDICTED: ferric reduction oxidase 2-like i...  84.3    3e-15   
ref|XP_006306887.1|  hypothetical protein CARUB_v10008441mg           84.3    4e-15   Capsella rubella
ref|XP_010480116.1|  PREDICTED: ferric reduction oxidase 2-like       84.3    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011038370.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  84.3    4e-15   Populus euphratica
ref|XP_007038790.1|  Ferric reduction oxidase 4 isoform 2             84.0    5e-15   
ref|XP_011043857.1|  PREDICTED: ferric reduction oxidase 2-like i...  83.6    6e-15   Populus euphratica
ref|XP_007038789.1|  Ferric reduction oxidase 4 isoform 1             83.6    6e-15   
ref|XP_011043858.1|  PREDICTED: ferric reduction oxidase 2-like i...  83.6    6e-15   Populus euphratica
ref|XP_009609066.1|  PREDICTED: ferric reduction oxidase 2-like       83.6    6e-15   Nicotiana tomentosiformis
ref|XP_008234849.1|  PREDICTED: ferric reduction oxidase 4-like       83.6    6e-15   Prunus mume [ume]
ref|XP_009368746.1|  PREDICTED: ferric reduction oxidase 4-like i...  83.6    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_009411423.1|  PREDICTED: ferric reduction oxidase 2-like       83.6    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852345.1|  hypothetical protein AMTR_s00049p00212370        83.2    8e-15   
gb|KCW71572.1|  hypothetical protein EUGRSUZ_E00107                   83.2    8e-15   Eucalyptus grandis [rose gum]
ref|XP_006362676.1|  PREDICTED: ferric reduction oxidase 4-like       83.2    8e-15   Solanum tuberosum [potatoes]
gb|EYU34160.1|  hypothetical protein MIMGU_mgv1a023886mg              83.2    8e-15   Erythranthe guttata [common monkey flower]
gb|AAT01415.1|  ferric reductase                                      83.2    8e-15   Cucumis sativus [cucumbers]
gb|KCW71571.1|  hypothetical protein EUGRSUZ_E00107                   83.2    8e-15   Eucalyptus grandis [rose gum]
ref|XP_010055097.1|  PREDICTED: ferric reduction oxidase 2-like       83.2    9e-15   Eucalyptus grandis [rose gum]
ref|XP_010457106.1|  PREDICTED: ferric reduction oxidase 2            82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004143614.1|  PREDICTED: ferric reduction oxidase 2-like       82.8    1e-14   Cucumis sativus [cucumbers]
ref|NP_001234329.1|  ferric-chelate reductase                         82.8    1e-14   
ref|XP_002305245.2|  ferric-chelate reductase family protein          82.8    1e-14   
gb|EMS45573.1|  Superoxide-generating NADPH oxidase heavy chain s...  82.8    1e-14   Triticum urartu
ref|XP_008445871.1|  PREDICTED: ferric reduction oxidase 2-like       82.4    2e-14   Cucumis melo [Oriental melon]
ref|XP_009368744.1|  PREDICTED: ferric reduction oxidase 2-like       82.4    2e-14   
ref|XP_007220890.1|  hypothetical protein PRUPE_ppa014767mg           82.4    2e-14   
ref|XP_002305246.1|  hypothetical protein POPTR_0004s07730g           82.4    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_004496531.1|  PREDICTED: ferric reduction oxidase 2-like       82.0    2e-14   
gb|EPS59492.1|  ferric-chelate reductase                              81.6    3e-14   Genlisea aurea
ref|XP_002511896.1|  ferric-chelate reductase, putative               81.6    3e-14   
gb|EYU25131.1|  hypothetical protein MIMGU_mgv1a023728mg              81.6    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_011093123.1|  PREDICTED: LOW QUALITY PROTEIN: ferric reduc...  81.6    3e-14   
ref|XP_004253309.1|  PREDICTED: ferric reduction oxidase 4-like       78.2    3e-14   
ref|XP_010661832.1|  PREDICTED: ferric reduction oxidase 2 isofor...  81.6    3e-14   
ref|XP_002275942.2|  PREDICTED: ferric reduction oxidase 2 isofor...  81.6    3e-14   
ref|XP_009800600.1|  PREDICTED: ferric reduction oxidase 2-like       81.3    3e-14   Nicotiana sylvestris
emb|CAN82573.1|  hypothetical protein VITISV_034719                   81.3    5e-14   Vitis vinifera
ref|XP_008376640.1|  PREDICTED: ferric reduction oxidase 4-like i...  80.9    5e-14   
ref|XP_010545917.1|  PREDICTED: ferric reduction oxidase 4            80.9    6e-14   Tarenaya hassleriana [spider flower]
gb|KHN46714.1|  Ferric reduction oxidase 2                            80.9    6e-14   Glycine soja [wild soybean]
gb|ABU54827.1|  ferric reductase                                      80.9    6e-14   Malus baccata var. xiaojinensis
ref|XP_009368745.1|  PREDICTED: ferric reduction oxidase 4-like i...  80.1    8e-14   Pyrus x bretschneideri [bai li]
ref|XP_010045373.1|  PREDICTED: ferric reduction oxidase 7, chlor...  80.5    8e-14   Eucalyptus grandis [rose gum]
ref|XP_010055095.1|  PREDICTED: ferric reduction oxidase 2-like i...  80.1    9e-14   
ref|XP_009375512.1|  PREDICTED: ferric reduction oxidase 4-like i...  80.1    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_011470323.1|  PREDICTED: ferric reduction oxidase 2-like       80.1    1e-13   Fragaria vesca subsp. vesca
ref|XP_006372444.1|  ferric-chelate reductase family protein          79.7    1e-13   
ref|XP_010462520.1|  PREDICTED: probable ferric reduction oxidase 1   79.3    1e-13   
ref|XP_009621944.1|  PREDICTED: ferric reduction oxidase 2-like i...  79.3    2e-13   Nicotiana tomentosiformis
gb|EYU32154.1|  hypothetical protein MIMGU_mgv1a002115mg              79.3    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_009621943.1|  PREDICTED: ferric reduction oxidase 2-like i...  79.3    2e-13   Nicotiana tomentosiformis
ref|XP_008234904.1|  PREDICTED: ferric reduction oxidase 2-like       79.3    2e-13   
ref|XP_009800598.1|  PREDICTED: ferric reduction oxidase 2-like i...  79.3    2e-13   Nicotiana sylvestris
ref|XP_009800599.1|  PREDICTED: ferric reduction oxidase 2-like i...  79.3    2e-13   Nicotiana sylvestris
ref|XP_009612091.1|  PREDICTED: ferric reduction oxidase 2-like       79.3    2e-13   Nicotiana tomentosiformis
gb|EYU25132.1|  hypothetical protein MIMGU_mgv1a019178mg              79.3    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_008376639.1|  PREDICTED: ferric reduction oxidase 2-like       79.0    2e-13   
ref|XP_010919103.1|  PREDICTED: ferric reduction oxidase 2-like       79.0    2e-13   
ref|XP_007135107.1|  hypothetical protein PHAVU_010G101500g           79.0    3e-13   Phaseolus vulgaris [French bean]
ref|XP_004140754.1|  PREDICTED: ferric reduction oxidase 4-like       78.6    3e-13   
ref|XP_010474764.1|  PREDICTED: probable ferric reduction oxidase 1   78.6    3e-13   
ref|XP_002986459.1|  hypothetical protein SELMODRAFT_425399           77.8    3e-13   
gb|KJB34155.1|  hypothetical protein B456_006G050700                  78.6    3e-13   Gossypium raimondii
ref|XP_007221102.1|  hypothetical protein PRUPE_ppa017732mg           78.6    3e-13   
ref|XP_008343838.1|  PREDICTED: ferric reduction oxidase 4-like       75.9    3e-13   
ref|XP_002892052.1|  predicted protein                                78.2    4e-13   Arabidopsis lyrata subsp. lyrata
gb|KGN57404.1|  hypothetical protein Csa_3G183380                     78.2    4e-13   Cucumis sativus [cucumbers]
ref|XP_011092747.1|  PREDICTED: ferric reduction oxidase 2-like i...  78.2    4e-13   Sesamum indicum [beniseed]
ref|XP_011470324.1|  PREDICTED: ferric reduction oxidase 4-like i...  78.2    4e-13   Fragaria vesca subsp. vesca
ref|NP_171665.1|  ferric reduction oxidase 1                          77.8    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396230.1|  hypothetical protein EUTSA_v10028469mg           77.8    6e-13   Eutrema salsugineum [saltwater cress]
emb|CAA70769.1|  FRO1                                                 77.8    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422002.1|  hypothetical protein CICLE_v10006989mg           77.4    7e-13   
ref|XP_004253331.2|  PREDICTED: ferric reduction oxidase 4            77.4    7e-13   Solanum lycopersicum
gb|EPS59494.1|  hypothetical protein M569_15313                       74.3    7e-13   Genlisea aurea
ref|XP_006372445.1|  hypothetical protein POPTR_0017s01700g           77.4    8e-13   
ref|XP_004157221.1|  PREDICTED: ferric reduction oxidase 4-like       77.4    8e-13   
ref|XP_006422008.1|  hypothetical protein CICLE_v10007201mg           73.6    1e-12   Citrus clementina [clementine]
ref|XP_009377542.1|  PREDICTED: ferric reduction oxidase 4-like       77.0    1e-12   Pyrus x bretschneideri [bai li]
gb|KCW90647.1|  hypothetical protein EUGRSUZ_A02751                   76.6    1e-12   Eucalyptus grandis [rose gum]
ref|XP_006360210.1|  PREDICTED: ferric reduction oxidase 2-like       76.6    1e-12   Solanum tuberosum [potatoes]
ref|XP_011038373.1|  PREDICTED: ferric reduction oxidase 2-like i...  76.6    1e-12   Populus euphratica
ref|XP_011038371.1|  PREDICTED: ferric reduction oxidase 2-like i...  76.3    1e-12   Populus euphratica
ref|XP_009798642.1|  PREDICTED: ferric reduction oxidase 4-like       76.3    2e-12   Nicotiana sylvestris
ref|XP_011092755.1|  PREDICTED: ferric reduction oxidase 2-like i...  76.3    2e-12   Sesamum indicum [beniseed]
gb|KCW71573.1|  hypothetical protein EUGRSUZ_E00108                   75.9    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010240299.1|  PREDICTED: ferric reduction oxidase 2-like       75.9    3e-12   
ref|XP_009411424.1|  PREDICTED: ferric reduction oxidase 2-like       75.9    3e-12   
ref|XP_006353911.1|  PREDICTED: ferric reduction oxidase 4-like       75.5    3e-12   Solanum tuberosum [potatoes]
gb|KCW87545.1|  hypothetical protein EUGRSUZ_B03992                   75.5    3e-12   
gb|EYU25134.1|  hypothetical protein MIMGU_mgv1a024649mg              75.1    4e-12   
ref|XP_009355418.1|  PREDICTED: ferric reduction oxidase 6            74.7    6e-12   
ref|XP_011076479.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  74.7    7e-12   
ref|XP_008365332.1|  PREDICTED: ferric reduction oxidase 6-like       73.9    9e-12   
ref|XP_010024990.1|  PREDICTED: ferric reduction oxidase 2-like       73.9    1e-11   
ref|XP_009375511.1|  PREDICTED: ferric reduction oxidase 4-like i...  73.9    1e-11   
ref|XP_002874156.1|  predicted protein                                73.6    1e-11   
ref|XP_006422009.1|  hypothetical protein CICLE_v10007201mg           69.3    1e-11   
gb|EYU32156.1|  hypothetical protein MIMGU_mgv1a024360mg              73.2    2e-11   
emb|CBI29608.3|  unnamed protein product                              73.2    2e-11   
ref|XP_011092779.1|  PREDICTED: ferric reduction oxidase 2-like       72.8    2e-11   
ref|XP_008439292.1|  PREDICTED: ferric reduction oxidase 4-like i...  72.8    3e-11   
ref|XP_009798669.1|  PREDICTED: ferric reduction oxidase 4-like       72.4    3e-11   
emb|CAN83907.1|  hypothetical protein VITISV_035329                   72.4    3e-11   
ref|XP_002266723.2|  PREDICTED: ferric reduction oxidase 7, chlor...  72.4    3e-11   
ref|XP_011093124.1|  PREDICTED: ferric reduction oxidase 2-like       72.4    3e-11   
ref|XP_006306803.1|  hypothetical protein CARUB_v10008345mg           72.4    3e-11   
ref|XP_001767136.1|  ferric reductase-like transmembrane component    72.4    4e-11   
emb|CDP08776.1|  unnamed protein product                              72.0    4e-11   
ref|XP_006388819.1|  hypothetical protein POPTR_0096s00200g           69.3    4e-11   
ref|XP_010105755.1|  Ferric reduction oxidase 4                       72.0    5e-11   
ref|NP_197786.2|  ferric reduction oxidase 4                          71.6    5e-11   
gb|KHN21777.1|  Ferric reduction oxidase 2                            71.6    5e-11   
ref|XP_003536451.2|  PREDICTED: ferric reduction oxidase 2-like       71.6    6e-11   
ref|XP_009375514.1|  PREDICTED: ferric reduction oxidase 4-like       71.2    7e-11   
ref|XP_002975965.1|  hypothetical protein SELMODRAFT_416159           71.2    7e-11   
ref|XP_002968519.1|  hypothetical protein SELMODRAFT_440376           71.2    7e-11   
ref|XP_009150921.1|  PREDICTED: ferric reduction oxidase 4-like       70.9    8e-11   
gb|EYU32155.1|  hypothetical protein MIMGU_mgv1a019951mg              71.2    8e-11   
ref|XP_010671643.1|  PREDICTED: ferric reduction oxidase 4-like       70.5    1e-10   
ref|XP_010028464.1|  PREDICTED: ferric reduction oxidase 7, chlor...  70.5    1e-10   
gb|KEH31790.1|  oxidoreductase/ferric-chelate reductase               69.7    2e-10   
ref|XP_002874157.1|  predicted protein                                70.1    2e-10   
ref|XP_004229896.2|  PREDICTED: ferric reduction oxidase 2            70.1    2e-10   
gb|KFK27689.1|  hypothetical protein AALP_AA8G415800                  68.9    3e-10   
ref|XP_003579831.1|  PREDICTED: ferric reduction oxidase 7, chlor...  68.9    4e-10   
gb|ADR70887.1|  ferric reductase oxidase                              68.9    4e-10   
dbj|BAB08721.1|  FRO2 homolog                                         68.9    4e-10   
ref|XP_006394658.1|  hypothetical protein EUTSA_v10003544mg           68.9    5e-10   
gb|ACX54451.1|  hypothetical protein F156                             66.2    6e-10   
ref|XP_009375513.1|  PREDICTED: ferric reduction oxidase 4-like i...  68.2    7e-10   
ref|XP_009602843.1|  PREDICTED: ferric reduction oxidase 4-like       65.9    7e-10   
ref|XP_006339609.1|  PREDICTED: ferric reduction oxidase 2-like       68.2    8e-10   
gb|KEH18874.1|  oxidoreductase/ferric-chelate reductase               67.8    8e-10   
ref|XP_002515792.1|  ferric-chelate reductase, putative               67.8    9e-10   
gb|EYU33250.1|  hypothetical protein MIMGU_mgv1a001927mg              67.0    1e-09   
gb|KJB73649.1|  hypothetical protein B456_011G242100                  67.0    2e-09   
gb|KCW55200.1|  hypothetical protein EUGRSUZ_I01139                   66.6    2e-09   
gb|KCW55199.1|  hypothetical protein EUGRSUZ_I01139                   66.6    2e-09   
gb|KHG27220.1|  Ferric reduction oxidase 7, chloroplastic -like p...  66.6    2e-09   
ref|XP_010028461.1|  PREDICTED: ferric reduction oxidase 7, chlor...  66.6    2e-09   
ref|XP_010454684.1|  PREDICTED: ferric reduction oxidase 4-like i...  66.6    2e-09   
gb|KCW55197.1|  hypothetical protein EUGRSUZ_I01139                   66.6    2e-09   
ref|XP_006339610.1|  PREDICTED: ferric reduction oxidase 2-like       66.2    3e-09   
ref|XP_011464975.1|  PREDICTED: ferric reduction oxidase 7, chlor...  66.2    3e-09   
gb|EEE61072.1|  hypothetical protein OsJ_14936                        65.9    3e-09   
ref|XP_009130092.1|  PREDICTED: ferric reduction oxidase 5 isofor...  65.9    3e-09   
emb|CDY46972.1|  BnaA02g32740D                                        65.9    3e-09   
gb|EEC77356.1|  hypothetical protein OsI_16048                        65.9    4e-09   
emb|CAD40972.2|  OSJNBa0027P08.6                                      65.9    4e-09   
dbj|BAD18962.1|  ferric reductase                                     65.9    4e-09   
ref|NP_001052896.1|  Os04g0444800                                     65.9    4e-09   
ref|XP_004301589.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.5    5e-09   
ref|XP_010028458.1|  PREDICTED: ferric reduction oxidase 6-like       65.5    6e-09   
ref|XP_010028459.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.1    6e-09   
ref|XP_008218605.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.1    7e-09   
ref|XP_010421206.1|  PREDICTED: ferric reduction oxidase 4 isofor...  65.1    7e-09   
ref|XP_010028466.1|  PREDICTED: ferric reduction oxidase 7, chlor...  65.1    7e-09   
ref|XP_009589301.1|  PREDICTED: ferric reduction oxidase 6-like i...  64.7    8e-09   
ref|XP_007225171.1|  hypothetical protein PRUPE_ppa002259mg           64.7    9e-09   
ref|XP_007009660.1|  Ferric reduction oxidase 7 isoform 2             64.3    1e-08   
ref|XP_006289602.1|  hypothetical protein CARUB_v10003155mg           64.3    1e-08   
ref|XP_002519390.1|  ferric-chelate reductase, putative               64.3    1e-08   
ref|XP_007009659.1|  Ferric reduction oxidase 7 isoform 1             63.9    1e-08   
ref|XP_010101613.1|  Ferric reduction oxidase 7                       63.9    1e-08   
ref|XP_006431349.1|  hypothetical protein CICLE_v10000235mg           63.9    1e-08   
ref|XP_006829040.1|  hypothetical protein AMTR_s00001p00254670        63.9    1e-08   
emb|CDP17766.1|  unnamed protein product                              63.9    2e-08   
ref|XP_009109991.1|  PREDICTED: ferric reduction oxidase 4-like       62.8    2e-08   
ref|XP_010265600.1|  PREDICTED: ferric reduction oxidase 7, chlor...  63.9    2e-08   
ref|XP_006579584.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  62.8    2e-08   
ref|XP_006653450.1|  PREDICTED: ferric reduction oxidase 7, chlor...  63.5    2e-08   
sp|Q9FLW2.1|FRO5_ARATH  RecName: Full=Ferric reduction oxidase 5;...  63.5    2e-08   
ref|XP_010493527.1|  PREDICTED: ferric reduction oxidase 4-like i...  63.2    3e-08   
ref|NP_001147916.1|  ferric reductase-like transmembrane component    63.2    3e-08   
ref|XP_002967602.1|  hypothetical protein SELMODRAFT_10731            63.2    3e-08   
ref|XP_006282058.1|  hypothetical protein CARUB_v10028303mg           62.8    3e-08   
emb|CDX90043.1|  BnaA10g00390D                                        62.8    4e-08   
ref|XP_009368747.1|  PREDICTED: ferric reduction oxidase 4-like i...  62.8    4e-08   
emb|CDY44266.1|  BnaC02g41510D                                        62.4    4e-08   
ref|XP_011470325.1|  PREDICTED: ferric reduction oxidase 5-like i...  62.4    5e-08   
gb|KFK26610.1|  hypothetical protein AALP_AA8G271300                  62.0    5e-08   
gb|KDO69498.1|  hypothetical protein CISIN_1g005126mg                 62.0    6e-08   
ref|XP_006836945.1|  hypothetical protein AMTR_s00099p00157080        62.0    6e-08   
ref|XP_007036322.1|  Ferric reduction oxidase 8 isoform 2             62.0    7e-08   
ref|XP_009589295.1|  PREDICTED: ferric reduction oxidase 6-like i...  62.0    7e-08   
gb|EYU25133.1|  hypothetical protein MIMGU_mgv1a025470mg              62.0    7e-08   
ref|XP_002446539.1|  hypothetical protein SORBIDRAFT_06g017800        62.0    8e-08   
ref|XP_010682185.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.6    8e-08   
ref|XP_004155276.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.6    8e-08   
ref|XP_004975731.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.6    1e-07   
gb|ACL54664.1|  unknown                                               61.6    1e-07   
ref|XP_006470777.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.2    1e-07   
ref|XP_004133744.1|  PREDICTED: ferric reduction oxidase 7, chlor...  61.2    1e-07   
gb|KFK22245.1|  hypothetical protein AALP_AAs62663U000200             60.1    1e-07   
gb|KFK22246.1|  hypothetical protein AALP_AAs62663U000200             60.5    1e-07   
gb|KFK22243.1|  hypothetical protein AALP_AAs62663U000200             60.1    2e-07   
ref|XP_011087588.1|  PREDICTED: ferric reduction oxidase 7, chlor...  60.5    2e-07   
gb|KFK22244.1|  hypothetical protein AALP_AAs62663U000200             60.1    2e-07   
gb|KDP29818.1|  hypothetical protein JCGZ_19157                       60.5    2e-07   
ref|XP_010442443.1|  PREDICTED: ferric reduction oxidase 7, chlor...  60.5    2e-07   
ref|XP_007147544.1|  hypothetical protein PHAVU_006G133600g           60.5    2e-07   
ref|XP_010682186.1|  PREDICTED: ferric reduction oxidase 7, chlor...  60.5    2e-07   
ref|XP_006368813.1|  hypothetical protein POPTR_0001s11860g           59.7    3e-07   
ref|XP_009782893.1|  PREDICTED: ferric reduction oxidase 7, chlor...  60.1    3e-07   
ref|XP_006368814.1|  hypothetical protein POPTR_0001s11860g           60.1    3e-07   
ref|XP_006368815.1|  hypothetical protein POPTR_0001s11860g           59.7    3e-07   
ref|XP_006368818.1|  hypothetical protein POPTR_0001s11860g           59.7    3e-07   
ref|XP_006368816.1|  hypothetical protein POPTR_0001s11860g           60.1    3e-07   
ref|XP_006402243.1|  hypothetical protein EUTSA_v10012839mg           59.7    4e-07   
ref|XP_010028467.1|  PREDICTED: ferric reduction oxidase 7, chlor...  59.7    4e-07   
gb|ADR70888.1|  ferric reductase oxidase                              59.7    4e-07   
ref|XP_008452185.1|  PREDICTED: ferric reduction oxidase 7, chlor...  58.9    6e-07   
ref|XP_010441063.1|  PREDICTED: ferric reduction oxidase 7, chlor...  58.9    8e-07   
ref|NP_199785.2|  ferric reduction oxidase 7                          58.9    8e-07   
ref|XP_009589290.1|  PREDICTED: ferric reduction oxidase 6-like i...  58.9    8e-07   
gb|EEC77843.1|  hypothetical protein OsI_17084                        58.5    9e-07   
ref|XP_002980762.1|  hypothetical protein SELMODRAFT_113141           58.5    9e-07   
ref|XP_002865755.1|  ATFRO7/FRO7                                      58.5    1e-06   
ref|XP_011026718.1|  PREDICTED: ferric reduction oxidase 6-like       58.5    1e-06   
ref|XP_003546231.1|  PREDICTED: ferric reduction oxidase 7, chlor...  58.2    1e-06   
ref|XP_002981744.1|  hypothetical protein SELMODRAFT_10830            58.2    1e-06   
gb|KHN14381.1|  Ferric reduction oxidase 7, chloroplastic             58.2    1e-06   
ref|XP_006368817.1|  hypothetical protein POPTR_0001s11860g           57.8    2e-06   
ref|XP_002299406.2|  ferric reductase-like transmembrane componen...  57.8    2e-06   
ref|XP_010482265.1|  PREDICTED: ferric reduction oxidase 7, chlor...  57.8    2e-06   
ref|XP_010441037.1|  PREDICTED: ferric reduction oxidase 7, chlor...  57.8    2e-06   
dbj|BAK01705.1|  predicted protein                                    57.4    2e-06   
emb|CDX88061.1|  BnaA06g26520D                                        57.4    2e-06   
ref|XP_010482264.1|  PREDICTED: ferric reduction oxidase 7, chlor...  57.4    2e-06   
ref|XP_009383442.1|  PREDICTED: ferric reduction oxidase 7, chlor...  57.4    2e-06   
emb|CDX71600.1|  BnaC09g26410D                                        56.6    4e-06   
ref|XP_010442442.1|  PREDICTED: ferric reduction oxidase 7, chlor...  56.6    4e-06   
dbj|BAJ09028.1|  ferric reductase oxidase                             56.6    4e-06   
gb|KDP32466.1|  hypothetical protein JCGZ_13391                       56.2    5e-06   
dbj|BAA98162.1|  FRO1-like protein; NADPH oxidase-like                55.8    8e-06   
emb|CDY65711.1|  BnaAnng20940D                                        55.8    8e-06   
ref|XP_009118912.1|  PREDICTED: ferric reduction oxidase 7, chlor...  55.8    8e-06   
emb|CAH66739.1|  H0404F02.15                                          55.1    1e-05   
ref|XP_002989049.1|  hypothetical protein SELMODRAFT_159917           55.1    1e-05   
ref|XP_002865754.1|  ATFRO6/FRO6                                      55.1    1e-05   
ref|XP_003535028.1|  PREDICTED: ferric reduction oxidase 7, chlor...  55.1    1e-05   
ref|XP_004230384.1|  PREDICTED: ferric reduction oxidase 6-like       54.7    2e-05   
ref|NP_199784.2|  ferric reduction oxidase 6                          54.7    2e-05   
dbj|BAA98161.1|  FRO2-like protein; NADPH oxidase-like                54.3    2e-05   
ref|XP_009763020.1|  PREDICTED: ferric reduction oxidase 6-like       54.3    3e-05   
ref|XP_002983719.1|  hypothetical protein SELMODRAFT_445683           54.3    3e-05   
ref|XP_001754578.1|  ferric reductase like transmembrane component    53.9    3e-05   
ref|XP_008439293.1|  PREDICTED: ferric reduction oxidase 4-like i...  53.9    3e-05   
ref|XP_008801600.1|  PREDICTED: ferric reduction oxidase 7, chlor...  53.9    3e-05   
ref|XP_003594430.1|  NADPH oxidase                                    53.5    4e-05   
ref|XP_010930349.1|  PREDICTED: ferric reduction oxidase 7, chlor...  53.5    5e-05   
ref|XP_010028465.1|  PREDICTED: ferric reduction oxidase 6-like i...  52.8    7e-05   
ref|XP_008376642.1|  PREDICTED: ferric reduction oxidase 4-like i...  52.8    7e-05   
ref|XP_008351781.1|  PREDICTED: L-type lectin-domain containing r...  52.4    1e-04   
ref|XP_006358487.1|  PREDICTED: ferric reduction oxidase 6-like       52.0    1e-04   
ref|XP_001759875.1|  ferric reductase like transmembrane component    51.6    2e-04   
emb|CAP74553.1|  putative TdLFC71 protein                             50.1    5e-04   
ref|XP_001786093.1|  ferric reductase-like transmembrane component    49.7    9e-04   



>ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum 
tuberosum]
Length=699

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 151/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+S+W+LKPTQ+WT+TWK AE+KASAS    +GL FAVYTFPVIA AIVGFVYL     
Sbjct  18   GWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPVIAIAIVGFVYL---AL  74

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            KQKE ISR+ R  L+ LSNP++V   +GILSG EIL V LF+IFLAWTFY RISNDF+K 
Sbjct  75   KQKEPISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKM  134

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            V  K F L+VWQYR+ RVATR GLL EACLALLLLP+LR M+VFR+LG+QFE SVRYH W
Sbjct  135  VPMKSFTLSVWQYRVFRVATRSGLLAEACLALLLLPILRGMSVFRILGIQFEASVRYHVW  194

Query  636  LGTAMI  653
            LGTAMI
Sbjct  195  LGTAMI  200



>ref|XP_009798365.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=700

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWVSLW+LKPTQ+WT+TWK AE KAS S     GL FAVYTFPVIA AIVGF+YLE K  
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGLNFAVYTFPVIAIAIVGFMYLELK--  76

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
             QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF+K 
Sbjct  77   -QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDFKKM  135

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRYH W
Sbjct  136  IPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRYHIW  195

Query  636  LGTAMI  653
            LGTAMI
Sbjct  196  LGTAMI  201



>ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Solanum 
lycopersicum]
Length=699

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 150/186 (81%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+S+W+LKPTQ+WT+TWK AE+KASAS    +GL FAVYTFPVIA AIVGFVYL  K  
Sbjct  18   GWLSVWLLKPTQLWTKTWKLAEKKASASFLTQSGLNFAVYTFPVIAIAIVGFVYLSLK--  75

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
             QKE ISR+ R  L+ LSNP++V   +GILSG EIL V LF+IFLAWTFY RISNDF+K 
Sbjct  76   -QKEAISRKGRSSLSVLSNPVVVNKYIGILSGFEILAVCLFVIFLAWTFYVRISNDFKKM  134

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            V  K F L+VWQYR+ RVATR GLL EACLALLLLP+LR M+VF++LG+QFE SVRYH W
Sbjct  135  VPMKSFTLSVWQYRVFRVATRSGLLAEACLALLLLPILRGMSVFQILGIQFEASVRYHVW  194

Query  636  LGTAMI  653
            LGT MI
Sbjct  195  LGTTMI  200



>ref|XP_011072176.1| PREDICTED: ferric reduction oxidase 8, mitochondrial, partial 
[Sesamum indicum]
Length=688

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 5/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLW+LKPT+ WTR WK AEEK++ASVFGYNGL F VYTFPVIA AI+GF+YLE K  
Sbjct  19   GWLSLWVLKPTEFWTRKWKKAEEKSTASVFGYNGLDFVVYTFPVIAMAIIGFIYLELK--  76

Query  276  KQKEGISRQERRCLAF--LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
             QKE  +RQ RR   F   S+PL V   +GILSG  IL  SLFIIFL WTFY R+SNDF+
Sbjct  77   -QKEPRTRQRRRSSIFTSFSSPLFVNQYVGILSGAHILASSLFIIFLVWTFYARVSNDFK  135

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
            K    K FKL++WQY++ R+ATR GLL EACLALLLLPVLR M+VFRLLG+QFE SVRYH
Sbjct  136  KMTPVKSFKLSLWQYKLFRMATRCGLLAEACLALLLLPVLRGMSVFRLLGIQFEGSVRYH  195

Query  630  TWLGTAMI  653
            TWLGTAM+
Sbjct  196  TWLGTAMV  203



>ref|XP_009613740.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=700

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWVSLW+LKPTQ+WT++WK AE KAS S     GL FAVYTFPVIA AIVGF+YLE K  
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGLNFAVYTFPVIAIAIVGFMYLELK--  76

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
             QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF+K 
Sbjct  77   -QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDFKKM  135

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRYH W
Sbjct  136  IPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRYHIW  195

Query  636  LGTAMI  653
            LGTAMI
Sbjct  196  LGTAMI  201



>ref|XP_009798366.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana sylvestris]
Length=645

 Score =   228 bits (582),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            GWVSLW+LKPTQ+WT+TWK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGPTGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K   QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRY
Sbjct  136  KKMIPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRY  195

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  196  HIWLGTAMI  204



>ref|XP_009798364.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=703

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 150/189 (79%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            GWVSLW+LKPTQ+WT+TWK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKTWKIAEAKASTSFLTQTGPTGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K   QKE  SR+ R  L+ LSNPL+V   +G+LSG EIL VSLF+IFLAWTFY+RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVSRYIGMLSGFEILAVSLFVIFLAWTFYSRISSDF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRL+G+QFE SVRY
Sbjct  136  KKMIPIKSFALHVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLIGIQFEASVRY  195

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  196  HIWLGTAMI  204



>ref|XP_009613741.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana tomentosiformis]
Length=645

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            GWVSLW+LKPTQ+WT++WK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGPAGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K   QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRY
Sbjct  136  KKMIPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRY  195

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  196  HIWLGTAMI  204



>ref|XP_009613739.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=703

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 149/189 (79%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF---GYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            GWVSLW+LKPTQ+WT++WK AE KAS S     G  GL FAVYTFPVIA AIVGF+YLE 
Sbjct  19   GWVSLWLLKPTQLWTKSWKIAEAKASTSFLTQAGPAGLNFAVYTFPVIAIAIVGFMYLEL  78

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K   QKE  SR+ R  L+ LSNPL+V   +GILSG EIL VSLF+IFLAWTFY RIS+DF
Sbjct  79   K---QKEPTSRKGRSSLSVLSNPLVVNRYIGILSGFEILVVSLFVIFLAWTFYARISSDF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K F L VWQYR+ RVATR GLL EACLALLLLP+LR M++FRLLG+QFE SVRY
Sbjct  136  KKMIPIKSFTLPVWQYRIFRVATRCGLLAEACLALLLLPILRGMSIFRLLGIQFEASVRY  195

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  196  HIWLGTAMI  204



>gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like protein [Gossypium 
arboreum]
Length=727

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +ST W+SLW+LKPT +WTR WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL  
Sbjct  17   ISTAWLSLWLLKPTNLWTRKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLNL  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +   Q+   SRQ R   A  SNPL+  + +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQRN--SRQIRSSTAAFSNPLVTSNLVGILSGVEILSVFLFILFLAWTFYTRISHDF  134

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             K    +  KL +WQ + LRVATRFGLL EACLA LLLP+LR +AVFR+LG+QFE SVRY
Sbjct  135  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLAFLLLPILRELAVFRILGIQFEASVRY  194

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  195  HIWLGTAMI  203



>ref|XP_010037521.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Eucalyptus grandis]
Length=716

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWV+LWILKPT++WT+ WK AEE A  +VFGY GL FAVYTFP+IA AI+G +YL     
Sbjct  23   GWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVYTFPIIALAIIGSLYLNDTAS  82

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                 ISRQ +  L+ LS P+IV S +GI+S +EIL + +F+IFLAWTFY RISNDF K 
Sbjct  83   G---AISRQRKTSLSSLSYPIIVNSLVGIISVVEILAILVFVIFLAWTFYCRISNDFEKL  139

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K  KL++WQ + L+VATRFGLL EACLALLLLP+LR M V RLLG+QFE SVRYHTW
Sbjct  140  TPAKSLKLSIWQLKYLKVATRFGLLAEACLALLLLPILRVMPVLRLLGIQFEASVRYHTW  199

Query  636  LGTAMI  653
            LGT MI
Sbjct  200  LGTGMI  205



>emb|CDP12742.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 160/204 (78%), Gaps = 3/204 (1%)
 Frame = +3

Query  42   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  221
            MAKASLLILK+LL ++ + W+SLW+L+P++ W + W+ AEEKA  +VF YNGL FAVYTF
Sbjct  1    MAKASLLILKVLLTILFSVWLSLWLLQPSRTWEKKWREAEEKAMKTVFNYNGLSFAVYTF  60

Query  222  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  401
            P +A A+VGF+YLE K +  +    R E + ++ LSNP++V   LGIL+G EIL V LF+
Sbjct  61   PFLALAMVGFIYLELKLRTNR---MRPESKLISALSNPIVVNRYLGILTGTEILLVFLFV  117

Query  402  IFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMA  581
             FL WTFY  ISNDF+K + TK  KL++WQY++L+VATR GLL EACLALLLLP+LR MA
Sbjct  118  TFLFWTFYAHISNDFKKMMPTKSLKLSMWQYKVLKVATRCGLLAEACLALLLLPILRGMA  177

Query  582  VFRLLGLQFEVSVRYHTWLGTAMI  653
            +FR+LG+QFEVSVRYH WLGT MI
Sbjct  178  IFRILGVQFEVSVRYHIWLGTTMI  201



>ref|XP_010037520.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Eucalyptus grandis]
 gb|KCW49230.1| hypothetical protein EUGRSUZ_K02803 [Eucalyptus grandis]
Length=717

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWV+LWILKPT++WT+ WK AEE A  +VFGY GL FAVYTFP+IA AI+G +YL     
Sbjct  23   GWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVYTFPIIALAIIGSLYLNDTAS  82

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                  SRQ +  L+ LS P+IV S +GI+S +EIL + +F+IFLAWTFY RISNDF K 
Sbjct  83   GAIS--SRQRKTSLSSLSYPIIVNSLVGIISVVEILAILVFVIFLAWTFYCRISNDFEKL  140

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K  KL++WQ + L+VATRFGLL EACLALLLLP+LR M V RLLG+QFE SVRYHTW
Sbjct  141  TPAKSLKLSIWQLKYLKVATRFGLLAEACLALLLLPILRVMPVLRLLGIQFEASVRYHTW  200

Query  636  LGTAMI  653
            LGT MI
Sbjct  201  LGTGMI  206



>gb|KJB59689.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=726

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +ST W+SLW+LKPT +WT+ WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL+ 
Sbjct  17   ISTAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLKL  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +   Q+   +RQ R   A  SNPL+  S +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQR---NRQIRSSTAAFSNPLVTSSLVGILSGVEILSVFLFILFLAWTFYTRISHDF  133

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             K    +  KL +WQ + LRVATRFGLL EACLALLLLP+LR +AVFR+LG+QFE SVRY
Sbjct  134  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLALLLLPILRELAVFRILGIQFEASVRY  193

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  194  HIWLGTAMI  202



>gb|KJB59688.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=727

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +ST W+SLW+LKPT +WT+ WKAAE  A  +VFGY GL F VYTFPVIA A++G VYL+ 
Sbjct  17   ISTAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVYTFPVIAVAMIGLVYLKL  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +   Q+    RQ R   A  SNPL+  S +GILSG+EIL V LFI+FLAWTFYTRIS+DF
Sbjct  77   QSWGQRN--RRQIRSSTAAFSNPLVTSSLVGILSGVEILSVFLFILFLAWTFYTRISHDF  134

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             K    +  KL +WQ + LRVATRFGLL EACLALLLLP+LR +AVFR+LG+QFE SVRY
Sbjct  135  TKLTPMESLKLDLWQLKFLRVATRFGLLAEACLALLLLPILRELAVFRILGIQFEASVRY  194

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  195  HIWLGTAMI  203



>ref|XP_011464152.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=703

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = +3

Query  93   TGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
              WVSLW++KPTQ WTR WKAAE+ A  ++FGY GL FAVY FP+ A AI+G +YL  K 
Sbjct  19   AAWVSLWLIKPTQFWTREWKAAEDLARPTLFGYYGLNFAVYIFPLFALAILGSIYLNLKP  78

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
               +E I R+ RR  A  SNPL+V S LGILS IEI+ V LF++FLAWTFY RIS+DF+K
Sbjct  79   ---REPIRRKGRRVFAGFSNPLVVNSLLGILSSIEIVAVFLFMLFLAWTFYVRISSDFKK  135

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                K  KL +WQ + LRVATRFGLL EACLA LLLPVLR +AVFR+LG+QFE S+RYH 
Sbjct  136  LKPDKALKLNLWQLKYLRVATRFGLLAEACLAFLLLPVLRGLAVFRILGIQFEASIRYHI  195

Query  633  WLGTAMI  653
            WLGT M+
Sbjct  196  WLGTTML  202



>ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
 gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
Length=720

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +STGW+SLW+LKPT  WTR WK AE  A  +VFGY GL FAVYTFPVIA A++G VYL  
Sbjct  17   ISTGWISLWLLKPTNFWTRKWKGAEASAQDTVFGYYGLDFAVYTFPVIALAMIGLVYLNL  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +  + +   SRQ R   A  SNPL++   +GILS +EIL V LF +FLAWTFY RIS DF
Sbjct  77   QPWEHR---SRQVRSSAAAFSNPLVISKLIGILSSVEILAVFLFTLFLAWTFYKRISQDF  133

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K    +  KL +WQ + LRVATRFGLL EACL LLLLP+LR +AVFR+LG++FE SVRY
Sbjct  134  KKLTPVESLKLDLWQLKYLRVATRFGLLAEACLTLLLLPILRGLAVFRILGIRFEASVRY  193

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  194  HIWLGTAMI  202



>ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
 gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
Length=687

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 137/186 (74%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             WVSLW+LKPTQ+WTR WKAAE+KA A+VFGY GL FAVYTFP IA AI+G  YL  K  
Sbjct  20   AWVSLWLLKPTQLWTRKWKAAEDKARATVFGYYGLNFAVYTFPPIALAIIGSFYLNLKP-  78

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +E I R+ R+  A  SNPL+V + LG+ S +EIL V LFI+FLAW FY RISNDF+  
Sbjct  79   --RESIRRKGRKLTAGFSNPLVVNTLLGVFSTLEILAVFLFILFLAWNFYARISNDFKNL  136

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ + L+VATRFGLL E CLA LL P+LR +A+FRLLG+QFE SVRYH W
Sbjct  137  KAAKSL---IWQLKYLKVATRFGLLAEVCLAFLLFPILRGLALFRLLGIQFEASVRYHIW  193

Query  636  LGTAMI  653
            LGTAMI
Sbjct  194  LGTAMI  199



>gb|KDO69496.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=672

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  193  HIWLGTAMI  201



>ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
 gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
Length=713

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  193  HIWLGTAMI  201



>gb|KDO69497.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=713

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GFVYL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFVYLHL  75

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLDTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  193  HIWLGTAMI  201



>ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus 
sinensis]
Length=713

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +   W++LWILKPT +WT+ W  AE++A  ++FGY GL FAV TFPVIA AI+GF+YL  
Sbjct  16   ICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGYYGLNFAVSTFPVIALAIIGFIYLHL  75

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
              +K +    RQ R     LSNPL+V S +GILS  EIL V LF+IFL WT+Y RISNDF
Sbjct  76   LPRKPR---IRQARSSATALSNPLVVNSIVGILSSFEILLVFLFVIFLVWTYYARISNDF  132

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +++FRLLG+QFE SVRY
Sbjct  133  KKLMPVKSLKLNTWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRLLGIQFEASVRY  192

Query  627  HTWLGTAMI  653
            H WLGTAMI
Sbjct  193  HIWLGTAMI  201



>ref|XP_011046222.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Populus 
euphratica]
Length=722

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+++WI KPT +WTR WK AE+ +  +VFGY GL FAVYTFP+I+  I+G VYL    +
Sbjct  20   GWITVWIQKPTNMWTRKWKGAEDSSRYTVFGYYGLNFAVYTFPLISLTIIGLVYLNLVSR  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            +     SR  R      SNP++V S LGILS IEIL V LF++FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATIGFSNPVLVNSFLGILSSIEILAVFLFVLFLAWTYYARISNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR MA+F++LG+QFE SVRYH W
Sbjct  138  MPIKSLKLDLWQLKYLRVATRFGLLAEACLALLLLPILRGMALFQILGIQFEASVRYHIW  197

Query  636  LGTAMI  653
            LGT+MI
Sbjct  198  LGTSMI  203



>gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta]
Length=722

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWVSLW+LKPT +WTR WK  E+ A  ++FGY GL FAVYTFPVI+ AI+G VYL     
Sbjct  20   GWVSLWLLKPTNLWTRKWKGVEDSARPTIFGYYGLDFAVYTFPVISLAIIGLVYLNLL--  77

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              KE + R+        SNP+IV S +GILSGIEIL V LFI+ L WT+YTRISNDF+K 
Sbjct  78   -SKETLRRKASSSTTGFSNPVIVNSFIGILSGIEILWVFLFILLLGWTYYTRISNDFKKL  136

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR +A+F+LLG+QFE SV+YH W
Sbjct  137  MPIKLLKLNLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQLLGIQFEASVKYHIW  196

Query  636  LGTAMI  653
            LGT+MI
Sbjct  197  LGTSMI  202



>ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cicer 
arietinum]
Length=714

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 140/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  90   STGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            S GW+SLW+LKPTQVWT TWK AE+ A+ ++FGY GL F VYTFPVIA AI+G + L+  
Sbjct  18   SAGWISLWLLKPTQVWTTTWKHAEQSANNTIFGYYGLNFVVYTFPVIAIAIIGLLLLDFS  77

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
              +      R  RR     SN L+V S  GILS +EIL   LF++FLAWTFY RISNDF+
Sbjct  78   SIEIIN--CRSARRSSIVFSNQLVVNSVFGILSSVEILIAFLFMVFLAWTFYARISNDFK  135

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
            K +  K  KL +WQ + LRVATRFGLL EACLALLLLP+LR +++FR+LG+QFE SV+YH
Sbjct  136  KLMPDKSLKLNIWQLKYLRVATRFGLLAEACLALLLLPILRGLSLFRILGIQFEASVKYH  195

Query  630  TWLGTAMI  653
            TW+GTAMI
Sbjct  196  TWVGTAMI  203



>ref|XP_002321628.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEF05755.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=722

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 139/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+++WI KPT +WTR WK AE+ +S +VFGY GL FAVYTFP+I+  I+G VYL    +
Sbjct  20   GWIAVWIQKPTNMWTRKWKGAEDSSSYTVFGYYGLNFAVYTFPLISLTIIGLVYLNLVSR  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            +     SR  R      SNP++V S LGILS IEIL V LF++FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATIGFSNPVLVNSFLGILSSIEILAVFLFVLFLAWTYYARISNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ + LRVATRFGLL EACLALLLLP+LR +A+F++LG+QFE SVRYH W
Sbjct  138  MPIKSLNLDLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQILGIQFEASVRYHIW  197

Query  636  LGTAMI  653
            LGT+MI
Sbjct  198  LGTSMI  203



>emb|CBI14963.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 156/204 (76%), Gaps = 6/204 (3%)
 Frame = +3

Query  42   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  221
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY GL F VYTF
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVYTF  60

Query  222  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  401
            PVIA A +GFVYL+ + ++ +   +R+     + LSNPL+V + LG+LS +EIL VSLF 
Sbjct  61   PVIALAAIGFVYLDLQSRESRRRQARRSA---SVLSNPLVVNNYLGVLSALEILAVSLFF  117

Query  402  IFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMA  581
            ++LAWTFY  ISNDF K V  K  K    Q++ LRVATRFGLL EACLALLLLPVLR MA
Sbjct  118  LYLAWTFYVHISNDFEKMVPAKSLKR---QFKFLRVATRFGLLAEACLALLLLPVLRGMA  174

Query  582  VFRLLGLQFEVSVRYHTWLGTAMI  653
            +FR +G+QFE SVRYH WLGTAMI
Sbjct  175  LFRFVGVQFEASVRYHVWLGTAMI  198



>gb|KDP31036.1| hypothetical protein JCGZ_11412 [Jatropha curcas]
Length=724

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 138/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWVSLW+LKPT +WTR WK AE+ A  ++FGY GL FA YTFP+IA AI+G VYL     
Sbjct  20   GWVSLWLLKPTNLWTRKWKEAEDSARPTIFGYYGLNFAAYTFPIIALAIIGLVYLNFL--  77

Query  276  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
              KE I R++ R      SNP+IV S +GILS  EIL V LFI+FL WT+YTRISND +K
Sbjct  78   -SKELIRRRQARTPTIGFSNPVIVNSFVGILSSKEILTVLLFILFLVWTYYTRISNDLKK  136

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +  K   L +WQ + LRVATRFGLL EACL LLLLP+LR +++F+LLG+QFE SVRYH 
Sbjct  137  LMPIKSLNLNLWQLKYLRVATRFGLLAEACLVLLLLPILRGLSLFQLLGIQFEASVRYHI  196

Query  633  WLGTAMI  653
            WLGT+MI
Sbjct  197  WLGTSMI  203



>ref|XP_008459874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459875.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459876.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459877.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
Length=718

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLW+LKPT +WT+ W  AE  A AS FGY GL F VYTFPVI   I+G VYL  K  
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASPFGYYGLNFVVYTFPVIVLVIIGLVYLNNKPS  84

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +     +       LSNPL+V + LGILSGIE+LG++LF++FLAWTFY RIS DFRK 
Sbjct  85   NPQTFRQTKFSTFSNALSNPLVVNNYLGILSGIELLGIALFLLFLAWTFYARISKDFRKL  144

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  +   L +W+ + LR+ATRFGLL EACL LLLLP+LR +A F+L+G+QFE SV+YH W
Sbjct  145  LPVESLNLKIWELKYLRIATRFGLLAEACLGLLLLPILRGLAPFQLIGIQFEASVKYHVW  204

Query  636  LGTAMI  653
            LGTAM+
Sbjct  205  LGTAMV  210



>gb|KEH31789.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=714

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            +   W+SLWILKPTQVWT+ WK  E+ A+ ++FGY GL FAVYTFP+IA AI+G ++L+ 
Sbjct  17   ICAAWISLWILKPTQVWTKKWKHVEQSANNTIFGYYGLNFAVYTFPIIAIAIIGLLFLDL  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K   Q+    R     + F SNPL+V S +GILS IEIL V LFI+FLAWT+Y RISNDF
Sbjct  77   KAGYQRSRNGRSSSSSIVF-SNPLVVNSVVGILSSIEILVVFLFIVFLAWTYYARISNDF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K +Q K  KL +WQ + LR+ATRFGLL EACLALLLLP+LR +A+FR+ G+QFE SV+Y
Sbjct  136  KKLMQDKSLKLNIWQLKSLRIATRFGLLAEACLALLLLPILRGLAIFRIFGIQFEASVKY  195

Query  627  HTWLGTAMI  653
            HTW+GTAMI
Sbjct  196  HTWIGTAMI  204



>ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis]
Length=726

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 143/187 (76%), Gaps = 4/187 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWV++WILKPT +WTR WK AE+ A ++VFGY GL FAVYTFP+IA AI G VYL     
Sbjct  20   GWVAIWILKPTNLWTRKWKEAEDSARSTVFGYYGLDFAVYTFPIIALAITGLVYLSFL--  77

Query  276  KQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
              KE ++R++ R   + +SNP+IV S +G+LS +EIL V  FI+FLAWT+Y RI+NDF+K
Sbjct  78   -SKEPVTRRQARIPTSGISNPVIVNSFVGVLSTLEILVVLFFILFLAWTYYVRIANDFKK  136

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +  K   L +WQ + LRVATRFGLL EACLALLLLP+LR +A+F+L G+QFE +VRYH 
Sbjct  137  LMPAKSLNLNLWQLKYLRVATRFGLLAEACLALLLLPILRGLALFQLFGIQFEATVRYHV  196

Query  633  WLGTAMI  653
            WLGT+MI
Sbjct  197  WLGTSMI  203



>ref|XP_010248638.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Nelumbo 
nucifera]
Length=720

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             WV LW+LKPT++WT++W  AE+ A  + FGYNGL F+VY+FP+IA AI+GF+Y+  +  
Sbjct  34   SWVCLWLLKPTELWTKSWHKAEDSARNTFFGYNGLDFSVYSFPIIAVAIIGFIYMHLRA-  92

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +E   RQ+R  +  LSNP+IV S LGI+S  E+L  +LF++FL WT Y  IS DF+K 
Sbjct  93   --REPTRRQKRFPITTLSNPVIVHSPLGIISTWELLIAALFVLFLLWTIYVHISKDFKKL  150

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K  KL VWQ + +RV  RFGLL EACLALLL P+LR MA+FRL GLQFE SVRYH W
Sbjct  151  TPPKSLKLEVWQIKFMRVGIRFGLLAEACLALLLFPILRGMALFRLFGLQFEASVRYHVW  210

Query  636  LGTAMI  653
             GTAMI
Sbjct  211  FGTAMI  216



>ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis 
sativus]
Length=716

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLW+LKPT +WT+ W  AE  A AS+FGY GL F VYTFPVI   ++G V+L  K  
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASLFGYYGLNFVVYTFPVIVLVMIGLVHLNNKPS  84

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +    R+       LSNPL+V + LGILSGIE+LGV+LF++FLAWTFY RIS DFRK 
Sbjct  85   SPQT--FRKFSTFSNALSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRKL  142

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  +   L +W+ + LR+ATRFGLL EACL+LLLLP+LR +A F+L+G+QFE SV+YH W
Sbjct  143  LPVESLNLKIWELKYLRIATRFGLLAEACLSLLLLPILRGLAPFQLIGIQFEASVKYHVW  202

Query  636  LGTAMI  653
            LGTAM+
Sbjct  203  LGTAMV  208



>ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis 
sativus]
Length=716

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLW+LKPT +WT+ W  AE  A AS+FGY GL F VYTFPVI   ++G V+L  K  
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASLFGYYGLNFVVYTFPVIVLVMIGLVHLNNKPS  84

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +    R+       LSNPL+V + LGILSGIE+LGV+LF++FLAWTFY RIS DFRK 
Sbjct  85   SPQT--FRKFSTFSNALSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRKL  142

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  +   L +W+ + LR+ATRFGLL EAC +LLLLP+LR +A F+L+G+QFE SV+YH W
Sbjct  143  LPVESLNLKIWELKYLRIATRFGLLAEACFSLLLLPILRGLAPFQLIGIQFEASVKYHVW  202

Query  636  LGTAMI  653
            LGTAM+
Sbjct  203  LGTAMV  208



>ref|XP_010102484.1| Ferric reduction oxidase 8 [Morus notabilis]
 gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis]
Length=711

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLW+LKPTQ+WTR WK  EE+   ++ GY G+ F V+TFPVIA AI+G +Y+  + +
Sbjct  20   GWISLWLLKPTQIWTRKWKEVEERLRPTILGYYGINFVVFTFPVIALAIIGSIYMNLQLR  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            K +    +   +  + +SNP++V + LG  S +EIL +SLF +FLAWTFY RISNDF+  
Sbjct  80   KTRRSYGK---KVFSGISNPVVVNTLLGTFSALEILSISLFALFLAWTFYARISNDFKDL  136

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL  WQ + LRVATRFGLL EACLALLLLP+LR +A FRL G+QFE SVRYH W
Sbjct  137  MPVKSLKLKTWQLKYLRVATRFGLLAEACLALLLLPILRGLAFFRLFGIQFEASVRYHVW  196

Query  636  LGTAMI  653
            LGTAM+
Sbjct  197  LGTAMV  202



>ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera]
Length=725

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 157/223 (70%), Gaps = 22/223 (10%)
 Frame = +3

Query  42   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  221
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY GL F VYTF
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVYTF  60

Query  222  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  401
            PVIA A +GFVYL+ + ++ +   +R+     + LSNPL+V + LG+LS +EIL VSLF 
Sbjct  61   PVIALAAIGFVYLDLQSRESRRRQARRSA---SVLSNPLVVNNYLGVLSALEILAVSLFF  117

Query  402  IFLAWTFYTRISNDFRKTVQTK-------------------DFKLAVWQYRMLRVATRFG  524
            ++LAWTFY  ISNDF K V  K                     KL   Q++ LRVATRFG
Sbjct  118  LYLAWTFYVHISNDFEKMVPAKSLKSYSTISNAGKKMTPAESLKLNTRQFKFLRVATRFG  177

Query  525  llteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            LL EACLALLLLPVLR MA+FR +G+QFE SVRYH WLGTAMI
Sbjct  178  LLAEACLALLLLPVLRGMALFRFVGVQFEASVRYHVWLGTAMI  220



>gb|EYU22175.1| hypothetical protein MIMGU_mgv1a002211mg [Erythranthe guttata]
Length=701

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASAS-VFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+S+W+LKPT+ WT+ WKAAEEKA+AS +F YNGL F VY FP+IA AI+G++YLE K 
Sbjct  16   GWLSIWVLKPTEFWTQKWKAAEEKANASSIFRYNGLDFVVYAFPLIALAIIGYIYLELK-  74

Query  273  QKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
              Q E I+R+ RR  L   S+ + V   LG+LSG +IL  SLFI+FL WTFY R+S DF+
Sbjct  75   --QTERINRRGRRNALTCFSSRIYVNGYLGVLSGAQILASSLFIVFLVWTFYARVSADFK  132

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
            K    K FKL+ WQY+  R+ATR GLL+E CLALLLLPVLR M++FRLL ++FE SV YH
Sbjct  133  KMTPGKTFKLSPWQYKFFRMATRCGLLSEVCLALLLLPVLRGMSIFRLLKIEFEASVMYH  192

Query  630  TWLGTAMI  653
              LG AMI
Sbjct  193  ICLGNAMI  200



>ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine 
max]
 gb|KHN18418.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=711

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GWVSLW+LKPTQ+WTR WK AE+ A+ ++FGY GL FAVY FP+IA AI+G + L+ K  
Sbjct  22   GWVSLWLLKPTQIWTRKWKQAEDSANDTIFGYYGLSFAVYAFPIIAIAIIGLLLLDLKAG  81

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
             Q+   +R       F SNPL+V ++LGILS IEIL   LFI+FLAWT+Y+RI  DF+K 
Sbjct  82   YQRSRSARSTPSKSNFFSNPLVVNTTLGILSSIEILIAFLFIVFLAWTYYSRIYTDFKKL  141

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL  WQ +  R+ATRFGLL EAC+ALLLLP+LR +AVFR+LG+QFE SVRYHTW
Sbjct  142  MPYKSLKLNTWQLKYHRIATRFGLLAEACMALLLLPILRGLAVFRILGIQFEASVRYHTW  201

Query  636  LGTAMI  653
            +GTAMI
Sbjct  202  IGTAMI  207



>ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Malus domestica]
Length=699

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 139/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W+SLW+LKPTQ+WT+ WK AE+ A  +VFGY GL FAVYTFP IA AI+G +YL  K  
Sbjct  20   AWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVYTFPPIALAIIGSLYLNWKP-  78

Query  276  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
              KE I R+ R  +A   SNPL+V + +G+LS +EIL V LF++FLAW FY RISNDF+ 
Sbjct  79   --KEPIRRKGRGLIAAGFSNPLVVNALVGVLSTLEILAVFLFLLFLAWNFYARISNDFKN  136

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
               +K   L  WQ + LRVATRFGLL EACLA LL P+LR +A+FR+LG+QFE S++YHT
Sbjct  137  LKPSKSIVLNSWQLKYLRVATRFGLLAEACLAFLLFPILRGLALFRVLGIQFEASIKYHT  196

Query  633  WLGTAMI  653
            WLGTAM+
Sbjct  197  WLGTAML  203



>ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Malus domestica]
Length=706

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 139/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W+SLW+LKPTQ+WT+ WK AE+ A  +VFGY GL FAVYTFP IA AI+G +YL  K  
Sbjct  20   AWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVYTFPPIALAIIGSLYLNWKP-  78

Query  276  KQKEGISRQERRCLAF-LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
              KE I R+ R  +A   SNPL+V + +G+LS +EIL V LF++FLAW FY RISNDF+ 
Sbjct  79   --KEPIRRKGRGLIAAGFSNPLVVNALVGVLSTLEILAVFLFLLFLAWNFYARISNDFKN  136

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
               +K   L  WQ + LRVATRFGLL EACLA LL P+LR +A+FR+LG+QFE S++YHT
Sbjct  137  LKPSKSIVLNSWQLKYLRVATRFGLLAEACLAFLLFPILRGLALFRVLGIQFEASIKYHT  196

Query  633  WLGTAMI  653
            WLGTAM+
Sbjct  197  WLGTAML  203



>ref|XP_002318065.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEE96285.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=743

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW++LW+LKPT +WTR WK AE+ A  +VFGY GL FAV+TFP IA  I+G VYL+   +
Sbjct  20   GWIALWLLKPTNLWTRKWKGAEDSARHTVFGYYGLNFAVFTFPPIAVTIIGLVYLDLVTK  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            +     SR  R      SNP++V S +GILS +EIL V LF +FLAWT+Y RISNDF+K 
Sbjct  80   EPPR--SRPARSATVGFSNPVVVNSFVGILSSLEILAVFLFFLFLAWTYYARISNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL E CLALLLLPVLR +A+F+L+G+QFE SVRYH  
Sbjct  138  MPVKSLKLDLWQIKYLRVATRFGLLAEVCLALLLLPVLRGLAIFQLIGIQFEASVRYHIL  197

Query  636  LGTAMI  653
            LGT+MI
Sbjct  198  LGTSMI  203



>ref|XP_007155475.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
 gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
Length=709

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             WVSLW LKPTQ+WTR WK  E  A  ++FGY GL FAVYTFP+IA AI+G + L+ K  
Sbjct  22   AWVSLWFLKPTQIWTRKWKQLENSADNTIFGYYGLSFAVYTFPIIAIAIIGLLLLDLKSG  81

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
             Q        +    F S PL+V S++GILS IE+L   LFI+FL WT+Y+RIS DF+K 
Sbjct  82   YQSRSARSPSKS--NFFSKPLVVNSTVGILSIIEVLVAFLFIVFLVWTYYSRISADFKKL  139

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            V  K  KL  WQ +  RVATRFGLL+EACLALLLLP+LR +AVFR+LG+QFE SVRYHTW
Sbjct  140  VPYKSLKLNTWQLKYHRVATRFGLLSEACLALLLLPILRGLAVFRILGIQFEASVRYHTW  199

Query  636  LGTAMI  653
            LGTAMI
Sbjct  200  LGTAMI  205



>ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047811.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
Length=733

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW++LW+LKPT +WT  WK AE+ A  +VFGY GL F V+TFP IA  I+G VYL+   +
Sbjct  29   GWIALWLLKPTDLWTSKWKGAEDSARHAVFGYYGLNFGVFTFPPIALTIIGLVYLDLVTK  88

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            +     SR  R      SNP++V S +GILS +EIL V LF +FLAWT+Y RISNDF+  
Sbjct  89   EPPR--SRPARSATVGFSNPVVVNSFVGILSSLEILAVFLFFLFLAWTYYARISNDFKNL  146

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL E CLALLLLPVLR +A+F+L+G+QFE SVRYH  
Sbjct  147  MPIKSLKLDLWQIKYLRVATRFGLLAEVCLALLLLPVLRGLAIFQLIGIQFEASVRYHIL  206

Query  636  LGTAMI  653
            LGT+MI
Sbjct  207  LGTSMI  212



>ref|XP_009406362.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=709

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W  +WI++PTQ W R+W  AE++A+A+  G  GL   VY  PV+A A +G++ L    +
Sbjct  23   AWACIWIIRPTQSWKRSWHVAEDRANATFLGDYGLTVVVYCLPVLAVATLGYISLHIAAK  82

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
            K      R+ R  +   +NPLIV S +G+LS  E+LGV+LFI+FLAWT+Y+ +S+DF+K 
Sbjct  83   KDDL---RKRRPLMPAFTNPLIVSSPVGVLSAAELLGVALFIVFLAWTYYSNVSSDFKKM  139

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K  KL  WQ +M+ +  R G L+EACL LL LP+LR MAVFR+LG+Q+E SVRYH W
Sbjct  140  TPYKSLKLNRWQLKMMHMGVRIGSLSEACLLLLFLPILRGMAVFRILGVQYEASVRYHIW  199

Query  636  LGTAMI  653
            +G  MI
Sbjct  200  IGNTMI  205



>ref|XP_009114914.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Brassica rapa]
Length=728

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAISVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  MPVKTMNLDLWQLQYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT ++
Sbjct  198  LGTGLV  203



>ref|XP_009114915.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Brassica rapa]
Length=727

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAISVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  MPVKTMNLDLWQLQYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT ++
Sbjct  198  LGTGLV  203



>gb|KFK26648.1| hypothetical protein AALP_AA8G275500 [Arabis alpina]
Length=728

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = +3

Query  93   TGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            TGWVSLWI+KPT +W ++W+ AE+    +  GY GL FAV++FP IA +I+G +YL    
Sbjct  19   TGWVSLWIIKPTTLWIQSWRQAEDTIKHTFIGYYGLNFAVFSFPPIALSIIGLIYLSLLS  78

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
                   +R  R+    +S P ++ S +GI+S  EIL + LF++FLAWTFY+R+SND +K
Sbjct  79   HHHHP--ARGGRKRALSVSRPAVINSVIGIVSCFEILALVLFMLFLAWTFYSRVSNDLKK  136

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +  K   L +WQ +  RVATRFGLL EACLALLL PVLR +++FRLL +QF  +V+YH 
Sbjct  137  LMPVKTMNLDLWQLKYFRVATRFGLLAEACLALLLFPVLRGLSMFRLLNIQFAATVKYHV  196

Query  633  WLGTAMI  653
            WLGT +I
Sbjct  197  WLGTGLI  203



>emb|CDY22585.1| BnaC05g24230D [Brassica napus]
Length=725

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = +3

Query  99   WVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQK  278
            W+SLWI+KPT VW ++W+ AE+    + FGY G+ FAV+TFP IA +I+G +YL    Q 
Sbjct  21   WISLWIIKPTTVWIQSWRQAEDTFQHTFFGYYGVSFAVFTFPPIALSIIGLIYLSLLPQH  80

Query  279  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  458
             +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K +
Sbjct  81   HR--LTRGGRSAAITVSRPAIISSFIGIVSCFEIVAVILFLVFLAWTFYVRVNNDLKKLM  138

Query  459  QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWL  638
              K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH WL
Sbjct  139  PVKTMNFDLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVWL  198

Query  639  GTAMI  653
            GT ++
Sbjct  199  GTGLV  203



>ref|XP_010678862.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=726

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 125/185 (68%), Gaps = 3/185 (2%)
 Frame = +3

Query  99   WVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQK  278
            W+ +W LKPT+ WT+ W+  E+    ++  YNG  F VYTF +I   +VG VYL  + + 
Sbjct  34   WIIIWFLKPTKFWTKKWRIVEDSMQITILKYNGADFVVYTFLIILLVMVGLVYLYLQPRI  93

Query  279  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  458
              +   R+    L    NPLIVKS LG+LSGI++L +SL +  L WTFY RISND++K V
Sbjct  94   LIKRRIRRYITALY---NPLIVKSPLGMLSGIDVLVISLVLTLLVWTFYVRISNDYKKLV  150

Query  459  QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWL  638
              K  KL +WQ + LR++TRFGL+ E CLA LL P+LR ++VFRLLG+QFE SVRYH WL
Sbjct  151  PVKQLKLEIWQLKFLRMSTRFGLMGEICLAFLLFPILRGLSVFRLLGIQFEASVRYHMWL  210

Query  639  GTAMI  653
            GT +I
Sbjct  211  GTMLI  215



>ref|XP_010906716.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Elaeis 
guineensis]
Length=703

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 131/189 (69%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            V + W+ +WIL+PTQ+W ++W  AE+ A+A++ G  GL   V+ FPV+A A +G++YL  
Sbjct  18   VLSAWICIWILRPTQLWKKSWHVAEDLANATILGDYGLNVVVFCFPVLAVATLGYIYLHL  77

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
               K   G  RQ    +   S+PLI+ S +GILSG E+L ++LF++FL WT+Y+ +S DF
Sbjct  78   CVNK---GRLRQRISWMTHFSSPLIISSPVGILSGGELLFIALFVLFLVWTYYSNVSGDF  134

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K    K  +L  WQ +M+R+  R G L+EACLALLLLP+LR MAVFR+ G+QFE SVRY
Sbjct  135  KKMPPYKPLQLNRWQQKMMRMGIRIGSLSEACLALLLLPILRGMAVFRIPGIQFEASVRY  194

Query  627  HTWLGTAMI  653
            H W+G AMI
Sbjct  195  HVWIGNAMI  203



>ref|XP_008777197.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Phoenix 
dactylifera]
Length=707

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 130/189 (69%), Gaps = 3/189 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            V   W+ +WIL+PTQ+W ++W  AE++A+A++ G  GL   V+ FPV+A A +G+ YL  
Sbjct  18   VLAAWICMWILRPTQLWKKSWHVAEDRANATILGDYGLNVVVFCFPVLAVATLGYTYLHL  77

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
               K   G  RQ    +   S+PLI+   +GILSG+E+L  ++F++FL WT+Y+ +S DF
Sbjct  78   CVSK---GRLRQRISLMTNFSSPLIISRPVGILSGLELLFAAVFVLFLVWTYYSNVSGDF  134

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
            +K    K  +L  WQ +M+R+  R G L+EACLALLLLP+LR MAVFR++G+QFE SVRY
Sbjct  135  KKMPPYKPLQLNRWQLKMMRMGVRIGSLSEACLALLLLPILRGMAVFRIVGIQFEASVRY  194

Query  627  HTWLGTAMI  653
            H W+G AMI
Sbjct  195  HMWIGNAMI  203



>gb|KGN46442.1| hypothetical protein Csa_6G093620 [Cucumis sativus]
Length=703

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 127/187 (68%), Gaps = 17/187 (9%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAI-VGFVYLEQKK  272
            GW+SLW+LKPT +WT+ W  AE  A AS+FGY          P I + I + F++  Q K
Sbjct  25   GWISLWLLKPTDLWTKKWHLAENSARASLFGYYD------PTPAIHYIIDMNFMFFRQTK  78

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
                             LSNPL+V + LGILSGIE+LGV+LF++FLAWTFY RIS DFRK
Sbjct  79   FSTFSNA----------LSNPLVVNNYLGILSGIELLGVALFLLFLAWTFYARISKDFRK  128

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +  +   L +W+ + LR+ATRFGLL EACL+LLLLP+LR +A F+L+G+QFE SV+YH 
Sbjct  129  LLPVESLNLKIWELKYLRIATRFGLLAEACLSLLLLPILRGLAPFQLIGIQFEASVKYHV  188

Query  633  WLGTAMI  653
            WLGTAM+
Sbjct  189  WLGTAMV  195



>ref|XP_010533458.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=725

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWIL+PT +WTR W+ AEE    + FGY GL F V +FPV+A +++G +YL    Q
Sbjct  20   GWISLWILRPTNLWTRAWRQAEEAMKHTFFGYYGLNFVVLSFPVVAISMIGLIYLSFPPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R        +SNP+I+   +GI+S  E++ + LF++ LAWTFY RISNDF+K 
Sbjct  80   NLR---NRGNVEPQISVSNPIIISQFIGIVSCFELVALLLFLLLLAWTFYARISNDFKKL  136

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL EACLALLLLPVLR ++VFRL  +QFE SV+YH W
Sbjct  137  MPVKSMKLDLWQLKYLRVATRFGLLAEACLALLLLPVLRGLSVFRLWNIQFEASVKYHIW  196

Query  636  LGTAMI  653
            LGTAMI
Sbjct  197  LGTAMI  202



>ref|XP_010533455.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533456.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533457.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=729

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWIL+PT +WTR W+ AEE    + FGY GL F V +FPV+A +++G +YL    Q
Sbjct  20   GWISLWILRPTNLWTRAWRQAEEAMKHTFFGYYGLNFVVLSFPVVAISMIGLIYLSFPPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R        +SNP+I+   +GI+S  E++ + LF++ LAWTFY RISNDF+K 
Sbjct  80   NLR---NRGNVEPQISVSNPIIISQFIGIVSCFELVALLLFLLLLAWTFYARISNDFKKL  136

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K  KL +WQ + LRVATRFGLL EACLALLLLPVLR ++VFRL  +QFE SV+YH W
Sbjct  137  MPVKSMKLDLWQLKYLRVATRFGLLAEACLALLLLPVLRGLSVFRLWNIQFEASVKYHIW  196

Query  636  LGTAMI  653
            LGTAMI
Sbjct  197  LGTAMI  202



>ref|XP_008238075.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Prunus 
mume]
Length=440

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = +3

Query  132  VWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERR  311
            +WTR WKAAE+KA A++FGY GL  AV+TFP IA AI+   YL  K ++     SR+ R+
Sbjct  45   LWTRKWKAAEDKARATLFGYYGLNLAVHTFPPIALAIIRSFYLNLKPRESIR--SRKGRK  102

Query  312  CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQ  491
              A  SNPL+V + LG+LS +EIL V LFI+FLAW FY  ISNDF+     K   L  WQ
Sbjct  103  LTAGFSNPLVVNTLLGVLSTLEILAVFLFILFLAWNFYAHISNDFKNLKPAKSLMLNSWQ  162

Query  492  YRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
             + L+V TRFGLL E CLA LL P+LR + +FRLLG+QFE SVRYH WLGTAMI
Sbjct  163  LKYLKVETRFGLLAEVCLAFLLFPILRGLGLFRLLGIQFEASVRYHIWLGTAMI  216



>dbj|BAB09387.1| FRO1 and FRO2-like protein [Arabidopsis thaliana]
Length=713

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRGAAITVSRPAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTMNLNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  636  LGTAMI  653
             GT +I
Sbjct  198  FGTGLI  203



>ref|NP_199827.2| ferric reduction oxidase 8 [Arabidopsis thaliana]
 sp|Q8VY13.1|FRO8_ARATH RecName: Full=Ferric reduction oxidase 8, mitochondrial; Short=AtFRO8; 
AltName: Full=Ferric-chelate reductase 8; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL66984.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AAO22815.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AED95905.1| ferric reduction oxidase 8 [Arabidopsis thaliana]
Length=728

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTIWIQSWRQAEDTARHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRGAAITVSRPAIINSFIGIVSCFEILALLLFLLFLAWNFYARVSNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTMNLNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  636  LGTAMI  653
             GT +I
Sbjct  198  FGTGLI  203



>ref|XP_010442496.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=737

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 126/186 (68%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R     +S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_010442495.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=743

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 126/186 (68%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R     +S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40298.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 128/186 (69%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W+ AE+ A  + FGY GL FAV++FP IA +IVG +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWRQAEDTAKHTFFGYYGLNFAVFSFPPIALSIVGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                  +R  R     +S P I+ S +GI+S  EIL + LF++FLAW FY R+SNDF+K 
Sbjct  80   HHHP--TRGGRSAAITVSRPAIINSFIGIVSCFEILALLLFLVFLAWNFYARVSNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
            +  K   L +WQ +  RVATRFGLL EACLALLL PVLR +++FRLL ++F  SV+YH W
Sbjct  138  MPVKTLNLNLWQLKYYRVATRFGLLAEACLALLLFPVLRGLSMFRLLNIEFAASVKYHVW  197

Query  636  LGTAMI  653
             GT +I
Sbjct  198  FGTGLI  203



>ref|XP_010482321.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=726

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R      S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITTSRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_010482319.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=730

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R      S P I+ S +GI+   EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITTSRPAIINSFIGIMPCFEIIALFLFLLFLAWTFYVRVTSDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMNFNLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_008239582.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Prunus 
mume]
Length=630

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +3

Query  189  YNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILS  368
            + GL FAVYTFP IA AI+G  YL  K    +E I R+ R+  A  SNPL+V + +G+LS
Sbjct  30   FAGLNFAVYTFPPIALAIIGSFYLNLKP---RESIRRKGRKLTAGFSNPLLVNTLVGVLS  86

Query  369  GIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteacla  548
             +EIL V LFI+FLAW FY RISNDF+     K   L  WQ + L+VATRFGLL E CLA
Sbjct  87   TLEILAVFLFILFLAWNFYARISNDFKNLKPAKSLMLNSWQLKYLKVATRFGLLAEVCLA  146

Query  549  llllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
             LL P+LR +A+FRLLG+QFE SVRYH WLGTA+I
Sbjct  147  FLLFPILRGLALFRLLGIQFEASVRYHIWLGTALI  181



>ref|XP_006280084.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
 gb|EOA12982.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
Length=682

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W++LWI KPT +WT++W  AE+    + FGY GL FAV++FP IA +I+G VYL    Q
Sbjct  20   SWIALWIFKPTTLWTQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLVYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R++NDF+K 
Sbjct  80   HHRP--TRGGRSASIPVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K+    +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKNMDFNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_006280085.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
 gb|EOA12983.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
Length=723

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 127/186 (68%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W++LWI KPT +WT++W  AE+    + FGY GL FAV++FP IA +I+G VYL    Q
Sbjct  20   SWIALWIFKPTTLWTQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLVYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R++NDF+K 
Sbjct  80   HHRP--TRGGRSASIPVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTNDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K+    +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SV+YH W
Sbjct  138  TPVKNMDFNLWQLKYYRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_010472423.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial-like 
[Camelina sativa]
Length=614

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ LWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWIFLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  R     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R+++DF+K 
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYVRVTSDFKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K     +WQ +  RVATRFGLL EACL+LLL PV R +++FRLL +QF  SV+YH W
Sbjct  138  TPVKTMDFNLWQLKYFRVATRFGLLAEACLSLLLFPVSRGLSMFRLLNIQFAASVKYHVW  197

Query  636  LGTAMI  653
            LGT +I
Sbjct  198  LGTGLI  203



>ref|XP_006402177.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
 gb|ESQ43630.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
Length=727

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W+ AE+    + F Y GL FAV++FP IA +I+G +YL     
Sbjct  20   GWISLWIIKPTTLWIQSWRQAEDIIRHTFFSYYGLSFAVFSFPPIALSIIGLIYLSLLPL  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +   +R  +     +S P I+ S +GI+S  EI+ + LF++FLAWTFY R+SNDF K 
Sbjct  80   YNRS--TRGGKSVDFNVSRPAIINSFIGIVSCFEIIALLLFLLFLAWTFYARVSNDFNKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTW  635
               K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRLL +QF  SVRYH W
Sbjct  138  TPIKTMNLELWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLLNIQFAASVRYHVW  197

Query  636  LGTAMI  653
            LG  +I
Sbjct  198  LGNGLI  203



>emb|CDY12264.1| BnaA09g24640D [Brassica napus]
Length=706

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
             W+SLWI+KPT VW ++W+ AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   SWISLWIIKPTTVWIQSWRQAEDTFKHTFFGYYGLSFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              +  ++R  R     +S P I+ S +GI+S  EI+ V LF++FLAWTFY R++ND +K 
Sbjct  80   HHR--LTRGGRSAAITVSRPAIINSFIGIVSCFEIIAVILFLVFLAWTFYVRVNNDLKKL  137

Query  456  VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGL  602
            +  K   L +WQ +  RVATRFGLL EACL+LLL PVLR +++FRL  L
Sbjct  138  MPVKTINLDLWQLKYFRVATRFGLLAEACLSLLLFPVLRGLSMFRLFSL  186



>ref|XP_007215241.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
 gb|EMJ16440.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
Length=526

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 104/164 (63%), Gaps = 20/164 (12%)
 Frame = +3

Query  129  QVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQER  308
            Q+WTR WKAAE+KA A++FGY GL FAVYTFP IA AI+G  YL  K ++    + R E 
Sbjct  4    QLWTRKWKAAEDKARATLFGYYGLNFAVYTFPPIALAIIGSFYLNLKPRE----LIRSEH  59

Query  309  RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVW  488
                F       KS+L      EIL + LFI FLAW FY  ISNDF+     K  K  +W
Sbjct  60   PSGCF-------KSTL------EILAIFLFIPFLAWNFYACISNDFK---NLKPAKSLIW  103

Query  489  QYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            Q + L VATRFGLL E CLA LL P+LR +A+FRLLG+QF  S+
Sbjct  104  QLKYLNVATRFGLLVEVCLAFLLFPILRGLALFRLLGIQFVASI  147



>ref|XP_010678863.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=646

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +3

Query  324  LSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRML  503
            L NPLIVKS LG+LSGI++L +SL +  L WTFY RISND++K V  K  KL +WQ + L
Sbjct  26   LYNPLIVKSPLGMLSGIDVLVISLVLTLLVWTFYVRISNDYKKLVPVKQLKLEIWQLKFL  85

Query  504  RVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            R++TRFGL+ E CLA LL P+LR ++VFRLLG+QFE SVRYH WLGT +I
Sbjct  86   RMSTRFGLMGEICLAFLLFPILRGLSVFRLLGIQFEASVRYHMWLGTMLI  135



>emb|CAN79355.1| hypothetical protein VITISV_010064 [Vitis vinifera]
Length=497

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 116/223 (52%), Gaps = 77/223 (35%)
 Frame = +3

Query  42   MAKASllilklllilVSTGWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTF  221
            MAKA+LLILKLL+IL+  GW++LWILKPTQ+WT+ W  AE+ A  +VFGY       Y  
Sbjct  1    MAKATLLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGY-------YAL  53

Query  222  PVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFI  401
             ++A ++  F+YL                                               
Sbjct  54   EILAVSLF-FLYL-----------------------------------------------  65

Query  402  IFLAWTFYTRISNDFRKTVQTK-------------------DFKLAVWQYRMLRVATRFG  524
               AWTFY  ISNDF K V  K                     KL   Q++ LRVATRFG
Sbjct  66   ---AWTFYVHISNDFEKMVPAKSLKSYSTISNAGKKMTPAESLKLNTRQFKFLRVATRFG  122

Query  525  llteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            LL EACLALLLLPVLR MA+FR +G+QFE SVRYH WLGTAMI
Sbjct  123  LLAEACLALLLLPVLRGMALFRFVGVQFEASVRYHVWLGTAMI  165



>ref|XP_010255644.1| PREDICTED: uncharacterized protein LOC104596257 [Nelumbo nucifera]
Length=1446

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 115/206 (56%), Gaps = 6/206 (3%)
 Frame = +3

Query  42   MAKASllilklllilVSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYT  218
            M KA    L L ++++S G++ +WI+ PT  + + W  +   KA+++ FG  G    VYT
Sbjct  743  MMKAVRAALMLFILVISLGFLIIWIMMPTSTYKQKWLPSIRAKANSTYFGVQGATLLVYT  802

Query  219  FPVIAFAIVGFVYLE-QKKQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGV  389
            FPV++ A++G  YL   KK    + I R   E   LA    P++VK  LGI++GIE+   
Sbjct  803  FPVLSIAVLGCFYLHLGKKYGDHQYIQRNPAESSRLALWKRPVLVKGPLGIVTGIELAFF  862

Query  390  SLFIIFLAWTFYTRISNDFRK-TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllp  563
            ++FI  L W+F T +   F K T Q  + K   +WQ ++   A R GL+   CLA L  P
Sbjct  863  AMFIALLVWSFSTYLHVSFAKLTPQAAEKKGEHLWQAKLDSAALRLGLVGNVCLAFLFFP  922

Query  564  vlRRMAVFRLLGLQFEVSVRYHTWLG  641
            V R  +V  LLGL  E S++YH WLG
Sbjct  923  VTRGSSVLPLLGLTSESSIKYHIWLG  948


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 96/186 (52%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ LWI+ PT ++   W    + KA+++ FG  G    V+TFP++  A++G VYL   K
Sbjct  43   GWLMLWIVLPTNIYKSQWTPQLKAKANSTYFGGQGTNLLVFTFPIMLIAVLGCVYLHFLK  102

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISND  443
            K       S      L     P +VK  LGI++ +E+   ++FI  + W+   Y  IS  
Sbjct  103  KSDNYYNKSWSASHGLFSWKRPFLVKPPLGIVTAMELAFSAMFIALIIWSLAIYLHISFG  162

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
                 +T +    VWQ +   V+ R G +   CLALL  PV R  ++  LLGL  E S++
Sbjct  163  HLHMHKTGE---KVWQAKFRSVSLRLGYVGNICLALLFFPVTRASSILPLLGLTSESSIK  219

Query  624  YHTWLG  641
            YH WLG
Sbjct  220  YHIWLG  225



>gb|AES62463.2| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=702

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 102/187 (55%), Gaps = 6/187 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+++WIL PT+V+  TW    E K +++ F   G+   ++TFP++    +G +YL   +
Sbjct  19   GWLTVWILLPTKVYKNTWTPKLEIKLNSTYFREQGVNILLFTFPIMFIGALGCIYLHLHR  78

Query  273  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            +K  + +        ++CL FL  P +V  ++GI+S +E++   +F+  L W+ Y  +S 
Sbjct  79   EKTTQKLPSTSTGALKKCLCFLRRPFLVMPTIGIVSAMELIFAIMFVALLIWSLYNYLSI  138

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F      K+ +  VW+ +   V  R G +   C A L  PV R  ++ RL+GL  E S+
Sbjct  139  SFAHLHMHKEGE-KVWEAKFRSVFLRLGYIGNICWAFLFFPVTRGSSILRLVGLTSESSI  197

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  198  KYHIWLG  204



>ref|XP_003592212.1| NADPH oxidase [Medicago truncatula]
Length=700

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 102/187 (55%), Gaps = 6/187 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+++WIL PT+V+  TW    E K +++ F   G+   ++TFP++    +G +YL   +
Sbjct  17   GWLTVWILLPTKVYKNTWTPKLEIKLNSTYFREQGVNILLFTFPIMFIGALGCIYLHLHR  76

Query  273  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            +K  + +        ++CL FL  P +V  ++GI+S +E++   +F+  L W+ Y  +S 
Sbjct  77   EKTTQKLPSTSTGALKKCLCFLRRPFLVMPTIGIVSAMELIFAIMFVALLIWSLYNYLSI  136

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F      K+ +  VW+ +   V  R G +   C A L  PV R  ++ RL+GL  E S+
Sbjct  137  SFAHLHMHKEGE-KVWEAKFRSVFLRLGYIGNICWAFLFFPVTRGSSILRLVGLTSESSI  195

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  196  KYHIWLG  202



>gb|KHN34351.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=442

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 91/153 (59%), Gaps = 25/153 (16%)
 Frame = +3

Query  195  GLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGI  374
            GL FAVYTFP++A AI+G + ++ K   Q+   +R   +   F SNPL+   +       
Sbjct  9    GLSFAVYTFPIVAIAILGLLLMDLKAGYQRSRSARSPSKS-NFFSNPLVHGPT-------  60

Query  375  EILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclall  554
                             TRIS DF+K +  K  KL  WQ +  ++A RFGLL E C+ALL
Sbjct  61   -----------------TRISADFKKLMPYKSLKLNTWQLKYHKIAIRFGLLAEPCMALL  103

Query  555  llpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            LLP+LR +AVFR+LG+QFE SVRY TW+GTAMI
Sbjct  104  LLPILRGLAVFRILGIQFEASVRYPTWVGTAMI  136



>ref|XP_010112949.1| Ferric reduction oxidase 2 [Morus notabilis]
 gb|EXC35108.1| Ferric reduction oxidase 2 [Morus notabilis]
Length=717

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 98/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKA--AEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--  263
            G+V +WI+ PT  + +TW+     +  +++ FG  GL   +YTFPV+ FA++G VY+   
Sbjct  29   GFVFIWIIVPTNTYKQTWQPRIKAKVNNSTYFGSQGLTLLLYTFPVLLFAVLGCVYIHLG  88

Query  264  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +K       +   +    A    P++VK   GI+S IE+    +FI  L W+F T + N 
Sbjct  89   RKLDGHDHNVQSGKNHRFAVWKRPILVKGPQGIVSSIELTFFVMFIALLVWSFSTYLHNS  148

Query  444  FRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F K       K    VW+ ++   A R GL+   CLA L  PV R  +V  L GL  E S
Sbjct  149  FAKITPKSAAKDGEKVWESKLDSAALRLGLIGNICLAFLFFPVARGSSVLPLFGLTSEAS  208

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  209  IKYHIWLG  216



>emb|CDY07230.1| BnaCnng02450D [Brassica napus]
Length=710

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (56%), Gaps = 7/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G+V +WIL PT ++   W      E   ++ FG  GL   +  FP++  A +G +YL  K
Sbjct  37   GYVFIWILMPTLIYRTKWLPVMRTEFGFSTYFGLAGLTLFMLMFPMLLLACLGCLYLHLK  96

Query  270  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            KQK    + R++   R  LA +  P++VK  LGI+S  E++ +++F+  L W F+  + N
Sbjct  97   KQKTNNHLIREKATGRGVLAAMRRPMLVKGPLGIVSATELIFLAMFVALLLWNFFIYLRN  156

Query  441  DFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
             F         KL   +WQ ++  +A R GL+  ACLA L +PV+R  ++  +LGL  E 
Sbjct  157  AFPMITPQSAAKLHQKIWQAKLEAMAIRIGLVGNACLAFLFIPVVRGSSLLPVLGLTSES  216

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  217  SIKYHIWLG  225



>ref|XP_009111537.1| PREDICTED: ferric reduction oxidase 2-like [Brassica rapa]
Length=722

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (56%), Gaps = 7/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G+V +WIL PT ++   W      E   ++ FG  GL   +  FP++  A +G +YL  K
Sbjct  37   GYVFIWILMPTLIYRTKWLPVMRTEFGFSTYFGLAGLTLFMLMFPMLLLACLGCLYLHLK  96

Query  270  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            KQK    + R++   R  LA +  P++VK  LGI+S  E++ +++F+  L W F+  + N
Sbjct  97   KQKTNNHLIREKATGRGVLAAMRRPMLVKGPLGIVSATELIFLAMFVALLLWNFFIYLRN  156

Query  441  DFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
             F         KL   +WQ ++  +A R GL+  ACLA L +PV+R  ++  +LGL  E 
Sbjct  157  AFPMITPQSAAKLHQKIWQAKLEAMAIRIGLVGNACLAFLFIPVVRGSSLLPVLGLTSES  216

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  217  SIKYHIWLG  225



>gb|KHM99348.1| Ferric reduction oxidase 3, mitochondrial [Glycine soja]
Length=590

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 102/189 (54%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  276  KQ---KEGISRQ-ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
                 KE  S   ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N 
Sbjct  92   GNGFGKESCSSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNG  151

Query  444  FRKTVQ--TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  
Sbjct  152  FAKITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESC  211

Query  618  VRYHTWLGT  644
            ++YH WLG 
Sbjct  212  IKYHIWLGN  220



>ref|XP_003552408.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Glycine 
max]
Length=715

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 101/187 (54%), Gaps = 4/187 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  276  KQKEG--ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
                G   S  ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N F 
Sbjct  92   GNGFGKESSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNGFA  151

Query  450  KTVQ--TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  ++
Sbjct  152  KITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESCIK  211

Query  624  YHTWLGT  644
            YH WLG 
Sbjct  212  YHIWLGN  218



>ref|XP_006602816.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Glycine 
max]
 ref|XP_006602817.1| PREDICTED: ferric reduction oxidase 2-like isoform X3 [Glycine 
max]
 ref|XP_006602818.1| PREDICTED: ferric reduction oxidase 2-like isoform X4 [Glycine 
max]
Length=717

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 102/189 (54%), Gaps = 6/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +WI+ PT  + + W+   +  + S+FG  G    VYTFP++  A++G VY+   K+
Sbjct  32   GWIFVWIVTPTNTYQQKWQPRLQAKTNSIFGAQGAMLLVYTFPILFIAVLGCVYVHIAKK  91

Query  276  KQ---KEGISR-QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
                 KE  S   ++R ++     ++V+  LGI+SG E++ + +FI+ L W+F   + N 
Sbjct  92   GNGFGKESCSSYGKKREVSIWKRLVLVRGPLGIVSGTEMVFLLMFIVLLVWSFSIYLHNG  151

Query  444  FRKTVQ--TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F K       +  L VW+ ++   + R  L+   CLA L  PV R  +V  LLGL  E  
Sbjct  152  FAKITHKSAAEHGLKVWEKKLDIASVRLALVGNICLAFLFFPVARGSSVLPLLGLTPESC  211

Query  618  VRYHTWLGT  644
            ++YH WLG 
Sbjct  212  IKYHIWLGN  220



>ref|XP_010556561.1| PREDICTED: ferric reduction oxidase 2 [Tarenaya hassleriana]
Length=720

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 105/186 (56%), Gaps = 4/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PTQ + + W      +  +++ FG  G    ++TFP+I  A +G VYL  K
Sbjct  35   GIIMIWIMVPTQTYRKIWLPTLRAKLGNSTYFGAAGTTLLLFTFPMILMACMGGVYLHLK  94

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K+K  +  +R+ +  +  L  P++VK  LGI+S  E   + +F+  L W+F T + N F 
Sbjct  95   KRKNVDQFNREMKGEMEVLRRPMLVKGPLGIVSVTEFGFLLMFVALLLWSFCTYLYNGFL  154

Query  450  K-TVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
              T Q+  +    VWQ ++  VA RFG++   CLA L LPV R  ++  L+GL  E S++
Sbjct  155  TITPQSAAEDGHQVWQAKLETVALRFGVVGNICLAFLFLPVARGSSLLPLVGLTSESSIK  214

Query  624  YHTWLG  641
            YH WLG
Sbjct  215  YHIWLG  220



>emb|CDY38012.1| BnaCnng08730D [Brassica napus]
Length=303

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 103/188 (55%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPYMRLKFGASTYFGSSGTTLFMYMFPMVVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+     L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKNPHHIVRETNGGVLSALRKPMLVKGPLGIVSATEIMFLAMFVALLLWSFITYLRNNF  156

Query  447  RKTVQTKD---FKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPRSAAAHGESLWQAKLESAALRIGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  215

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  216  IKYHIWLG  223



>ref|XP_011468990.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=719

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 102/188 (54%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V L+++ PT  + + W+     +  S++ FG  G    V+TFP++  A++G VYL   
Sbjct  36   GCVLLYVMMPTNTYKQIWQPRIRAKTNSSTYFGSQGASLLVFTFPIMFIALMGCVYLHLG  95

Query  270  KQKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            K+     IS  + +   L+    P++VK  LGI+SGIE+    +FI  L W+F T ++N 
Sbjct  96   KKMNDYTISCSDGKTKRLSVWKQPMLVKGPLGIVSGIELTFFIMFIALLIWSFSTYLTNG  155

Query  444  FRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F+K       K    VW+ ++   + R GL+   CLALL  PV R  ++  L GL  E S
Sbjct  156  FQKITPQSAAKSHEKVWEVKLESASLRLGLVGNICLALLFFPVARGSSILPLFGLTSEAS  215

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  216  IKYHIWLG  223



>ref|XP_002320814.1| ferric-chelate reductase family protein [Populus trichocarpa]
 gb|EEE99129.1| ferric-chelate reductase family protein [Populus trichocarpa]
Length=702

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 104/191 (54%), Gaps = 5/191 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKA--SASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  266
            G+  +WI++PT+ +   W     K   S++ FG  G  F V++FP++  A+VG VYL  +
Sbjct  18   GYAMVWIMRPTKTFKEIWLPNIRKKLNSSTYFGTQGTGFLVFSFPILFVAVVGCVYLHFR  77

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+ K ++  S  ++  L  L  P++VK  LGI+SG E+  + +F+  L W+F   + N F
Sbjct  78   KRSKDRKLESNGKKNRLVTLKKPMLVKGPLGIVSGTELAFLIMFVALLIWSFSVYLLNGF  137

Query  447  RKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                     K  L  WQ ++   +   GLL   CLALL LPV R  ++  L GL  E S+
Sbjct  138  ATITPQSAAKKGLKEWQAKLASASLSLGLLGNICLALLFLPVARGSSLLPLFGLPSEASI  197

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  198  KYHIWLGHTVL  208



>ref|XP_009367867.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=720

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 100/188 (53%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +W + PT  + +TW+     KA++S F G  G    VYTFP++  A++G VYL   
Sbjct  36   GTLFIWFMMPTNTFKQTWRPQIRRKANSSTFLGSAGANLLVYTFPILFIAVLGCVYLHLG  95

Query  270  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
             Q    K +    R+++R  A    P++VK  LGI+SGIE+   ++F+  L W+F   + 
Sbjct  96   NQLNDRKMERSNDRKKKRS-AVWKQPILVKGPLGIVSGIELAFFAMFVALLIWSFSMYLQ  154

Query  438  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            N F K    +     +W+ ++   A   GL+   CLA L  PV R  +V  L GL  E S
Sbjct  155  NSFAKISAARHPDEQIWKPKLESAALMLGLVGNICLAFLFFPVARGSSVLALFGLTSEGS  214

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  215  IKYHIWLG  222



>ref|XP_004308349.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=718

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 102/187 (55%), Gaps = 5/187 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V L+++ PT  + + W+     +  S++ FG  G    V+TFP++  A++G VYL   
Sbjct  36   GCVLLYVMMPTNTYKQIWQPRIRAKTNSSTYFGSQGASLLVFTFPIMFIALMGCVYLHLG  95

Query  270  KQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+     IS   + + L+    P++VK  LGI+SGIE+    +FI  L W+F T ++N F
Sbjct  96   KKMNDYTISCDGKTKRLSVWKQPMLVKGPLGIVSGIELTFFIMFIALLIWSFSTYLTNGF  155

Query  447  RKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            +K       K    VW+ ++   + R GL+   CLALL  PV R  ++  L GL  E S+
Sbjct  156  QKITPQSAAKSHEKVWEVKLESASLRLGLVGNICLALLFFPVARGSSILPLFGLTSEASI  215

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  216  KYHIWLG  222



>ref|XP_002511897.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF50566.1| ferric-chelate reductase, putative [Ricinus communis]
Length=716

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 94/186 (51%), Gaps = 4/186 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +W++ PT  + R W     K   SV FG  G     ++FPV+  A++G VYL   K
Sbjct  33   GYLMMWVMTPTTTYRRIWLPNIRKNVNSVYFGVQGATILTFSFPVLFIAVLGCVYLHLGK  92

Query  273  QKQKEGI-SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            +       S   +  LA    P++VK  LGI+SGIE+  +++F+  L W+  T + N F 
Sbjct  93   RSGHNNFRSNGRKHPLATWKKPMLVKGPLGIVSGIELAFLTMFVALLTWSLSTYLHNGFA  152

Query  450  KTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
                    K    VW+ ++   A R G++   CL  L  PV R  +V  L GL  E S++
Sbjct  153  TITPHSAAKSGERVWEAKLESSAIRLGVVGNICLTFLFFPVARGSSVLPLFGLTSEGSIK  212

Query  624  YHTWLG  641
            YH WLG
Sbjct  213  YHIWLG  218



>ref|XP_009363039.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 8, mitochondrial, 
partial [Pyrus x bretschneideri]
Length=491

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +3

Query  327  SNPLIVKSSLGILSGIEILGVSLFIIFL--AWTFYTRISNDFRKTVQTKDFKLAVWQYRM  500
            SNP++V + +G+ S +E+L V  FI+ L   W FY RI N F+    +K   L+ WQ + 
Sbjct  1    SNPIVVNTLVGVXSTLEMLAVFFFILVLVLTWNFYARILNGFKNLKPSKSLALSSWQLKY  60

Query  501  LRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            L+VATRF LL E CLA LL P++R +A+F++LG+ FE S++YHTWLGTAM+
Sbjct  61   LKVATRFSLLAEVCLAFLLFPIVRGLALFQVLGIHFEASIKYHTWLGTAML  111



>ref|XP_010669978.1| PREDICTED: ferric reduction oxidase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=722

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 101/188 (54%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +W + PT ++   WK       S++ FG  GL   ++TFPV+  A++G VYL   K
Sbjct  39   GYLFMWFIMPTNMYKTNWKTKLTANLSSTYFGTQGLPLLIFTFPVLFIAVLGSVYLHLGK  98

Query  273  QKQKEGISRQERRC-----LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            +     + R+E +      LA    P++VK  LGI+SGIE+  + +FI FLAW+    + 
Sbjct  99   KCPDYELRRKEEKSSTTRWLATWRRPVLVKGPLGIVSGIELSFLMMFIAFLAWSLTVYLH  158

Query  438  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              + K ++ + +    W Y+      R GL    CL+LL  PV R  ++  LLGL  E S
Sbjct  159  VGYSK-IKVQGYGGGRWLYKWEATVFRLGLTGNICLSLLFYPVTRGSSILPLLGLTSEGS  217

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  218  IKYHIWLG  225



>ref|XP_007051741.1| Ferric reduction oxidase 2, putative [Theobroma cacao]
 gb|EOX95898.1| Ferric reduction oxidase 2, putative [Theobroma cacao]
Length=703

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 101/190 (53%), Gaps = 6/190 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            +  G   +WI+ PT  + + W+A+  ++  ++ FG  G    ++TFPV+  A +G +YL 
Sbjct  17   ICLGICMMWIMLPTNTYRQKWRASITKRVLSTYFGTQGSNILIWTFPVLLVAALGSLYLH  76

Query  264  QKKQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
              K   +  +   ER R LA    PL+VK  LGI+SGIE+  + +FI  L WT  T + N
Sbjct  77   LGKNLNENVLHSNERKRRLALWKRPLLVKGPLGIVSGIELAFLIMFISLLIWTLATYLHN  136

Query  441  DFRKTVQTK---DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
                T+  K    + + VWQ ++  +A     +   CL+ L  PV R  +V  LLGL  E
Sbjct  137  GL-PTITPKVAAKYGVEVWQMKLFDIALWIAFVGNVCLSFLFYPVARGSSVLPLLGLTSE  195

Query  612  VSVRYHTWLG  641
             S++YH WLG
Sbjct  196  GSIKYHIWLG  205



>ref|XP_008803959.1| PREDICTED: ferric reduction oxidase 2-like [Phoenix dactylifera]
Length=704

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 101/183 (55%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE-EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W++ PT  + +TW+     K  ++ FG  G    ++TFP++  A+VG +YL   +
Sbjct  30   GWLMMWVMVPTSTYRKTWRPKLLSKTRSTYFGRQGGSMLIFTFPILFIAVVGCIYL-HLE  88

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK     S   RR L   S P++VK  LGI+S  E+    +F+  L W+F + +S  F K
Sbjct  89   QKIGNTDSGSLRRRLEAWSKPVLVKGPLGIVSATELAFCLMFLALLIWSFSSYLSVGFAK  148

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                K   +  WQ ++  VA R GL+ + C A L  PV+RR ++  L+GL+   S+R H 
Sbjct  149  ---LKAQGVESWQAKLATVALRLGLVGKICCAFLFFPVMRRSSLLPLVGLKSGSSIRRHV  205

Query  633  WLG  641
            WLG
Sbjct  206  WLG  208



>ref|XP_003548660.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Glycine 
max]
Length=714

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 98/188 (52%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ + I+ PT  + +TW  +   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIRIMSPTNTFRQTWLPRYKAKTNNTTYIGSKGAYLLLYTFPILLLATLGCVYLHIG  92

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K+  K  I   ++  +     P+++K  LGI+SG EI  + LFI  LAW F T + N F 
Sbjct  93   KKSSK--ICNAKKCGVTIWKRPVLIKGPLGIVSGTEIAFLFLFIALLAWVFSTSVQNSFA  150

Query  450  KTVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                    KD +  +W+ ++ RVA R G++   CLA +  PV R  +V  LL L  E  +
Sbjct  151  TITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMFFPVARGSSVLPLLDLTSESCI  209

Query  621  RYHTWLGT  644
            +YH WLG 
Sbjct  210  KYHIWLGN  217



>ref|XP_003528842.1| PREDICTED: ferric reduction oxidase 2-like isoform 2 [Glycine 
max]
Length=706

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 99/187 (53%), Gaps = 16/187 (9%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF-  446
            K+K K  I ++          P+++K  LGI+SG E+  + +FI+ L W F T + N F 
Sbjct  93   KKKFKATIWKR----------PVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNSFA  142

Query  447  --RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                 +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E  +
Sbjct  143  TITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSESCI  201

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  202  KYHIWLG  208



>ref|XP_002875038.1| hypothetical protein ARALYDRAFT_912220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51297.1| hypothetical protein ARALYDRAFT_912220 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 105/194 (54%), Gaps = 8/194 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            G + +W L PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GIIFIWALMPTMVYRTKWLNPVMRTEFGTSTYFGAIGLTFFMFMFPMVLMACLGCLYLHL  95

Query  267  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KKQK    ++R+   +    A +  P++VK  LGI+S  E++ +++F+  L W F+  + 
Sbjct  96   KKQKNTNHLAREKITDGGVFAAMKRPMLVKGPLGIVSATELILLAMFVALLLWNFFMYMR  155

Query  438  NDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
            N F         K    +WQ R+  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQARLEAMAVRIGLVGNCCLAFLFIPVVRGSSLLPVVGLTSE  215

Query  612  VSVRYHTWLGTAMI  653
             S++YH WLG  ++
Sbjct  216  SSIKYHIWLGHMLM  229



>ref|XP_010426833.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=720

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 105/194 (54%), Gaps = 8/194 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            G++ +WI+ PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GFIFIWIVMPTMVYRTQWLNPVMRTEFGTSTFFGAIGLTFFMFMFPMVLLACLGCLYLHL  95

Query  267  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KK K    + R+   E   LA +  P++VK  LGI+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNHLVREKITEGGVLAAMKRPMLVKGPLGIVSATELILFAMFVALLLWEFFMYMR  155

Query  438  NDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
            N F         K    +WQ R+  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQARLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  612  VSVRYHTWLGTAMI  653
             S++YH WLG  ++
Sbjct  216  SSIKYHIWLGHMLM  229



>ref|XP_004510756.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=716

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 104/193 (54%), Gaps = 8/193 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + ++I+ PT  + + W    + K +++ FG  G    ++TFPV+    +G VYL   K
Sbjct  31   GLILIFIMMPTNTFKKIWFPQFQAKTNSTYFGAQGSRILMFTFPVLLMGTLGCVYLHIAK  90

Query  273  QKQKEGI---SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
               +  I   + ++   ++   NP+IVK  LGI+SGIEI  + +FI  L W+F T + N+
Sbjct  91   ISNESNIEVYNGKKHEAISIWKNPMIVKGPLGIVSGIEITFLVMFIALLVWSFGTPLYNN  150

Query  444  FRKTVQTK---DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
            F  T+ +K   +    VWQ ++  V  RFGL+   CL  L  PV R  ++  + GL  E 
Sbjct  151  F-ATITSKSAAEDGDKVWQEKLEAVGLRFGLVGNICLTFLFFPVTRGSSLLPIFGLTSEG  209

Query  615  SVRYHTWLGTAMI  653
             ++YH WLG  ++
Sbjct  210  CIKYHIWLGHVLM  222



>ref|XP_009118816.1| PREDICTED: ferric reduction oxidase 2 [Brassica rapa]
Length=725

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 102/188 (54%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEK--ASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W         +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPYMRLKFGASTYFGSSGTTLFMYMFPMVVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+     L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKNPHHIVRETNGGVLSALRKPMLVKGPLGIVSATEIMFLAMFVALLLWSFITYLRNNF  156

Query  447  RKTVQTKD---FKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPRSAAAHGESLWQAKLESAALRIGLIGNMCLAFLFLPVARGSSLLPAVGLTSESS  215

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  216  IKYHIWLG  223



>gb|KFK42543.1| hypothetical protein AALP_AA1G008100 [Arabis alpina]
Length=659

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 67/188 (36%), Positives = 103/188 (55%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG  G    ++ FP+IA A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPLMRIKFGASTYFGATGTTLFMFMFPMIALACLGCVYLHFK  96

Query  270  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K      R+ +   L+ L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+F
Sbjct  97   KRKSMHHNDRETKGGVLSALRRPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYLRNNF  156

Query  447  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  K       ++WQ ++   A R GL+   CLA L LPV R  ++   LGL  E S
Sbjct  157  -ATITPKTAAAHGESLWQAKLASAALRIGLMGNICLAFLFLPVARGSSLLPALGLTSESS  215

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  216  IKYHIWLG  223



>gb|AED02590.1| ferric reductase [Lotus japonicus]
Length=706

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 94/185 (51%), Gaps = 10/185 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+  WI+ PT  + + W+   + K S++ FG  G     +TFPV+  A++G VYL   K
Sbjct  32   GWILQWIVIPTNTYRQIWRPQIQAKTSSTYFGAQGPVILTFTFPVLFIAVLGCVYLHTAK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +      +   +R       P++VK  LGI+S  E+  + +FI  L W+F T + N F K
Sbjct  92   KSSNGPEATIWKR-------PVLVKGPLGIVSSTELAFLLMFIALLVWSFATYLHNGFAK  144

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              Q         VW+ ++   A R GL+   CLA L  PV R   V  LLGL  E  ++Y
Sbjct  145  ITQKSAAADGEKVWEEKLETAALRLGLIGNICLAFLYFPVARGSTVLPLLGLTSESCIKY  204

Query  627  HTWLG  641
            H WLG
Sbjct  205  HIWLG  209



>gb|AED02589.1| ferric reductase [Lotus japonicus]
Length=702

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 94/185 (51%), Gaps = 10/185 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+  WI+ PT  + + W+   + K S++ FG  G     +TFPV+  A++G VYL   K
Sbjct  32   GWILQWIVIPTNTYRQIWRPQIQAKTSSTYFGAQGPVILTFTFPVLFIAVLGCVYLHTAK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +      +   +R       P++VK  LGI+S  E+  + +FI  L W+F T + N F K
Sbjct  92   KSSNGPEATIWKR-------PVLVKGPLGIVSSTELAFLLMFIALLVWSFATYLHNGFAK  144

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              Q         VW+ ++   A R GL+   CLA L  PV R   V  LLGL  E  ++Y
Sbjct  145  ITQKSAAADGEKVWEEKLEXAALRLGLIGNICLAFLYFPVARGSTVLPLLGLTSESCIKY  204

Query  627  HTWLG  641
            H WLG
Sbjct  205  HIWLG  209



>ref|XP_006598945.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Glycine 
max]
Length=718

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 98/190 (52%), Gaps = 8/190 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  266
            GW+ + I+ PT  + +TW  +   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIRIMSPTNTFRQTWLPRYKAKTNNTTYIGSKGAYLLLYTFPILLLATLGCVYLHIG  92

Query  267  KKQKQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            KK       S   ++C +     P+++K  LGI+SG EI  + LFI  LAW F T + N 
Sbjct  93   KKVIHSNTESCNAKKCGVTIWKRPVLIKGPLGIVSGTEIAFLFLFIALLAWVFSTSVQNS  152

Query  444  FRKTVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
            F         KD +  +W+ ++ RVA R G++   CLA +  PV R  +V  LL L  E 
Sbjct  153  FATITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMFFPVARGSSVLPLLDLTSES  211

Query  615  SVRYHTWLGT  644
             ++YH WLG 
Sbjct  212  CIKYHIWLGN  221



>ref|XP_006287152.1| hypothetical protein CARUB_v10000325mg [Capsella rubella]
 gb|EOA20050.1| hypothetical protein CARUB_v10000325mg [Capsella rubella]
Length=720

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 104/189 (55%), Gaps = 7/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +W++ PT V+   W      E ++++ FG  GL F ++ FP++  A +G +YL  K
Sbjct  36   GVLFIWVVMPTMVYRTKWLPVMRTEFSTSTYFGAIGLTFFMFMFPMVLLACLGCLYLHLK  95

Query  270  KQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K K    + R+   E   LA +  P++VK  LGI+S  E++  ++F++ L W F+  + N
Sbjct  96   KPKTTNHLVREKMTEGGVLAAMRRPMLVKGPLGIVSATELVLFAMFVVLLLWEFFMYMRN  155

Query  441  DFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
             F         K    +WQ R+  +A R GL+   CLA + +PV+R  ++  ++GL  E 
Sbjct  156  AFPTITPQSAAKHHQKLWQARLEAMAIRIGLVGNCCLAFIFIPVVRGSSLLPVIGLTSES  215

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  216  SIKYHIWLG  224



>ref|XP_004510757.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=716

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 103/195 (53%), Gaps = 12/195 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + ++I+ PT  + + W    + K +++ FG  G    ++TFPV+    +G VYL   K
Sbjct  31   GLIFIFIMMPTNTFKKIWIPQFQAKTNSTYFGAQGSRILMFTFPVLLMGTLGCVYLHIAK  90

Query  273  QKQKEGI---SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
               +  I   + ++   ++   NP++VK  LGI+SGIE+  + +FI  L W+F T + N+
Sbjct  91   ISNESNIEVYNGKKHEAISIWKNPMVVKGPLGIVSGIEMTFLVMFIALLVWSFGTPLYNN  150

Query  444  F-----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
            F     +   Q  D    VWQ +++ V +R G +   CLA L  PV R  ++  L GL  
Sbjct  151  FATITSKSAAQDGD---KVWQEKLVVVGSRAGAVGNICLAFLFFPVTRGSSLLPLFGLTS  207

Query  609  EVSVRYHTWLGTAMI  653
            E  ++YH WLG  ++
Sbjct  208  EGCIKYHIWLGHVLM  222



>ref|XP_007139803.1| hypothetical protein PHAVU_008G060100g [Phaseolus vulgaris]
 gb|ESW11797.1| hypothetical protein PHAVU_008G060100g [Phaseolus vulgaris]
Length=710

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 94/185 (51%), Gaps = 3/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QKK  272
            GW+ +WI+ PT  + + WK   +  + S FG  G    VYT P++  A +G VY+   KK
Sbjct  32   GWIFVWIMTPTNTYQQKWKHRLQAKTNSGFGKQGARLLVYTSPILLIAALGCVYIHIAKK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
                   S  ++  ++     + V+  LGI+SG E+   S+FI+ L W+    + N F K
Sbjct  92   GNGSNAESYGKKDEVSIWKRLVFVRGPLGIVSGTELAFFSMFILLLVWSLSIYLHNGFAK  151

Query  453  TVQ--TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
                   +  + VWQ R+     + GL+   CLA L  PV+R  +V  LLGL  E  ++Y
Sbjct  152  ITHKSAAEHGVEVWQKRLASAGVKLGLVGNICLAFLFFPVVRSSSVLPLLGLTPESCIKY  211

Query  627  HTWLG  641
            H WLG
Sbjct  212  HIWLG  216



>ref|XP_002272836.2| PREDICTED: ferric reduction oxidase 4 [Vitis vinifera]
Length=723

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 100/186 (54%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  +K
Sbjct  41   GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  100

Query  273  QKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +K       IS   R  LAF   P++V + LGI+S +E++  ++FI+ L W+    +   
Sbjct  101  KKGNSFSRSISASHR--LAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVS  158

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F      K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  159  FGHLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIK  217

Query  624  YHTWLG  641
            YH WLG
Sbjct  218  YHIWLG  223



>gb|AES62461.2| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=707

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 101/188 (54%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+S+WIL PT+++ + W    + K +++ F   G+    +TFP++    +  +YL   +
Sbjct  24   GWLSVWILLPTKIYKKIWAPMLQNKFNSTYFRGQGINLLFFTFPMMFIGALSCIYLHFHQ  83

Query  273  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            +K  E +  +     +RCL FL  P +V S +GI+S +E++ V +F   L W+    +  
Sbjct  84   EKITEKLPSRSGGALKRCLGFLRRPFLVMSPIGIVSAMELIFVLMFAALLIWSLSNYLHT  143

Query  441  DFRKT-VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
             F    +  +D K  +W+ ++  V+ R   +   CLA L  PV R  ++  L+GL  E S
Sbjct  144  GFDHLRMHKQDEK--IWEAKLRSVSLRLAYIGNICLAFLFFPVTRMSSILPLVGLTSESS  201

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  202  IKYHIWLG  209



>ref|XP_003592210.1| Ferric-chelate reductase [Medicago truncatula]
Length=736

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 101/188 (54%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+S+WIL PT+++ + W    + K +++ F   G+    +TFP++    +  +YL   +
Sbjct  24   GWLSVWILLPTKIYKKIWAPMLQNKFNSTYFRGQGINLLFFTFPMMFIGALSCIYLHFHQ  83

Query  273  QKQKEGISRQE----RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            +K  E +  +     +RCL FL  P +V S +GI+S +E++ V +F   L W+    +  
Sbjct  84   EKITEKLPSRSGGALKRCLGFLRRPFLVMSPIGIVSAMELIFVLMFAALLIWSLSNYLHT  143

Query  441  DFRKT-VQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
             F    +  +D K  +W+ ++  V+ R   +   CLA L  PV R  ++  L+GL  E S
Sbjct  144  GFDHLRMHKQDEK--IWEAKLRSVSLRLAYIGNICLAFLFFPVTRMSSILPLVGLTSESS  201

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  202  IKYHIWLG  209



>gb|ADL59931.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSAYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  435  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  193  SIKYHIWLG  201



>gb|AHW49435.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49436.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49437.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49438.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49439.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49441.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49442.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49443.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49444.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49445.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49446.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49448.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49449.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49451.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49452.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49453.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49454.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49455.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49456.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49457.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49459.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49460.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49461.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49463.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49464.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49465.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  435  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  193  SIKYHIWLG  201



>gb|AHW49458.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  435  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  193  SIKYHIWLG  201



>ref|XP_003528841.1| PREDICTED: ferric reduction oxidase 2-like isoform 1 [Glycine 
max]
Length=718

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 99/189 (52%), Gaps = 8/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  266
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  267  KKQKQKEGISRQERRCLAFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            KK       S   ++  A +   P+++K  LGI+SG E+  + +FI+ L W F T + N 
Sbjct  93   KKVNDSNTESCNAKKFKATIWKRPVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNS  152

Query  444  F---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
            F      +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E 
Sbjct  153  FATITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSES  211

Query  615  SVRYHTWLG  641
             ++YH WLG
Sbjct  212  CIKYHIWLG  220



>gb|KHN26943.1| Ferric reduction oxidase 2 [Glycine soja]
Length=718

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 99/189 (52%), Gaps = 8/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-Q  266
            GW+ +WI+ PT  + + W  +   +  + + FG  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWIMSPTNTFRQAWLPRYKAKTNNTTYFGSKGAYLLLYTFPILLIATLGCVYLHIG  92

Query  267  KKQKQKEGISRQERRCLAFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            KK       S   ++  A +   P+++K  LGI+SG E+  + +FI+ L W F T + N 
Sbjct  93   KKVNDSNTESCNAKKFKATIWKRPVLIKGPLGIVSGTELAFLFMFILLLIWVFATSVHNS  152

Query  444  F---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
            F      +  KD +  +W+ ++  VA R G++   CLA +  PV R   V  LLGL  E 
Sbjct  153  FATITPQLAAKDGE-KMWEEKLDSVALRLGVVGNICLAFMFFPVARGSCVLPLLGLTSES  211

Query  615  SVRYHTWLG  641
             ++YH WLG
Sbjct  212  CIKYHIWLG  220



>ref|XP_009411425.1| PREDICTED: ferric reduction oxidase 2-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE-EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI++PT+ +   W      +  ++ FG  G    +YTFP++  +++G +YL   K
Sbjct  16   GWLMIWIVRPTKTYQNQWSPQLLSETDSTYFGRQGTNILIYTFPILFISVLGCIYLHLVK  75

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT-----RIS  437
            +      S      LA    P++V   LGI+SGIE+    LF++ L W FYT       S
Sbjct  76   RTDNSQ-SGSSTHSLAAWKRPVVVNWPLGIVSGIELTFCVLFLVLLIW-FYTMYLVVNFS  133

Query  438  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            N  +   Q     L +WQ R+     R  LL + C A L  PV+R  ++  L+GL  E S
Sbjct  134  NSHQSHSQDTGEMLKLWQTRLDGAGIRLALLGDLCCAFLFFPVIRGSSLLPLVGLTSESS  193

Query  618  VRYHTWLG  641
            +RYH WLG
Sbjct  194  IRYHVWLG  201



>gb|AHW49440.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49447.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49450.1| ferric reductase [Phaseolus vulgaris]
 gb|AHW49462.1| ferric reductase [Phaseolus vulgaris]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGSANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  435  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  193  SIKYHIWLG  201



>ref|XP_007143462.1| hypothetical protein PHAVU_007G073900g [Phaseolus vulgaris]
 gb|ESW15456.1| hypothetical protein PHAVU_007G073900g [Phaseolus vulgaris]
Length=697

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +WIL PT+V+  TW    E K +++ F   G    ++TFPV+    +G VYL 
Sbjct  14   VFVGWIMVWILLPTKVYKNTWNPKLENKLNSTYFREQGTNLLLFTFPVVFMGALGCVYLH  73

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             + QK +   S+      R L+FL  P +V S +GIL+ +E++   +F   L W+    +
Sbjct  74   LRLQKPENLSSKSGGTANRRLSFLRRPFVVMSPIGILTSMELVFALMFAALLIWSLSNYL  133

Query  435  SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
               F       + +  VWQ ++  V+ R G +   C A L  PV R  ++  L GL  E 
Sbjct  134  HISFGHLHMHMEGE-KVWQAKLRSVSLRAGYIGNICWAFLFFPVTRASSILPLFGLTSES  192

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  193  SIKYHIWLG  201



>emb|CBI22668.3| unnamed protein product [Vitis vinifera]
Length=1178

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 100/186 (54%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  +K
Sbjct  496  GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  555

Query  273  QKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +K       IS   R  LAF   P++V + LGI+S +E++  ++FI+ L W+    +   
Sbjct  556  KKGNSFSRSISASHR--LAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVS  613

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F      K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  614  FGHLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIK  672

Query  624  YHTWLG  641
            YH WLG
Sbjct  673  YHIWLG  678



>gb|KDP28592.1| hypothetical protein JCGZ_14363 [Jatropha curcas]
Length=712

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 98/191 (51%), Gaps = 6/191 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  G+V +WI+ PT  + + W      K +++ FGY G    V+ FP+I  A++G VYL 
Sbjct  27   VLVGYVIMWIMMPTNTYRQIWLPYLRFKFNSTYFGYQGATLLVFFFPIIFVAVLGCVYLH  86

Query  264  QKKQKQKE---GISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
              K++        ++  +  L     P++VK+ LGI+SGIE+  + +FI  L W+  T +
Sbjct  87   LLKKRPININFSSNKGRKHILGAWKKPMLVKAPLGIVSGIELAFLIMFIALLIWSLATYL  146

Query  435  SNDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
             N F         K    VW+ ++   A R GL+   CL  L  PV R  +V  + GL  
Sbjct  147  HNSFATITPQSAAKNGQKVWEMKLENSALRLGLVGNICLTFLFFPVARGSSVLPVFGLTS  206

Query  609  EVSVRYHTWLG  641
            E S++YH WLG
Sbjct  207  EGSIKYHIWLG  217



>emb|CAN74772.1| hypothetical protein VITISV_024875 [Vitis vinifera]
Length=1230

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 97/184 (53%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ +W+L PT+V+ + W      K +++ FG  G    ++TFP++  A VG VYL  QK
Sbjct  548  GWLMVWVLLPTKVYKQQWTPKLNSKLNSTYFGEQGTNLLLFTFPMMLIAAVGCVYLHFQK  607

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K       S      LAF   P++V + LGI+S +E++  ++FI+ L W+    +   F 
Sbjct  608  KNGNSFSRSISASHRLAFWKKPVLVMAPLGIVSAMELVFAAMFIMLLIWSLANYLYVSFG  667

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                 K  +  VW+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  668  HLHMHKQGE-KVWEAKFRSVSLRLGYIGNLCWAFLFFPVTRGSSILPLVGLTSESSIKYH  726

Query  630  TWLG  641
             WLG
Sbjct  727  IWLG  730



>ref|XP_010477584.1| PREDICTED: ferric reduction oxidase 3, mitochondrial-like [Camelina 
sativa]
Length=722

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 101/193 (52%), Gaps = 13/193 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  54   GTMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGVNLLVYMFPMILLAFLGSIYLHLK  113

Query  270  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  425
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVSQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  426  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
               S    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  VTFSTITPQSIPTDGDNL--WQARLKSIAVRLGLTGNICLGFLFYPVARGSSLLTAVGLT  230

Query  606  FEVSVRYHTWLGT  644
             E S++YH WLG 
Sbjct  231  SESSIKYHIWLGN  243



>ref|XP_009119709.1| PREDICTED: ferric reduction oxidase 2 [Brassica rapa]
Length=702

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 104/192 (54%), Gaps = 7/192 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT+ +   W+     +  +++ FG  G    +Y FP+I  A +G VYL  K
Sbjct  14   GTIMLWIMMPTRTYKNKWQPYMRLKFGASTYFGATGTTLFMYMFPMILVACLGCVYLHFK  73

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+ +  + + L  P++VK  LGI+S  EI+ +++F+  L W+F T + N F
Sbjct  74   KRKSPHHIDREIKGGVWSALRKPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYLRNKF  133

Query  447  RKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +        +WQ ++   A R G +   CLA L LPV R  ++   +GL  E S
Sbjct  134  -ATITPQSAAADGQYLWQAKLESAALRIGFIGNICLAFLFLPVARGSSLLPAVGLTSESS  192

Query  618  VRYHTWLGTAMI  653
            ++YH WLG  +I
Sbjct  193  IKYHIWLGHMVI  204



>ref|XP_010456303.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=720

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 103/194 (53%), Gaps = 8/194 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            G + +WI+ PT V+   W       E  +++ FG  GL F ++ FP++    +G +YL  
Sbjct  36   GIIFIWIVMPTMVYRTKWLNPVMRTEFGTSTFFGAIGLTFFMFMFPIVLLVCLGCLYLHL  95

Query  267  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KK K    + R+   E   LA +  P++VK  LGI+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNHLVREKITEGGVLAAMKRPMLVKGPLGIVSATELILFAMFVALLLWEFFMYMR  155

Query  438  NDFRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
            N F         K    +WQ ++  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQAKLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  612  VSVRYHTWLGTAMI  653
             S++YH WLG  ++
Sbjct  216  SSIKYHIWLGHMLM  229



>ref|XP_006418435.1| hypothetical protein EUTSA_v10006930mg [Eutrema salsugineum]
 gb|ESQ36788.1| hypothetical protein EUTSA_v10006930mg [Eutrema salsugineum]
Length=725

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 101/188 (54%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG  G    ++ FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRNKWLPHMRIKFGASTYFGATGTTLFMFMFPMMVVASLGCVYLHFK  96

Query  270  KQKQKEGISRQERR--CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            K+K    I R+ ++    + L  P++VK  LGI+S  EI+ +++F+  L W+F T + N+
Sbjct  97   KRKSLHHIDRETKKGGVWSALRKPMLVKGPLGIVSVTEIMFLAMFVALLLWSFITYVRNN  156

Query  444  FRKTVQTKDFKL--AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F          L  ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  FATITPQSAAALGQSLWQAKLHSAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  216

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  217  IKYHIWLG  224



>gb|ADR70886.1| ferric reductase oxidase [Manihot esculenta]
Length=707

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 95/180 (53%), Gaps = 5/180 (3%)
 Frame = +3

Query  111  WILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKE  287
            W + PT  +   W +    K +++ FG  G    +Y+FP++  A++G VYL   K+  + 
Sbjct  31   WFMMPTNTYRHIWLRHVRNKFNSAYFGLQGATLVLYSFPILLIAVLGCVYLHLGKRSDQN  90

Query  288  GISRQERR--CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQ  461
                  R+   L+   NP+IVK  LGI+SGIE+  + +F+  L W+  T + N F     
Sbjct  91   DFQSDGRKRSKLSKWKNPMIVKGPLGIVSGIELGFLFMFVALLIWSLSTYLHNGFATI--  148

Query  462  TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLG  641
            T +    VW+ ++   + R GL+   CLA+L  PV R  +V  L GL  E S+++H W+G
Sbjct  149  TPEGGEQVWEAKLDNASLRLGLIGNICLAVLFFPVTRGSSVLPLFGLTSESSIKHHIWVG  208



>ref|XP_010472415.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like, partial 
[Camelina sativa]
Length=106

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+SLWI+KPT +W ++W  AE+    + FGY GL FAV++FP IA +I+G +YL    Q
Sbjct  20   GWISLWIIKPTTLWIQSWHQAEDTIKHTFFGYYGLNFAVFSFPPIALSIIGLIYLSLLPQ  79

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGI  362
              +   +R  R     +S P I+ S +GI
Sbjct  80   HHRP--TRGGRSASITISRPAIINSFIGI  106



>ref|XP_009367868.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=717

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 95/186 (51%), Gaps = 6/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +W++ PT  + + W      KAS+S + G  G    VYTFP++  A++G VYL   
Sbjct  36   GTLLIWLMMPTNTYRQIWLPQIRLKASSSTYLGAEGGTILVYTFPILFIAVLGCVYLHLG  95

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K       +++ R   A    P++VK  LGI+SGIE+    +F+  L W+  T + N F+
Sbjct  96   KNSSSSSGTKKNR--FAVWKQPMLVKGPLGIVSGIELAFFVIFVTLLVWSLSTYLHNKFK  153

Query  450  K--TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
               T         VW+ ++   A   GL+   CLA L  PV R  +V  L GL  E S++
Sbjct  154  NITTQSAAKHHEQVWESKLDSAALVLGLVGNICLAFLFFPVARGSSVLALFGLTSEGSIK  213

Query  624  YHTWLG  641
            YH WLG
Sbjct  214  YHIWLG  219



>ref|XP_010661833.1| PREDICTED: ferric reduction oxidase 2 isoform X2 [Vitis vinifera]
Length=714

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 94/187 (50%), Gaps = 8/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  33   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  92

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K    + IS +E R L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  93   KLNDNKSISPKEDR-LTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  151

Query  450  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  152  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  209

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  210  KYHIWLG  216



>gb|ADR70891.1| ferric reductase oxidase [Manihot esculenta]
Length=692

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 97/187 (52%), Gaps = 8/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL----  260
            GW+ +WIL PT+V+  TW    E K +++ F   G    +++FPV+  A  G VYL    
Sbjct  12   GWIVIWILLPTKVYKNTWTPKLESKLNSTYFEGEGNNLLLFSFPVMFIAAFGSVYLHFQK  71

Query  261  EQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            E +K   K  +    R  L+FL  PL+V + LGI++ +EI   ++FI  L W+    +  
Sbjct  72   ELRKPTCKSAVVSSNR--LSFLKRPLLVMAPLGIVTAMEIAFAAMFIALLIWSLANYLYV  129

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F      K  +  +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S+
Sbjct  130  SFGHLHMHKQGE-KIWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSI  188

Query  621  RYHTWLG  641
            +YH W+G
Sbjct  189  KYHIWVG  195



>ref|XP_002975964.1| hypothetical protein SELMODRAFT_51485, partial [Selaginella moellendorffii]
 gb|EFJ22869.1| hypothetical protein SELMODRAFT_51485, partial [Selaginella moellendorffii]
Length=587

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 94/188 (50%), Gaps = 5/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +W+++PT  +++ W++  +  +   +G  G     Y+ PV+  A+VG +YL+  K 
Sbjct  12   GWILMWVMRPTSAYSKFWQSFTKDTTTKAYGVAGSFTLFYSAPVVILAVVGAIYLQLSKD  71

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
                   R   R   F S P +V+  L + S  E+  + LF+  L WT    +S  F K 
Sbjct  72   DSTR--RRDGVRVNPF-SFPAVVRGPLAVASAAELTCLVLFVALLVWTLSEYLSTKFAKI  128

Query  456  VQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                    +L +W+ ++  V T  GL+   CLA L  PV R     RLL + FE +++YH
Sbjct  129  TPAYLHKHQLKLWERKLEMVGTNLGLVGIVCLAFLFFPVARGSVFLRLLNVPFEHAIKYH  188

Query  630  TWLGTAMI  653
             W+G  M+
Sbjct  189  IWIGHIMM  196



>ref|XP_010424035.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=585

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 104/194 (54%), Gaps = 8/194 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA---EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQ  266
            G++ +WI+ PT V+   W       E  +++ FG  GL F ++ FP++  A +G +YL  
Sbjct  36   GFIFIWIVMPTMVYRTEWLNPVMRTEFGTSTFFGAIGLTFFMFMFPMVLLACLGCLYLHL  95

Query  267  KKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KK K    + R+   E   LA +  P++VK  L I+S  E++  ++F+  L W F+  + 
Sbjct  96   KKPKTTNPLVREKITEGGVLAAMRRPMLVKGPLRIVSATELILFAMFVALLLWEFFMYMR  155

Query  438  NDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
            N F         K    +WQ ++  +A R GL+   CLA L +PV+R  ++  ++GL  E
Sbjct  156  NAFPTITPQSAAKHHQKLWQAKLEAMAIRIGLVGNCCLAFLFIPVVRGSSLLPVIGLTSE  215

Query  612  VSVRYHTWLGTAMI  653
             S++YH WLG  ++
Sbjct  216  SSIKYHIWLGHMLM  229



>ref|XP_002968520.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
 gb|EFJ30774.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
Length=667

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 5/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +W+++PT  +++ W++  +  +   +G  G     Y+ PV+  A+VG +YL+  K 
Sbjct  7    GWILMWVMRPTSAYSKFWQSFTKDTTTKAYGVAGSFTLFYSAPVVILAVVGAIYLQLSKD  66

Query  276  KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
               +   R++   +   S P +V+  L + S  E+  + LF+  L WT    +S  F K 
Sbjct  67   ---DSTRRRDGVRVNPFSFPAVVRGPLAVASAAELTCLVLFVALLVWTLSEYLSTKFAKI  123

Query  456  VQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                    +L +W+ ++  V T  GL+   CLA L  PV R     RLL + FE +++YH
Sbjct  124  TPAYLHKHQLKLWERKLEMVGTNLGLVGIVCLAFLFFPVARGSVFLRLLNVPFEHAIKYH  183

Query  630  TWLGTAMI  653
             W+G  M+
Sbjct  184  KWIGHIMM  191



>ref|XP_006490654.1| PREDICTED: ferric reduction oxidase 4-like [Citrus sinensis]
 gb|KDO56763.1| hypothetical protein CISIN_1g005360mg [Citrus sinensis]
Length=700

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 96/184 (52%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W L PT+V+  TW      K +++ F   G    +++FPV+  A++G VYL  +K
Sbjct  18   GWLLVWALIPTKVYKNTWTPKLNNKLNSTYFREQGTNLLLFSFPVMLIALLGCVYLHLQK  77

Query  273  QKQKEGISRQERRCLAFLSN-PLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            +  K    R+ R    F S  P++V + LGI++ IE+    +F+ FL W+    +   F 
Sbjct  78   KPNKLQSKRKMRSPRLFFSQRPVLVMAPLGIVTAIELTIAVMFVAFLIWSLANYLYVSFG  137

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  138  HLHMHKAGE-KVWQAKFRSVSLRLGYIGNTCWAFLFFPVTRGSSILPLVGLTSESSIKYH  196

Query  630  TWLG  641
             WLG
Sbjct  197  IWLG  200



>ref|XP_002892053.1| hypothetical protein ARALYDRAFT_470119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68312.1| hypothetical protein ARALYDRAFT_470119 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 99/189 (52%), Gaps = 9/189 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  38   GTIMLWIMMPTLTYRTKWLPHMRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  97

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
             +K  + I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  98   NRKSSDHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  157

Query  447  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  158  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  215

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  216  SIKYHIWLG  224



>ref|XP_002272804.1| PREDICTED: ferric reduction oxidase 2 [Vitis vinifera]
Length=714

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 94/189 (50%), Gaps = 5/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              +    K+   VW+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  627  HTWLGTAMI  653
            H WLG  ++
Sbjct  210  HIWLGHTVM  218



>emb|CAN76960.1| hypothetical protein VITISV_029500 [Vitis vinifera]
Length=730

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 94/189 (50%), Gaps = 5/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              +    K+   VW+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  627  HTWLGTAMI  653
            H WLG  ++
Sbjct  210  HIWLGHTVM  218



>emb|CBI22669.3| unnamed protein product [Vitis vinifera]
Length=727

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 94/189 (50%), Gaps = 5/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  45   GYIMVWIMMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  104

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +     I    R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  105  KCVDHDIDENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  162

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              +    K+   VW+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  163  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  222

Query  627  HTWLGTAMI  653
            H WLG  ++
Sbjct  223  HIWLGHTVM  231



>ref|XP_003622505.1| Ferric-chelate reductase [Medicago truncatula]
 gb|KEH18829.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=716

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 98/187 (52%), Gaps = 5/187 (3%)
 Frame = +3

Query  108  LWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLEQKKQK  278
            ++I+ PT  +  TW    + K +++ FG  G    +YTFPV+  A +G  F+++ +K  +
Sbjct  36   IFIMMPTYTFKHTWNPQFQAKTNSTYFGAQGTRILIYTFPVLLIATLGCVFLHIAKKSNE  95

Query  279  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  458
                I   ++      + P++VK  LGI+S  EI  + +FI  L W+F   + NDF   +
Sbjct  96   SNMEIGNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLIWSFSIYLHNDFATII  155

Query  459  QTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
               + +    VWQ ++  VA R GL+   CLALL  PV R   V  + GL  E  ++YH 
Sbjct  156  SKSEAENGEKVWQEKIESVALRLGLVGNICLALLFFPVTRGSTVLPIFGLTSEGCIKYHI  215

Query  633  WLGTAMI  653
            WLG  ++
Sbjct  216  WLGHVLM  222



>ref|XP_002275993.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Vitis vinifera]
Length=715

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 92/187 (49%), Gaps = 7/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  33   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  92

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K    + IS  +   L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  93   KLNDNKSISSPKEDRLTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  152

Query  450  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  153  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  210

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  211  KYHIWLG  217



>emb|CAN74771.1| hypothetical protein VITISV_024874 [Vitis vinifera]
Length=730

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 93/185 (50%), Gaps = 5/185 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT   W         K  +  FG  G    VYTFPV+  A +G +YL   K
Sbjct  32   GYIMVWIIMPTNTFWLHWLPDIHAKTDSKYFGQQGANLLVYTFPVLLIATLGCLYLHLGK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +     I+   R   A    P++VK +LGI+S IE+  +S+F + L W+    +   F  
Sbjct  92   KCVDHDIAENSR--WALWKRPVLVKGTLGIVSWIELSFLSMFFVLLVWSVSAYLHGMFAN  149

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              +    K+   VW+ ++   A   GL+   CLA L  PV R  +V RL+GL  E S++Y
Sbjct  150  ITRQSAAKMGVQVWEAKLESAALMLGLVGNICLAFLFFPVTRGSSVLRLIGLTSESSIKY  209

Query  627  HTWLG  641
            H WLG
Sbjct  210  HIWLG  214



>emb|CBI40432.3| unnamed protein product [Vitis vinifera]
Length=693

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 92/187 (49%), Gaps = 7/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G + LW++ PT  +   W      K  ++ FG  G    +YTFPV+  A++G VYL   K
Sbjct  11   GCLVLWVMMPTNTYRGKWLLQLRAKTDSTYFGQQGTTMLIYTFPVLFAAVLGCVYLHLGK  70

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K    + IS  +   L     P +VK  LGI+S  E+L   +FI  L W+F+  + N F+
Sbjct  71   KLNDNKSISSPKEDRLTVWKKPALVKGPLGIVSMTELLFFVMFIALLVWSFWEYLHNGFQ  130

Query  450  ---KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
                T   K  KL  W  ++   A R GL     LA L  PV R  ++  L GL  E S+
Sbjct  131  GIEATAAKKGEKL--WVSKLGAAALRLGLTGNIVLAFLFFPVARGSSILPLFGLTSEGSI  188

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  189  KYHIWLG  195



>ref|XP_010460078.1| PREDICTED: ferric reduction oxidase 3, mitochondrial [Camelina 
sativa]
Length=722

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 101/193 (52%), Gaps = 13/193 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  54   GSMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGVNLLVYMFPMILLAFLGSIYLHLK  113

Query  270  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  425
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVNQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  426  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
               +    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  FTFATITPQSIPTDGDNL--WQARLNAIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  230

Query  606  FEVSVRYHTWLGT  644
             E S++YH WLG 
Sbjct  231  SESSIKYHIWLGN  243



>gb|AAB72168.1| unknown [Arabidopsis thaliana]
Length=693

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (52%), Gaps = 11/192 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  25   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  84

Query  270  KQKQKEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FYT  428
            KQ +    +R +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY 
Sbjct  85   KQTRVNQFNRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFYH  144

Query  429  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
                   +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL  
Sbjct  145  TFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLTS  202

Query  609  EVSVRYHTWLGT  644
            E S +YH WLG 
Sbjct  203  ESSTKYHIWLGN  214



>ref|XP_010270349.1| PREDICTED: probable ferric reduction oxidase 1 [Nelumbo nucifera]
Length=718

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 101/188 (54%), Gaps = 11/188 (6%)
 Frame = +3

Query  111  WILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKE  287
            WI+ PT ++ R W      K +++ FG  G    +YT PV+  A++G VYL  +K+    
Sbjct  36   WIITPTSIYNRVWFPNIRAKTNSTYFGRQGTLILIYTVPVLLLAVLGCVYLHLEKKYGDN  95

Query  288  GISRQERRCL---AFL-SNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISNDF-  446
             I    +  L   AFL + P++V   LGI++  E+   ++FI  L W++  Y ++  D+ 
Sbjct  96   SIGSNGQTKLIRLAFLRARPMLVDGPLGIVTWTELAFFTMFIALLVWSYAVYLQVGLDYI  155

Query  447  -RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
              +  + K  KL  WQ ++   A R G++   CLA L  PV R  +V  LLGL +E S++
Sbjct  156  TSEIAEAKGEKL--WQAQLDCAAVRLGVVGNVCLAFLFFPVTRGSSVLPLLGLTWEASIK  213

Query  624  YHTWLGTA  647
            YH W+G A
Sbjct  214  YHIWVGHA  221



>gb|ABJ16556.1| Fe(III)-chelate reductase [Citrus junos]
Length=700

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 95/184 (52%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W L PT+V+  TW      K +++ F   G    +++FPV+  A++G VYL  +K
Sbjct  18   GWLLVWALIPTKVYKNTWTPKLNNKLNSTYFREQGTNLLLFSFPVMLIALLGCVYLHLQK  77

Query  273  QKQKEGISRQERRCLAFLSN-PLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            +  K    R+ R    F S  P++V + LGI++ IE+    +F+ FL W     +   F 
Sbjct  78   KPNKLQSKRKMRSPRLFFSQRPVLVMAPLGIVTAIELTIAVMFVAFLIWALANYLYVSFG  137

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  138  HLHMHKAGE-KVWQAKFRSVSLRLGYIGNTCWAFLFFPVTRGSSILPLVGLTSESSIKYH  196

Query  630  TWLG  641
             WLG
Sbjct  197  IWLG  200



>gb|AAF81316.1|AC061957_12 Identical to FRO2 protein from Arabidopsis thaliana gb|Y09581 
and contains a ferric reductase like transmembrane component 
PF|01794 [Arabidopsis thaliana]
Length=703

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 98/189 (52%), Gaps = 9/189 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
             +K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  97   NRKSPHHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  156

Query  447  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  157  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  214

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  215  SIKYHIWLG  223



>ref|NP_173715.2| ferric reduction oxidase 3 [Arabidopsis thaliana]
 gb|AEE30322.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=716

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (52%), Gaps = 11/192 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  48   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  107

Query  270  KQKQKEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FYT  428
            KQ +    +R +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY 
Sbjct  108  KQTRVNQFNRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFYH  167

Query  429  RISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
                   +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL  
Sbjct  168  TFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLTS  225

Query  609  EVSVRYHTWLGT  644
            E S +YH WLG 
Sbjct  226  ESSTKYHIWLGN  237



>gb|AAK95654.2|AF405422_1 ferric-chelate reductase [Pisum sativum]
 gb|AAU94356.1| iron reductase [Pisum sativum]
Length=712

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + ++I+ P   + + W    + K +++ FG  G    +YTFP++  A +G VY+   K
Sbjct  32   GLLFIFIMMPVTTFKQKWIPKIQAKTNSTYFGVQGFRILIYTFPLLLIATLGCVYIHIAK  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +  +  I   ++        P++VK  LGI+S  EI  + +FI  L WT  T + NDF  
Sbjct  92   KSNQ--IDNGKKHETTIWKRPMLVKGPLGIVSITEIAFLLMFIALLVWTLATYLHNDFSS  149

Query  453  TVQT--KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
               +  ++    VWQ ++  V  R GL+   CL LL  PV R  +V  + GL  E S++Y
Sbjct  150  IASSPEEEHGPKVWQEKLESVGLRLGLVGNICLVLLFFPVTRGTSVLPMFGLTSEGSIKY  209

Query  627  HTWLGTAMI  653
            H WLG  ++
Sbjct  210  HIWLGHVLM  218



>gb|KDO86264.1| hypothetical protein CISIN_1g005553mg [Citrus sinensis]
Length=691

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LW+L PT  + + W      +    + FG  G    +YTFP++  A+ G +YL   
Sbjct  6    GTLMLWVLMPTNTYRQNWLPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHLG  65

Query  270  KQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
             +     +  +  ++  L     P++VK  LGI+SGIE+    + I  L W+    + N 
Sbjct  66   NKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHNS  125

Query  444  FRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F   T Q+  +  + VWQ ++   A RFGL+   CL LL  PV R  +V  L GL  E S
Sbjct  126  FADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEAS  185

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  186  IKYHIWLG  193



>ref|NP_171664.1| ferric reduction oxidase 2 [Arabidopsis thaliana]
 sp|P92949.2|FRO2_ARATH RecName: Full=Ferric reduction oxidase 2; Short=AtFRO2; AltName: 
Full=Ferric-chelate reductase 2; AltName: Full=Protein FERRIC 
CHELATE REDUCTASE DEFECTIVE 1 [Arabidopsis thaliana]
 emb|CAA70770.1| FRO2 [Arabidopsis thaliana]
 gb|AAP51420.1| ferric-chelate reductase [Arabidopsis thaliana]
 gb|AEE27308.1| ferric reduction oxidase 2 [Arabidopsis thaliana]
Length=725

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 98/189 (52%), Gaps = 9/189 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG  G    +Y FP++  A +G VYL  K
Sbjct  37   GTIMLWIMMPTLTYRTKWLPHLRIKFGTSTYFGATGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
             +K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W F T + N F
Sbjct  97   NRKSPHHIDRETKGGVWSKLRKPMLVKGPLGIVSVTEITFLAMFVALLLWCFITYLRNSF  156

Query  447  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
                 K+    D  L  WQ ++   A R GL+   CLA L LPV R  ++   +GL  E 
Sbjct  157  ATITPKSAAAHDESL--WQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAMGLTSES  214

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  215  SIKYHIWLG  223



>ref|XP_006444982.1| hypothetical protein CICLE_v10019053mg [Citrus clementina]
 ref|XP_006491162.1| PREDICTED: ferric reduction oxidase 2-like [Citrus sinensis]
 gb|ESR58222.1| hypothetical protein CICLE_v10019053mg [Citrus clementina]
Length=718

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LW+L PT  + + W      +    + FG  G    +YTFP++  A+ G +YL   
Sbjct  33   GTLMLWVLMPTNTYRQNWLPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHLG  92

Query  270  KQKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
             +     +  +  ++  L     P++VK  LGI+SGIE+    + I  L W+    + N 
Sbjct  93   NKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHNS  152

Query  444  FRK-TVQTK-DFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F   T Q+  +  + VWQ ++   A RFGL+   CL LL  PV R  +V  L GL  E S
Sbjct  153  FADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEAS  212

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  213  IKYHIWLG  220



>gb|KHN21778.1| Ferric reduction oxidase 4 [Glycine soja]
Length=702

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 97/186 (52%), Gaps = 5/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+++WIL PT+V+  TW    + K +++ F   G    ++TFPV+    +  +YL   +
Sbjct  17   GWLTVWILLPTKVYKNTWTPKLKTKLNSTYFREQGTNLLLFTFPVMLIGALSCIYLHLHE  76

Query  273  QKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +  ++  S+      R L FL  P +V S +GI++ +EI+   +F+  L W+    +   
Sbjct  77   KGTEKLPSKSGGVVNRWLCFLRRPFLVMSPIGIVTSMEIIFALMFVALLIWSLSNYLHTS  136

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F      K+ +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  137  FGHLHMHKEGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSIK  195

Query  624  YHTWLG  641
            YH WLG
Sbjct  196  YHIWLG  201



>ref|XP_011036851.1| PREDICTED: ferric reduction oxidase 2 [Populus euphratica]
Length=702

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 104/192 (54%), Gaps = 6/192 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKA--SASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G+  +WI+ PT+ +   W     K   S++ FG  G  F V++FP++  A+VG VYL  +
Sbjct  18   GYAMVWIMMPTKTFRGKWLPNIRKKLNSSTYFGKQGTGFLVFSFPILFVAVVGCVYLHFR  77

Query  270  KQKQKEGI-SRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+     + S  ++  L  L  P++VK  LGI+S  E+  + +F+  L W+F   + N F
Sbjct  78   KRSNDSKLESNGKKNRLVTLKQPMLVKGPLGIVSATELAFLIMFVALLIWSFSVYLLNGF  137

Query  447  RK-TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
               T Q+   K L  W+ ++   +   GLL   CLALL LPV R  ++  L GL  E S+
Sbjct  138  ATITPQSAAKKGLKEWEAKLATASLSLGLLGNICLALLFLPVARGSSLLPLFGLPSEASI  197

Query  621  RYHTWLG-TAMI  653
            +YH W+G T M+
Sbjct  198  KYHIWIGHTVMV  209



>ref|XP_007143461.1| hypothetical protein PHAVU_007G073800g [Phaseolus vulgaris]
 gb|ESW15455.1| hypothetical protein PHAVU_007G073800g [Phaseolus vulgaris]
Length=717

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 101/194 (52%), Gaps = 11/194 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G+V +WIL+PT  +   W    E K  +  FG  G    +YTFP++  A +  VYL  ++
Sbjct  33   GYVMVWILRPTNFFYLQWFPHIEAKTDSIYFGKQGTIILIYTFPILLIATLTSVYLHLEQ  92

Query  273  QKQKEGISRQERRCLAFLS--NPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            ++       +  R L   S   PL+ K  LGI++  E+    +F++ L WTF++ + + F
Sbjct  93   KRSNHNTESKGGRFLGLASWKRPLLTKGPLGIITMTELSFAIMFVLLLIWTFFSYLHSLF  152

Query  447  ----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
                +   + +D    VW+ ++   +   GL+   CL LL  PV R  ++ R +GL  E 
Sbjct  153  ASAAKDAAKERD---QVWEIKLEYSSLALGLVGNICLVLLFFPVSRGSSILRFIGLTSEG  209

Query  615  SVRYHTWLG-TAMI  653
            S++YH WLG TAM+
Sbjct  210  SIKYHIWLGHTAML  223



>ref|XP_010498794.1| PREDICTED: ferric reduction oxidase 3, mitochondrial-like [Camelina 
sativa]
Length=721

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 100/193 (52%), Gaps = 13/193 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W K+   K   S+ FG  G    VY FP+I  A +G +YL  K
Sbjct  54   GTMVIWIMMPTSTYKKIWLKSMRAKLGESIYFGRPGANLLVYMFPMILLAFLGSIYLHLK  113

Query  270  KQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  425
            KQ    +   G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    FY
Sbjct  114  KQTTVNQLNSGVERKKRNKFGALKKPMLVKG-LGIVTVTEVMFLTMFLALLLWSLANYFY  172

Query  426  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
               +    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  173  FTFATITPQSIPTGGDNL--WQARLNAIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  230

Query  606  FEVSVRYHTWLGT  644
             E S++YH WLG 
Sbjct  231  SESSIKYHIWLGN  243



>gb|KJB41380.1| hypothetical protein B456_007G101800 [Gossypium raimondii]
Length=699

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 96/187 (51%), Gaps = 7/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G   +WI+ PT  + + W+ +  +K  ++ FG       ++TFPV+  A +G +YL   K
Sbjct  20   GICMMWIMAPTNTYLQKWRPSIHKKLVSTYFGTQAPSMLIWTFPVLFVASLGSLYLHLGK  79

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT---RISN  440
               Q    S +++   A    P++VK  LGI+SGIE+  + +FI  L W+  T   R+  
Sbjct  80   NSNQDASQSNEKKHRRALWRKPVLVKGPLGIVSGIELALLIMFIALLVWSLVTYLRRLHT  139

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
               K    +  K  VW+ ++  VA   GL    CLA L  PV R  +V  LLGL  E S+
Sbjct  140  ITPKAAAKEGVK--VWEMKLFDVALWIGLTGNVCLAFLFYPVARGSSVLPLLGLTSEGSI  197

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  198  KYHIWLG  204



>gb|EMT07839.1| Superoxide-generating NADPH oxidase heavy chain subunit C [Aegilops 
tauschii]
Length=639

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 104/207 (50%), Gaps = 26/207 (13%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGL------------C-------FAVYT  218
            GW+ +W + PT+ ++ TW  A + A+ + FG  G             C         VY 
Sbjct  36   GWLMMWAMLPTRTYSSTW--APKLAALTGFGKQGFLLTLHGLSELHRCRFSRGIRMTVYA  93

Query  219  FPVIAFAIVGFVYLEQKKQKQKEGIS--RQERRCLAFLSNPLIVKSSLGILSGIEILGVS  392
            FPV+   +V  VYL  ++QK  +  +  R   R  A    P++V+  LGI++GIE+  + 
Sbjct  94   FPVLFVYVVACVYLHLQQQKGGDPDTQRRTSTRIAAAWRRPVLVRGPLGIVTGIELAILL  153

Query  393  LFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlR  572
            +F+  L W +Y  I+ +F K       KL  WQ  + + A R G +   C ALL LPV R
Sbjct  154  MFMALLVWFYYAYITVEFSKLRVKPGEKL--WQAELEKAAKRLGSVGSLCCALLFLPVAR  211

Query  573  RMAVFRLLGLQFEVSVRYHTWLG-TAM  650
              ++  L+GL  E  ++YH WLG TAM
Sbjct  212  GSSLLPLVGLTSEAGIKYHVWLGNTAM  238



>ref|XP_010474762.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010474763.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Camelina 
sativa]
Length=724

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 102/188 (54%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W+     +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRNKWQPLMRIKFGTSTYFGSSGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERR-CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
             +++   I R+ +   L+ L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   TKRKSYHIDRETKGGVLSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  156

Query  447  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  157  -ATITPQSLAAHGESLWQAKLESAALRLGLVGNICLAFLFLPVARGSSLLPAVGLTSESS  215

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  216  IKYHIWLG  223



>gb|KDP22239.1| hypothetical protein JCGZ_26070 [Jatropha curcas]
Length=630

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 91/184 (49%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ +W++ PT+++   W      K   S F   G    +++FPV+  AI G VYL  QK
Sbjct  12   GWIMIWVMLPTKLYDNKWTPKLTSKLINSKFEVQGTNLLLFSFPVMFIAISGCVYLHLQK  71

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K K          + L+FL  P++V + LGI + +EI    +FI  L W+    +   F 
Sbjct  72   KLKNSSSKRVVTSKRLSFLRRPVLVMAPLGIFTAVEIAFAVMFIALLIWSLANYLYVSFG  131

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                 K  +  VWQ +   V+ R G +   C A L  PV R  +V  L+GL  E S++YH
Sbjct  132  HLHMDKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSVLPLVGLTSESSIKYH  190

Query  630  TWLG  641
             WLG
Sbjct  191  IWLG  194



>ref|XP_008233004.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Prunus mume]
Length=702

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 96/189 (51%), Gaps = 7/189 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G V+L   
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  270  KQKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K+      E  S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N
Sbjct  76   KKLNDYKVESSSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHN  135

Query  441  DFRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
             F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E 
Sbjct  136  SFANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEG  195

Query  615  SVRYHTWLG  641
            S++YH WLG
Sbjct  196  SIKYHIWLG  204



>gb|KJB41381.1| hypothetical protein B456_007G101800 [Gossypium raimondii]
Length=727

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 96/187 (51%), Gaps = 7/187 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G   +WI+ PT  + + W+ +  +K  ++ FG       ++TFPV+  A +G +YL   K
Sbjct  20   GICMMWIMAPTNTYLQKWRPSIHKKLVSTYFGTQAPSMLIWTFPVLFVASLGSLYLHLGK  79

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT---RISN  440
               Q    S +++   A    P++VK  LGI+SGIE+  + +FI  L W+  T   R+  
Sbjct  80   NSNQDASQSNEKKHRRALWRKPVLVKGPLGIVSGIELALLIMFIALLVWSLVTYLRRLHT  139

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
               K    +  K  VW+ ++  VA   GL    CLA L  PV R  +V  LLGL  E S+
Sbjct  140  ITPKAAAKEGVK--VWEMKLFDVALWIGLTGNVCLAFLFYPVARGSSVLPLLGLTSEGSI  197

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  198  KYHIWLG  204



>ref|XP_008233005.1| PREDICTED: ferric reduction oxidase 2 isoform X2 [Prunus mume]
Length=701

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 97/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLE  263
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G  F++L 
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  264  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +K    K   S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N 
Sbjct  76   KKLNDYKVESSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHNS  135

Query  444  FRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E S
Sbjct  136  FANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEGS  195

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  196  IKYHIWLG  203



>emb|CDY38014.1| BnaCnng08750D [Brassica napus]
Length=705

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 99/194 (51%), Gaps = 12/194 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I  A +G +YL  K
Sbjct  26   GTMVIWIMMPTSTYKKIWLTSMRAKLGKTTTFGKPGVNLLVYMFPMILLAFLGCIYLHLK  85

Query  270  KQKQKEG----ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT-----F  422
            K+   +     + R++R     L  PL+VK  LGI++  E++ +++F+  L W+     +
Sbjct  86   KKTSVDQFHSVLERKKRDKFGALRKPLLVKGPLGIVTVTEVMFLTMFMTLLLWSLTNYFY  145

Query  423  YTRIS-NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            YT ++       V     KL  W+ R+  ++ R G+    CLA L  PV R  ++   +G
Sbjct  146  YTFVTITPQSAAVHGDKIKLKRWEARLDSISVRLGVAGNICLAFLFYPVARGSSLLAAVG  205

Query  600  LQFEVSVRYHTWLG  641
            L  E S++YH WLG
Sbjct  206  LTSESSIKYHIWLG  219



>gb|KDP28593.1| hypothetical protein JCGZ_14364 [Jatropha curcas]
Length=723

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 100/197 (51%), Gaps = 15/197 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVW-TRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ LW+L PT+++  + +     K  ++ FG  G+   +Y FP++  A++G VYL   K
Sbjct  31   GYLILWVLMPTKIYRHQLFPRVRNKLDSAFFGIQGIMLLLYFFPILFVAVLGCVYLHLLK  90

Query  273  QK----QKEGISRQ--------ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAW  416
            ++    Q E I            +  +     P+IVK  LGI+SGIE+  + +F   + W
Sbjct  91   KRSSNEQFESIPTHFNKYSGNGRKHAVGAWKKPMIVKDPLGIVSGIELAFLIMFTALVIW  150

Query  417  TFYTRISNDFRK-TVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFR  590
            +F T + N F   T Q+  +    VW+ ++   A R  L    CL  L  PV R  +V  
Sbjct  151  SFATYLRNSFATITPQSAAENGQKVWEAKLESSALRLALAGNMCLTFLFFPVARGSSVLP  210

Query  591  LLGLQFEVSVRYHTWLG  641
            L GL FE S++YH WLG
Sbjct  211  LFGLTFEGSIKYHIWLG  227



>ref|XP_011043855.1| PREDICTED: ferric reduction oxidase 4-like isoform X3 [Populus 
euphratica]
Length=688

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  273  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  624  YHTWLG  641
            YH WLG
Sbjct  194  YHIWLG  199



>ref|XP_007220622.1| hypothetical protein PRUPE_ppa002203mg [Prunus persica]
 gb|EMJ21821.1| hypothetical protein PRUPE_ppa002203mg [Prunus persica]
Length=701

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 97/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVG--FVYLE  263
            G + +W + PT  +++ W+    ++  S++  G  G    ++TFP++  A++G  F++L 
Sbjct  16   GSLFVWFMMPTNTYSQIWRLQIRQKTNSSTYLGSEGSNIVMFTFPILFLALLGCVFLHLG  75

Query  264  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +K    K   S   +   A    P++VK  LGI+SGIE+    +FI  L W+F T + N 
Sbjct  76   KKLNDYKVESSNGTKNRFAVWKKPMLVKGPLGIVSGIELAFFIMFIALLIWSFSTYLHNS  135

Query  444  FRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F         K    +W+ ++   A R GL+   CLA L  PV R  ++  L GL  E S
Sbjct  136  FANITPKSAAKNHEKIWESKLDSAALRLGLVGNICLAFLFFPVARGSSILALFGLTSEGS  195

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  196  IKYHIWLG  203



>ref|XP_011043854.1| PREDICTED: ferric reduction oxidase 4-like isoform X2 [Populus 
euphratica]
Length=696

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  273  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  624  YHTWLG  641
            YH WLG
Sbjct  194  YHIWLG  199



>ref|XP_010060545.1| PREDICTED: ferric reduction oxidase 4-like [Eucalyptus grandis]
Length=709

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 98/186 (53%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+ +   W    + K  ++ F   G+   + TFPV+  A  G VYL  ++
Sbjct  17   GWLMIWIMLPTKTYKNKWTPNLQMKLDSTYFEGQGINLLLLTFPVMFIAAFGCVYLHLQR  76

Query  273  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            + +K   +  S+  R  LAFL  P++V  +LGI++  E+  V++FI  L W+    I   
Sbjct  77   KSEKLYTKSASKTGR--LAFLRRPVLVMPTLGIVTLTELAFVAMFIALLIWSLANYIYIS  134

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            +   +   D  + VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  YSGHLHM-DKGVEVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  624  YHTWLG  641
            YH WLG
Sbjct  194  YHIWLG  199



>ref|XP_011043852.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011043853.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Populus 
euphratica]
Length=703

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 98/186 (53%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  K+
Sbjct  17   GWLVVWIMLPTKLYKNTWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKQ  76

Query  273  QKQ---KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            Q++    + I    R  L+FL  P +V + LGI++ +E+  V++FI  L W+    +   
Sbjct  77   QQRISYSKSIVASNR--LSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLGNYLYVS  134

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F   +     +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  135  FGH-LHIHKLREKVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  193

Query  624  YHTWLG  641
            YH WLG
Sbjct  194  YHIWLG  199



>gb|KJB34152.1| hypothetical protein B456_006G050400 [Gossypium raimondii]
Length=685

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 98/184 (53%), Gaps = 4/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ LW + PT+++   W       + ++ FG  G    +YTFP++  A +G +YL   K
Sbjct  16   GYMMLWFMMPTKLYFEHWLPKIRANSKSTYFGQQGSTMLIYTFPILFIATLGCIYLHLGK  75

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +     +  + R   + L  P++VK  LGI+S +E+  +++F++ LAW+  + ++  F  
Sbjct  76   KHGDHNV--EGRVPTSKLKQPVMVKGPLGIVSWMELSFLTMFVVLLAWSTTSYLNGMFTH  133

Query  453  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
              Q      L VW+ ++       GL+   CLA L  PV R  +V RL+GL  E S++YH
Sbjct  134  IDQMASRSGLLVWEAKLEMSGLTLGLVGNICLAFLFFPVTRGSSVLRLIGLSSEASIKYH  193

Query  630  TWLG  641
             W+G
Sbjct  194  IWVG  197



>ref|XP_006418436.1| hypothetical protein EUTSA_v10006972mg [Eutrema salsugineum]
 gb|ESQ36789.1| hypothetical protein EUTSA_v10006972mg [Eutrema salsugineum]
Length=693

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 101/194 (52%), Gaps = 15/194 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W  +   K   S+ FG  G+   VY FPVI  A +G ++L  K
Sbjct  20   GTIVIWIMMPTSTYKKIWLTSMRAKLGKSIYFGKPGVNLLVYMFPVILLAFLGCIHLHLK  79

Query  270  KQKQKE----GISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT-----  419
            KQ   +    G+ R+++R     L  P++VK  LGI++  E++ +++F+  L W+     
Sbjct  80   KQTSVDHFHSGVERKKKRDKFGALRRPMLVKGPLGIVTVTEVMFLTMFMTLLLWSLTNYF  139

Query  420  FYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            +YT ++   +      D    +WQ R+  +A R GL    CL  L  PV R  ++   +G
Sbjct  140  YYTFVTITPQSAAIHGD---NLWQARLDSIAVRLGLAGNICLGFLFYPVARGSSLLAAIG  196

Query  600  LQFEVSVRYHTWLG  641
            L  E S++YH WLG
Sbjct  197  LTSESSIKYHIWLG  210



>ref|XP_002513661.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF49064.1| ferric-chelate reductase, putative [Ricinus communis]
Length=1368

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 100/188 (53%), Gaps = 10/188 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W+L PT+V+  +W      K +++ FG  G    +++FPV+  A  G V+L   K
Sbjct  17   GWLIVWVLLPTKVYKNSWTPKLNSKLNSTYFGTQGTNLLLFSFPVMFIAAFGCVHLHFHK  76

Query  273  QKQKEGISRQERR--CLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRIS-  437
             K+    S+   +   L+F   P++V + LGI++ +EI   ++FI  + W+   Y  IS 
Sbjct  77   NKRGNSSSKSNVKGNLLSFFRRPVLVMAPLGIVTAMEIAFSAMFIALMIWSLANYLYISF  136

Query  438  NDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
             +    V+ +     VWQ +   V+ R G +   C A L +PV R  ++  L+GL  E S
Sbjct  137  GNLHMHVEGEK----VWQAKFRSVSLRLGYIGNVCWAFLFIPVTRGSSLLHLVGLTSESS  192

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  193  IKYHIWLG  200


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 79/160 (49%), Gaps = 8/160 (5%)
 Frame = +3

Query  165  KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQKQKEGISRQERRCLAFLSNPLIV  344
            K +++ FG  G    V+ FP++  A +  +YL      Q +      +R       P+I+
Sbjct  719  KTNSTFFGKQGANMLVFMFPILFIATLSCLYLHMGNTSQIDYWFASWKR-------PVIM  771

Query  345  KSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-KTVQTKDFKLAVWQYRMLRVATRF  521
            K  LGI+S +E+  + +FI  L W+ ++ +   F     +     L VW+ ++       
Sbjct  772  KGPLGIVSWMEVSFLVMFITLLMWSLFSYLHGMFAFAAPEAAYLGLKVWEAKLQSAGLSL  831

Query  522  GllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLG  641
            GL+   CLA L  PV R  +V RLLGL  E S++YH WLG
Sbjct  832  GLVGNVCLAFLFFPVTRGSSVLRLLGLNSEASIKYHIWLG  871



>gb|KCW90645.1| hypothetical protein EUGRSUZ_A02749 [Eucalyptus grandis]
Length=1185

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 98/186 (53%), Gaps = 7/186 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+ +   W    + K  ++ F   G+   + TFPV+  A  G VYL  ++
Sbjct  493  GWLMIWIMLPTKTYKNKWTPNLQMKLDSTYFEGQGINLLLLTFPVMFIAAFGCVYLHLQR  552

Query  273  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            + +K   +  S+  R  LAFL  P++V  +LGI++  E+  V++FI  L W+    I   
Sbjct  553  KSEKLYTKSASKTGR--LAFLRRPVLVMPTLGIVTLTELAFVAMFIALLIWSLANYIYIS  610

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            +   +   D  + VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  611  YSGHLHM-DKGVEVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIK  669

Query  624  YHTWLG  641
            YH WLG
Sbjct  670  YHIWLG  675



>ref|XP_002893257.1| ATFRO3/FRO3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69516.1| ATFRO3/FRO3 [Arabidopsis lyrata subsp. lyrata]
Length=695

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 97/193 (50%), Gaps = 14/193 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G ++L  K
Sbjct  25   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLAFLGSIHLHLK  84

Query  270  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----F  422
            KQ         G+ R++R     L  P++VK  LGI++  E++ +++F+  L W+    F
Sbjct  85   KQTTVNQFNSGGVERKKRDKFGALKRPMLVKG-LGIVTVTEVMFLTMFMSLLLWSLANYF  143

Query  423  YTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGL  602
            Y        +T+      L  WQ R+  +A R GL    CL  L  PV R  ++   +GL
Sbjct  144  YYTFVTITPQTIPIDGHNL--WQARLDSIAVRLGLTGNICLGFLFYPVSRGSSLLAAVGL  201

Query  603  QFEVSVRYHTWLG  641
              E S RYH WLG
Sbjct  202  TSESSTRYHIWLG  214



>ref|XP_007038788.1| Ferric reduction oxidase 2 [Theobroma cacao]
 gb|EOY23289.1| Ferric reduction oxidase 2 [Theobroma cacao]
Length=747

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 96/186 (52%), Gaps = 5/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
             ++ LWI+ PT ++   W      K  ++ FG  G    +YTFP++  A +G +YL   K
Sbjct  29   AYMVLWIMMPTNLYFEHWMPEIRAKTKSTYFGNQGASMLIYTFPILFIATMGCIYLHLGK  88

Query  273  QKQKEGISR--QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +       R  Q  R LA L  P IV+  LGI+S +E+  +++F+  L W+  + +++ F
Sbjct  89   KDADHNRHRMVQTSR-LATLKQPAIVRGPLGIVSWMELSFLTMFVALLVWSTSSYLNHMF  147

Query  447  RKTVQ-TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
                Q      L VW+ ++       GL+   CLA L  PV R  +V RL+GL  E SV+
Sbjct  148  VHIDQMAAKSGLLVWEAKLEMSGLALGLVGNICLAFLFFPVTRGSSVLRLIGLTSEASVK  207

Query  624  YHTWLG  641
            YH W+G
Sbjct  208  YHIWIG  213



>ref|XP_003622477.1| Ferric reductase [Medicago truncatula]
Length=403

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 94/191 (49%), Gaps = 5/191 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  273  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  444  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  199  KYHIWLGHILM  209



>ref|XP_009757787.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana sylvestris]
Length=718

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 104/194 (54%), Gaps = 14/194 (7%)
 Frame = +3

Query  87   VSTGWVSLWILKPT----QVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFV  254
            V+ G+  L I+ PT    Q+WT   KA  + A+++ FG  G    + TFP I  A++G V
Sbjct  31   VTIGYFLLLIVTPTNMYRQIWTPMIKA--QTATSTYFGAQGRTLLMNTFPFIFIAVLGCV  88

Query  255  YLEQKKQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTR  431
            YL   K+   + I+R E ++ L     P+I+K  LGI+S IE+    +FI  L WTF + 
Sbjct  89   YLHLWKKSNDKNINRVEGKQKLTIWRRPIIMKG-LGIVSRIELCFFVMFIALLVWTFASY  147

Query  432  ISNDF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            +   F     K+V  K  K  VW+ ++   A R GL+    L  L +PV R  +V ++ G
Sbjct  148  LHIIFPTITPKSVAKKGEK--VWEAKLEDSALRLGLVGNIALTFLFVPVTRGSSVLQVFG  205

Query  600  LQFEVSVRYHTWLG  641
            L  E SV+YH WLG
Sbjct  206  LTSEASVKYHIWLG  219



>gb|EYU32157.1| hypothetical protein MIMGU_mgv1a019436mg [Erythranthe guttata]
Length=728

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 97/195 (50%), Gaps = 13/195 (7%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASV-FGY-NGLCFAVYTFPVIAFAIVGFVYL  260
            V TG++ LW++ PT  +   W+      +AS  FG  +G  + V+TFPV+  A++G  Y+
Sbjct  34   VFTGYLFLWVMLPTNPYRLKWQPKLRTQTASTYFGTTHGATYLVFTFPVLLIAVLGCAYV  93

Query  261  EQKKQ----KQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYT  428
               K+       EG +      LA    P+I+K  LGI+S IEI    +FI  L W+F T
Sbjct  94   HLGKKSSDDDHTEGKNGNNNHRLAIWKRPMIIKG-LGIVSRIEIAFFLMFIALLIWSFAT  152

Query  429  RISNDF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLL  596
             + N F     K+   K  K  VW+ ++   + R   +     A L  PV R  +V  L 
Sbjct  153  YLHNSFATITPKSAAKKGEK--VWEVKLDSASHRLAFIGNIAFAFLFFPVTRGSSVLPLF  210

Query  597  GLQFEVSVRYHTWLG  641
            GL  E SV+YH WLG
Sbjct  211  GLTSEGSVKYHIWLG  225



>gb|AAU94355.1| iron reductase [Pisum sativum]
Length=712

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 97/189 (51%), Gaps = 5/189 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + ++I+ P   + + W    + K +++ FG  G    +YTFP++  A +G VY+    
Sbjct  32   GLLFIFIMMPITTFKQNWIPKIQAKTNSTYFGVQGFRILIYTFPLLLIATLGCVYIHIAT  91

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +  +  I   ++        P++VK  LGI+S  EI  + +FI  L WT  T + NDF  
Sbjct  92   KSNQ--IDNGKKHETTIWKRPMLVKGPLGIVSITEIAFLLMFIALLVWTLATYLHNDFLS  149

Query  453  --TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              ++  ++    VWQ ++  V  R GL+   CL LL  PV R  +V  + GL  E S++Y
Sbjct  150  IASLPKEEHGPKVWQEKLESVGLRLGLVGNICLVLLFFPVTRGTSVLPMFGLTSEGSIKY  209

Query  627  HTWLGTAMI  653
            H W+G  ++
Sbjct  210  HIWVGHVLM  218



>ref|NP_001185067.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
 sp|F4I4K7.1|FRO3_ARATH RecName: Full=Ferric reduction oxidase 3, mitochondrial; Short=AtFRO3; 
AltName: Full=Ferric-chelate reductase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE30323.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=717

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 100/193 (52%), Gaps = 12/193 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  + + W K+   K   S+ FG  G+   VY FP+I  A +G +YL  K
Sbjct  48   GTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGVNLLVYMFPMILLASLGSIYLHLK  107

Query  270  KQKQ-KEGISRQERRCL---AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWT----FY  425
            KQ +  +  SR +R+ +     L  P++VK+ LGI++  E++ + +F+  L W+    FY
Sbjct  108  KQTRVNQFNSRMDRKKIDKFGALKRPMLVKAGLGIVTVTEVMFLMMFMALLLWSLANYFY  167

Query  426  TRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
                    +++ T    L  WQ R+  +A R GL    CL  L  PV R  ++   +GL 
Sbjct  168  HTFVTITPQSLPTDGDNL--WQARLDSIAVRLGLTGNICLGFLFYPVARGSSLLAAVGLT  225

Query  606  FEVSVRYHTWLGT  644
             E S +YH WLG 
Sbjct  226  SESSTKYHIWLGN  238



>gb|KEH18825.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=701

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 94/191 (49%), Gaps = 5/191 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  273  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  444  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  199  KYHIWLGHILM  209



>ref|XP_006339613.1| PREDICTED: ferric reduction oxidase 2-like [Solanum tuberosum]
Length=721

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 8/191 (4%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  260
            V+ G+  L I+ PT ++ + W  K      +++ FG  G    + TFP+I  A++G VYL
Sbjct  34   VTIGYFILLIVTPTNMYRQIWTPKIKAHTTNSTYFGAQGRTLLMNTFPLIFIAVLGCVYL  93

Query  261  EQKKQKQKEGISR-QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
               K+   + I+R +E++ LA    P+I+K  LGI+S IE+    +FI  L WTF + + 
Sbjct  94   HLWKKSNNKNINRVEEKQKLAIWKRPIIMK-GLGIVSRIELGFFVMFIALLVWTFASYLH  152

Query  438  NDFRKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
              F  T+  K    +   VW+ ++     R GL+   CL  L +PV R  +V ++ GL  
Sbjct  153  IIF-PTITPKSVAKSGEKVWEAKLEDSGLRLGLVGNICLTFLFVPVTRGSSVLQVFGLTS  211

Query  609  EVSVRYHTWLG  641
            E SV+YH WLG
Sbjct  212  EASVKYHIWLG  222



>ref|XP_009118818.1| PREDICTED: probable ferric reduction oxidase 1 isoform X2 [Brassica 
rapa]
 ref|XP_009118819.1| PREDICTED: probable ferric reduction oxidase 1 isoform X2 [Brassica 
rapa]
Length=695

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 101/194 (52%), Gaps = 16/194 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  20   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  79

Query  270  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  80   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  135

Query  438  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  136  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  195

Query  600  LQFEVSVRYHTWLG  641
            L  E S++YH W+G
Sbjct  196  LTSESSIKYHIWVG  209



>gb|KEH18826.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=732

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 94/191 (49%), Gaps = 5/191 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  273  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  444  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  199  KYHIWLGHILM  209



>ref|XP_009118817.1| PREDICTED: probable ferric reduction oxidase 1 isoform X1 [Brassica 
rapa]
Length=700

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 101/194 (52%), Gaps = 16/194 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  84

Query  270  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  85   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  140

Query  438  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  141  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  200

Query  600  LQFEVSVRYHTWLG  641
            L  E S++YH W+G
Sbjct  201  LTSESSIKYHIWVG  214



>ref|XP_009118820.1| PREDICTED: probable ferric reduction oxidase 1 isoform X3 [Brassica 
rapa]
Length=694

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 101/194 (52%), Gaps = 16/194 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + +WI+ PT  + + W  +   +    + FG  G+   VY FP+I    +G +YL  K
Sbjct  25   GTIVIWIMMPTSTYRKIWLTSMRAKLGKTTNFGKPGVNLLVYMFPMILLPSLGCIYLHLK  84

Query  270  KQKQ----KEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            KQ      + G+ R++R   + L  P++VK  LGI++  E++ +++F+  L W+    ++
Sbjct  85   KQTSVDQFRSGVERKKREKCSALRRPMLVKGPLGIVTVTELMFLTMFMALLLWS----LT  140

Query  438  NDFRKTVQTKDFKLA------VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLG  599
            N F  T  T   + A      +W+ R+  VA R GL    CLA L  PV R  ++   +G
Sbjct  141  NYFYFTFVTVTPQSAAIHGDKLWEARLDSVAVRLGLAGNICLAFLFYPVSRGSSLLAAVG  200

Query  600  LQFEVSVRYHTWLG  641
            L  E S++YH W+G
Sbjct  201  LTSESSIKYHIWVG  214



>emb|CDP08775.1| unnamed protein product [Coffea canephora]
Length=715

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 106/195 (54%), Gaps = 8/195 (4%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWK-AAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            VS G++ +WI+ PT  + + W      +++ + FG  G  F V+TFPV+  A +G V+L 
Sbjct  29   VSAGYIFIWIMVPTNTFKQHWLLKIRAESNTTYFGSQGANFLVFTFPVLFVAALGCVFLH  88

Query  264  QKKQKQKEGISRQ---ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
              K++  E  S++   + R +A+   P+I+K  LGI+S IE+  + +FI  L W +   +
Sbjct  89   LGKKRSNEHDSKRRDGKNRTVAW-KRPVIIKG-LGIVSRIELAFLVMFIALLVWFYTVYV  146

Query  435  SNDFRKTVQTKDFK--LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
             N F         K  + VWQ ++   + R GLL   CL LL  PV R  +V +L GL  
Sbjct  147  RNGFDSITPKSAAKSGMKVWQAKLGSASLRLGLLGNLCLTLLFFPVTRGSSVLQLFGLTS  206

Query  609  EVSVRYHTWLGTAMI  653
            E S++YH WLG  ++
Sbjct  207  EASIKYHIWLGHTVM  221



>gb|AAR15416.1| ferric reductase [Medicago truncatula]
Length=703

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 94/191 (49%), Gaps = 5/191 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +WI+ PT  +   W      KA  + FG  G    +YTFPV+  A +G VYL   K
Sbjct  19   GCIMIWIMMPTNTFNLKWFPKIRGKADPTYFGAQGETILMYTFPVLLIATLGCVYLHIAK  78

Query  273  QKQKEG---ISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +   E    I   ++      + P++VK  LGI+S  EI  + +FI  L W+F T +   
Sbjct  79   KSSNESNIEIRNGKKHGTTIWNRPMLVKGPLGIVSITEIAFLLMFIALLVWSFTTYLHIG  138

Query  444  FRKTVQT-KDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
            F+   +T  ++   V Q ++  V    GL+   CLA L  PV R  +V  + GL  E  +
Sbjct  139  FKTVAKTAAEYGNTVEQEKLYSVGIWLGLVGNICLAFLFFPVTRGSSVLPIFGLTSEGCI  198

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  199  KYHIWLGHILM  209



>gb|EYU20558.1| hypothetical protein MIMGU_mgv1a002085mg [Erythranthe guttata]
Length=717

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 93/191 (49%), Gaps = 7/191 (4%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEEKASASV-FGY-NGLCFAVYTFPVIAFAIVG--FV  254
            V  G++ LW++ PT  +   W+      +AS  FG  +G  + V+TFPV+  A++G  +V
Sbjct  29   VFAGYLFLWVMLPTNPYRLKWQPKLRTQTASTYFGTTHGATYLVFTFPVLLIAVLGCAYV  88

Query  255  YLEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
            +L +K               LA L  P+I+K  LGI+S IEI    +FI  L W+F T +
Sbjct  89   HLGKKSSDNHTKGKNGNNHRLAILKRPMIIKG-LGIVSRIEIAFFLMFIALLIWSFATYL  147

Query  435  SNDFRKTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
             N F         K    VW+ ++   + R   +     A L  PV R  +V  L GL  
Sbjct  148  RNSFATITPKSAAKKGEEVWEVKLDSASHRLAFIGNIAFAFLFFPVTRGSSVLPLFGLTS  207

Query  609  EVSVRYHTWLG  641
            E SV+YH WLG
Sbjct  208  EGSVKYHIWLG  218



>ref|XP_008803960.1| PREDICTED: ferric reduction oxidase 2-like [Phoenix dactylifera]
Length=711

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 97/191 (51%), Gaps = 10/191 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT  +   W        +++ FG  G    ++TFP++  +++  +YL   K
Sbjct  32   GWLMIWIMVPTSTYKYNWLPKLRANTNSTYFGRQGTNMLIFTFPILFISVLACIYLHLVK  91

Query  273  QKQKEGISRQER----RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
                 G SR +R    R LA    P+IV+  LG++SGIE+    +F+  L W++   +S 
Sbjct  92   -----GSSRIQRGTFSRRLAVWKRPVIVRWPLGMVSGIELSFCFMFLALLIWSYSMYLSV  146

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F       +    +WQ ++   A R GL+   C A L  PV R  ++  L+GL  E S+
Sbjct  147  GFSSLHGAANKGEKLWQSKLDSAAVRLGLVGNLCCAFLFFPVTRLSSLLPLIGLTSESSI  206

Query  621  RYHTWLGTAMI  653
            +YH WLG  ++
Sbjct  207  KYHVWLGHVVM  217



>ref|XP_010055096.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Eucalyptus 
grandis]
Length=714

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 94/188 (50%), Gaps = 11/188 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V + I+ PT  + + W  +   +  +++ FG  G    ++TFPV+  A +G VYL   
Sbjct  35   GTVLILIMLPTNTYRKHWSVSIRAKSGTSTFFGSQGYTMLMFTFPVLFIASLGCVYLHLG  94

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF-  446
             +  + GI R   + LA    P++V   LGI+S  E+  + +F+  L W+F T + N F 
Sbjct  95   NKSSENGIERS--KVLATWKRPVLVSGPLGIVSWTELAFLVMFVALLIWSFATYLRNSFL  152

Query  447  ---RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
               R+     D    VW+ ++     R GL+    LA L  PV R  +V  L GL  E S
Sbjct  153  NIDRQGPMHGD---KVWEAKLEDSGLRLGLVGNIVLAFLFFPVTRLSSVLPLFGLTSEAS  209

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  210  IKYHIWLG  217



>ref|XP_006306887.1| hypothetical protein CARUB_v10008441mg [Capsella rubella]
 gb|EOA39785.1| hypothetical protein CARUB_v10008441mg [Capsella rubella]
Length=723

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 101/188 (54%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWIL PT  +   W      +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GTILLWILMPTLTYKTKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMLLIACLGCVYLHFK  96

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L WTF   + N F
Sbjct  97   KRKSYH-IDRETKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWTFTIYLRNSF  155

Query  447  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  215  IKYHIWLG  222



>ref|XP_010480116.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=723

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 102/188 (54%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG +G    +Y FP++A A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRTKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMMAVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   KRKSCH-IDRERKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  155

Query  447  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  215  IKYHIWLG  222



>ref|XP_011038370.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 4-like 
[Populus euphratica]
Length=696

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 94/184 (51%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ +W++ PT+V+   W      K +++ F   G    +++FPV+  A  G +YL  QK
Sbjct  17   GWLMIWVMLPTKVYKNAWTPKLNGKLNSTYFEGQGTNLLLFSFPVMFIAAFGCLYLHLQK  76

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
              ++    S      L+FL  P +V + LGI++ +E+  V++FI  L W+    +   F 
Sbjct  77   NLRKPNSRSVVTSNRLSFLRRPALVMAPLGIVTAMELAFVAMFIALLIWSLANYLYVSFG  136

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                 K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  137  HLHMHKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSIKYH  195

Query  630  TWLG  641
             WLG
Sbjct  196  IWLG  199



>ref|XP_007038790.1| Ferric reduction oxidase 4 isoform 2 [Theobroma cacao]
 gb|EOY23291.1| Ferric reduction oxidase 4 isoform 2 [Theobroma cacao]
Length=648

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 97/183 (53%), Gaps = 4/183 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+++W++ PT+++  TW+   + K +++ +   G    +++FP++  A  G  YL    
Sbjct  17   GWLTIWVMLPTKLYKYTWRPKLDSKLNSTYYAAQGTNLLLFSFPMMFIAAFGCAYLH--F  74

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK+    + +    +AFL  P++V + LGI+S ++++  ++F+  + W+    +   F  
Sbjct  75   QKKSRASNSKSSGAVAFLKRPVLVMAPLGIVSALDLIFSAMFVALMIWSLANYLYVSFGH  134

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +        +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  135  -LHMDGVGEKIWQAKFRSVSLRLGYIGNICWAFLFFPVTRASSLLPLVGLTSESSIKYHI  193

Query  633  WLG  641
            WLG
Sbjct  194  WLG  196



>ref|XP_011043857.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Populus 
euphratica]
Length=703

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 95/185 (51%), Gaps = 3/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
              ++    K  VW+ ++   A   GL   ACLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQVWEVKLRGAALSLGLAGNACLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  630  TWLGT  644
             WLG 
Sbjct  206  IWLGN  210



>ref|XP_007038789.1| Ferric reduction oxidase 4 isoform 1 [Theobroma cacao]
 gb|EOY23290.1| Ferric reduction oxidase 4 isoform 1 [Theobroma cacao]
Length=694

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 97/183 (53%), Gaps = 4/183 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+++W++ PT+++  TW+   + K +++ +   G    +++FP++  A  G  YL    
Sbjct  17   GWLTIWVMLPTKLYKYTWRPKLDSKLNSTYYAAQGTNLLLFSFPMMFIAAFGCAYLH--F  74

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK+    + +    +AFL  P++V + LGI+S ++++  ++F+  + W+    +   F  
Sbjct  75   QKKSRASNSKSSGAVAFLKRPVLVMAPLGIVSALDLIFSAMFVALMIWSLANYLYVSFGH  134

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +        +WQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  135  -LHMDGVGEKIWQAKFRSVSLRLGYIGNICWAFLFFPVTRASSLLPLVGLTSESSIKYHI  193

Query  633  WLG  641
            WLG
Sbjct  194  WLG  196



>ref|XP_011043858.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Populus 
euphratica]
Length=683

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 95/185 (51%), Gaps = 3/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
              ++    K  VW+ ++   A   GL   ACLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQVWEVKLRGAALSLGLAGNACLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  630  TWLGT  644
             WLG 
Sbjct  206  IWLGN  210



>ref|XP_009609066.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana tomentosiformis]
Length=718

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (53%), Gaps = 10/192 (5%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  260
            V+ G+  L I+ PT ++ + W  K   + A+++ FG  G    + TFP I  A++G VYL
Sbjct  31   VTIGYFLLLIVTPTNMYRQIWTPKIKAQTATSTYFGAQGRTLLLNTFPFIFIAVLGCVYL  90

Query  261  EQKKQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTR  431
               K+   + I+R E ++ L     P+I+K  LGI+S IE+    +FI  L WTF  Y R
Sbjct  91   HLWKKSNDKNINRVEGKQKLTIWRRPIIMKG-LGIVSRIELCFFVMFIALLVWTFASYLR  149

Query  432  I--SNDFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
            I       K+V     K  VW+ ++     R GL+    L  L +PV R  +V ++ GL 
Sbjct  150  IIFPTITPKSVAKSGEK--VWEAKLENSGLRLGLVGNIALTFLFVPVTRGSSVLQVFGLT  207

Query  606  FEVSVRYHTWLG  641
             E SV+YH WLG
Sbjct  208  SEASVKYHIWLG  219



>ref|XP_008234849.1| PREDICTED: ferric reduction oxidase 4-like [Prunus mume]
Length=690

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 92/183 (50%), Gaps = 5/183 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W + PT+ +   W    + K +++ FG  G+   + +FP++  A +  VYL  +K
Sbjct  21   GWLMIWTMLPTKTYKNVWTLNLQSKLNSTYFGAQGVNLLLLSFPMMLIAALSCVYLHFQK  80

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            Q     I+      L F   P +VK+ LGI++ +E+  V +F   L W+    +   F  
Sbjct  81   QSNSSVITTSR---LTFWRRPAVVKAPLGIVTAMELAFVIMFAALLVWSLANYLYVSFGH  137

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                KD +  VW+ +   V+ R G +   C A L  PV R  ++  L GL  E S++YH+
Sbjct  138  LHMHKDGE-KVWEAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLFGLTSESSIKYHS  196

Query  633  WLG  641
            WLG
Sbjct  197  WLG  199



>ref|XP_009368746.1| PREDICTED: ferric reduction oxidase 4-like isoform X2 [Pyrus 
x bretschneideri]
Length=690

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 94/183 (51%), Gaps = 2/183 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+ +   W    + K +++ FG  G+   +++FPV+  A +  VYL  +K
Sbjct  19   GWLVIWIMMPTKTYKNGWMPNLQSKLNSTYFGEQGVNLLLFSFPVMLIAALSCVYLHLQK  78

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +      +  +   LAF   P++VK+ LGI++ IE+    +F+  L W+    +   F  
Sbjct  79   KSISTTTTGIKTNRLAFWRRPVVVKAPLGIVTAIELAFGLMFVSLLVWSLANYLYVSFGH  138

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
             +        VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++YH 
Sbjct  139  -LHIHMPGEKVWEAKFRSVSLRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIKYHI  197

Query  633  WLG  641
            WLG
Sbjct  198  WLG  200



>ref|XP_009411423.1| PREDICTED: ferric reduction oxidase 2-like [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 93/190 (49%), Gaps = 16/190 (8%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE---  263
            GW+ +W + PT  +   W      K   + FG  G    ++TFP++  A+VG VYL    
Sbjct  11   GWLMIWGMLPTHTFGERWLPMLLSKTKTTYFGRLGTNVLIFTFPILFIAVVGCVYLHIVR  70

Query  264  -QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
               + K   G  +  RR       PL++K  LGI+SG E+    +F+ F+ W F   +SN
Sbjct  71   KSDRNKSSSGALKAWRR-------PLLIKQPLGIVSGTELAFCLMFLAFIVWFFSCYLSN  123

Query  441  ---DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
               +F+     K+    +W  ++   A R GLL   C A L  PV R  ++  L+GL  E
Sbjct  124  ALANFKGEGGEKESN-GLWLAKLEIAALRLGLLGSLCFAFLFFPVTRASSLLPLVGLTSE  182

Query  612  VSVRYHTWLG  641
             S++YH WLG
Sbjct  183  CSIKYHVWLG  192



>ref|XP_006852345.1| hypothetical protein AMTR_s00049p00212370 [Amborella trichopoda]
 gb|ERN13812.1| hypothetical protein AMTR_s00049p00212370 [Amborella trichopoda]
Length=599

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  354  LGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTVQTKDFKLAVWQYRMLRVATRFGllt  533
            +GI+S  E+L  S+FIIFL WTFY+   N F+K   ++      W ++ +++  +FG + 
Sbjct  1    MGIVSMKEVLTTSVFIIFLGWTFYSNTYNGFKKMKHSESENWQPWYFKTMKIGVKFGFVA  60

Query  534  eaclallllpvlRRMAVFRLLGLQFEVSVRYHTWLGTAMI  653
            EACLALLL P+LR +A+ +LLGLQ+EVSVRYH WLG  M+
Sbjct  61   EACLALLLFPILRVLALPQLLGLQYEVSVRYHIWLGNTMM  100



>gb|KCW71572.1| hypothetical protein EUGRSUZ_E00107 [Eucalyptus grandis]
Length=655

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 10/190 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  6    GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  65

Query  270  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  66   NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  123

Query  435  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  124  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  183

Query  612  VSVRYHTWLG  641
             S++YH WLG
Sbjct  184  ASIKYHIWLG  193



>ref|XP_006362676.1| PREDICTED: ferric reduction oxidase 4-like [Solanum tuberosum]
Length=707

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 89/185 (48%), Gaps = 3/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--Q  266
            GW+ +W++ PT  +  +W    + K +++ F   G+   ++TFP++  A V  VYL    
Sbjct  17   GWLFIWVMLPTPTYRNSWTPQLKIKLNSTYFREQGINLLLFTFPIMLIAAVSCVYLHLYN  76

Query  267  KKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K        + + R     L   ++V   LGI++ +E+    +FI+ L W+    I   F
Sbjct  77   KSTSDHSSTTNKGREYFGSLKRKVVVMEPLGIVNAVELSFAVMFIVLLIWSLANYIYISF  136

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
               +   +    VW+ +   V+ R G L   C A L  PV R  ++  L+GL  E S++Y
Sbjct  137  NGNLHMHNPTEKVWKAKFRSVSLRLGYLGNICYAFLFFPVTRVSSILPLMGLTSESSIKY  196

Query  627  HTWLG  641
            H WLG
Sbjct  197  HIWLG  201



>gb|EYU34160.1| hypothetical protein MIMGU_mgv1a023886mg [Erythranthe guttata]
Length=706

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 93/186 (50%), Gaps = 5/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASV-FGY-NGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G++ LW++  T  +   W       +AS  FG  +G  + ++TFPV+  A +G VYL   
Sbjct  38   GYLFLWMMISTNPYRLKWLPKVRTQTASTYFGTTHGATYLLFTFPVMFIATLGCVYLHLG  97

Query  270  KQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K+   +  ++ +   LA L  P+I+K  LGI+S IEI    +FI  L W F T + N F 
Sbjct  98   KKSSTDNHTKGKNERLAILKRPMIIK-GLGIVSWIEIAFFIMFIALLTWNFATYLRNSFA  156

Query  450  KTVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
                    K    VW+ ++   + R  L+    LA L  PV R  +V  L GL  E SV+
Sbjct  157  TITSKSAAKKGEQVWEVKLDSASHRLALVANIALAFLFFPVTRGSSVLPLFGLTSEGSVK  216

Query  624  YHTWLG  641
            YH WLG
Sbjct  217  YHIWLG  222



>gb|AAT01415.1| ferric reductase [Cucumis sativus]
Length=694

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 95/187 (51%), Gaps = 13/187 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKVREKSYKSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  270  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K++    +  ++      LA    P IVK  LGI+S  E+  +++FII L W+F T + N
Sbjct  81   KKRSDPNVKTRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFIILLVWSFATYLHN  140

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ITEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  193  KYHIWLG  199



>gb|KCW71571.1| hypothetical protein EUGRSUZ_E00107 [Eucalyptus grandis]
Length=690

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 10/190 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  6    GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  65

Query  270  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  66   NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  123

Query  435  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  124  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  183

Query  612  VSVRYHTWLG  641
             S++YH WLG
Sbjct  184  ASIKYHIWLG  193



>ref|XP_010055097.1| PREDICTED: ferric reduction oxidase 2-like [Eucalyptus grandis]
Length=724

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 94/190 (49%), Gaps = 10/190 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G V +WI+ PT  +   W  +   + ++++ FGY G    ++TFPV+  A +G VYL   
Sbjct  40   GTVLMWIMLPTNTYREHWFPSIWAKSSTSTFFGYQGYTMLMFTFPVLFIACLGCVYLHLG  99

Query  270  KQK-----QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRI  434
             +       K G+ R  ++ LA    P++V   LGI+S  E+    +FI  L W+F T +
Sbjct  100  NESIEPRVGKNGVER--KKGLAMWKRPVLVSGPLGIVSWTELAFFVMFIALLVWSFATDL  157

Query  435  SNDFRKTVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFE  611
               F    +T       +W+ ++ R     G +    LALL  PV R  +V  L GL  E
Sbjct  158  RISFLDIERTGPMDGDKMWEAKLERSGLWLGSVGNIALALLFFPVTRVSSVLPLFGLTSE  217

Query  612  VSVRYHTWLG  641
             S++YH WLG
Sbjct  218  ASIKYHIWLG  227



>ref|XP_010457106.1| PREDICTED: ferric reduction oxidase 2 [Camelina sativa]
Length=723

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 101/188 (54%), Gaps = 8/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAE--EKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G + LWI+ PT  +   W      +  +++ FG +G    +Y FP++  A +G VYL  K
Sbjct  37   GIILLWIMMPTLTYRNKWLPLMRIKFGTSTYFGSSGTTLFMYMFPMMVVACLGCVYLHFK  96

Query  270  KQKQKEGISRQERRCL-AFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            K+K    I R+ +  + + L  P++VK  LGI+S  EI  +++F+  L W+F   + N F
Sbjct  97   KRKSYH-IDRETKGGVWSALRKPMLVKGPLGIVSVTEITFLAMFVALLLWSFIIYLRNSF  155

Query  447  RKTVQTKDFKL---AVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+  +       ++WQ ++   A R GL+   CLA L LPV R  ++   +GL  E S
Sbjct  156  -ATITPQSLAAHGESLWQAKLESAALRLGLIGNICLAFLFLPVARGSSLLPAVGLTSESS  214

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  215  IKYHIWLG  222



>ref|XP_004143614.1| PREDICTED: ferric reduction oxidase 2-like [Cucumis sativus]
 ref|XP_004163105.1| PREDICTED: ferric reduction oxidase 2-like [Cucumis sativus]
Length=694

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 95/187 (51%), Gaps = 13/187 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKIREKSYKSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  270  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K++    +  ++      LA    P IVK  LGI+S  E+  +++FII L W+F T + N
Sbjct  81   KKRSDPNVKTRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFIILLVWSFATYLHN  140

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ITEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  193  KYHIWLG  199



>ref|NP_001234329.1| ferric-chelate reductase [Solanum lycopersicum]
 gb|AAP46144.1| ferric-chelate reductase [Solanum lycopersicum]
Length=719

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 103/191 (54%), Gaps = 8/191 (4%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYL  260
            V+ G+  L I+ PT ++ + W  K      +++ FG  G    + TFP+I  A++G VYL
Sbjct  32   VTIGYFLLLIVTPTNMYRQIWTPKIKAHTTNSTYFGAQGRTLLMNTFPLIFIAVLGCVYL  91

Query  261  EQKKQKQKEGISR-QERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
               K+   + I+R ++++ LA    P+I+K  LGI+S IE+    +FI  L WTF + + 
Sbjct  92   HLWKKSNNKNINRFEKKQKLAIWRRPIIMK-GLGIVSRIELGFFVMFIALLVWTFASYLH  150

Query  438  NDFRKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
              F  T+  K    +   VW+ ++     R GL+   CL  L +PV R  +V ++ GL  
Sbjct  151  IIF-PTITPKSVANSGEKVWEAKLEDSGLRLGLVGNICLTFLFVPVTRGSSVLQVFGLTS  209

Query  609  EVSVRYHTWLG  641
            E SV+YH WLG
Sbjct  210  EASVKYHIWLG  220



>ref|XP_002305245.2| ferric-chelate reductase family protein [Populus trichocarpa]
 gb|EEE85756.2| ferric-chelate reductase family protein [Populus trichocarpa]
Length=689

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 96/185 (52%), Gaps = 5/185 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+++  TW      K +++ F   G    + +FP++  A +G +YL  KK
Sbjct  17   GWLVVWIMLPTKLYKITWTPKLNSKLNSTYFSGQGTNLLLLSFPMMFIAALGCIYLHAKK  76

Query  273  QKQKEGISRQ--ERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            Q Q+   S+       L+FL  P +V + LG ++ +E+  V++FI  L W+    +   F
Sbjct  77   Q-QRSSYSKSVVTSNRLSFLRRPALVMAPLGTVTAMELAFVAMFIALLIWSLGNYLYVSF  135

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
                  K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++Y
Sbjct  136  GHLHIHKQGE-KVWQAKFRSVSLRLGYVGNICWAFLFFPVTRGSSILPLVGLTSESSIKY  194

Query  627  HTWLG  641
            H WLG
Sbjct  195  HIWLG  199



>gb|EMS45573.1| Superoxide-generating NADPH oxidase heavy chain subunit B [Triticum 
urartu]
Length=1019

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 104/185 (56%), Gaps = 5/185 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQ  275
            GW+ +W + PT+ ++ TW  A + A+ + FG  G+   VY FPV+   +V  VYL  ++Q
Sbjct  36   GWLMMWAMLPTRTYSSTW--APKLAALTGFGKQGIRITVYVFPVLFVFVVACVYLHLQQQ  93

Query  276  KQKEGIS--RQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR  449
            K  +  +  R   R  A    P++V+  LGI++GIE+  + +F+  L W +Y  ++ +F 
Sbjct  94   KGGDPNTQRRTSTRIAAAWRRPVLVRGPLGIVTGIELAVLLMFMALLVWFYYAYVTVEFS  153

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
            K ++ K  +  +WQ  + + A R G +   C ALL LPV R  ++  L+GL  E  ++YH
Sbjct  154  KLLRVKPGQ-KLWQAELEKAAKRLGSVGSLCCALLFLPVARGSSLLPLVGLTSESGIKYH  212

Query  630  TWLGT  644
             WLG 
Sbjct  213  VWLGN  217



>ref|XP_008445871.1| PREDICTED: ferric reduction oxidase 2-like [Cucumis melo]
Length=693

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 95/187 (51%), Gaps = 13/187 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ LW++ PT  + + W  K  E+   ++ FG  G    +YTFP++  AI+G VY   +
Sbjct  21   GWIFLWVMMPTNTYRKKWLPKIREKTYQSTYFGSEGTSLLMYTFPILFIAILGCVYNHLE  80

Query  270  KQKQKEGISRQE---RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K++  + I  ++      LA    P IVK  LGI+S  E+  +++FI  L W+F T + N
Sbjct  81   KKRSDQNIETRKGTKHHGLAMWKQPAIVKGPLGIVSWTELTLLTMFITLLVWSFATYLHN  140

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F            +W+ R+       G++   CL  L  PV R  ++  LLGL  E  +
Sbjct  141  SF--------ISEKMWEIRLGSAGFWLGIVGNICLVFLFFPVARGSSLLPLLGLTSEGCI  192

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  193  KYHIWLG  199



>ref|XP_009368744.1| PREDICTED: ferric reduction oxidase 2-like [Pyrus x bretschneideri]
Length=721

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 94/184 (51%), Gaps = 2/184 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT  +   W     +K  ++ FG  G    +YTFP++  A +G + L    
Sbjct  39   GYMMIWIIMPTNTYYLKWFPHIHKKTDSTYFGQEGADILIYTFPILFTATMGCLLLHMGN  98

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +       R ++   A  + P +VK  LGI+S IE+  + +FI    W+  + + + F  
Sbjct  99   KNVDLNNQRAKKSYRASWNRPALVKGPLGIVSCIELSFLVMFIALFVWSISSYLHDMFAY  158

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
             T++    K  VW+ ++  VA   G++    LA L  PV R  ++ +++GL  E S++YH
Sbjct  159  ATLEAAAKKEHVWENKLGSVALTLGIVGNIGLAFLFFPVSRCSSILQIIGLTSEASIKYH  218

Query  630  TWLG  641
             WLG
Sbjct  219  IWLG  222



>ref|XP_007220890.1| hypothetical protein PRUPE_ppa014767mg [Prunus persica]
 gb|EMJ22089.1| hypothetical protein PRUPE_ppa014767mg [Prunus persica]
Length=684

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 92/183 (50%), Gaps = 6/183 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +W + PT+ +   W    + K +++ FG  G+   + +FP++  A +  VYL  +K
Sbjct  16   GWLMIWTMLPTKTYKNVWTLNLQSKLNSTYFGAQGVNLLLLSFPMMLIAALSCVYLHFQK  75

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            Q     I+ +    L F   P +VK+ LGI++ +E+    +F   L W+    +   F  
Sbjct  76   QSNSSVITSR----LTFWRRPAVVKAPLGIVTAMELAFAIMFAALLVWSLANYLYVSFGH  131

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                KD +  VW+ +   V+ R G +   C A L  PV R  ++  L GL  E S++YH+
Sbjct  132  LHMHKDGE-KVWEAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLFGLTSESSIKYHS  190

Query  633  WLG  641
            WLG
Sbjct  191  WLG  193



>ref|XP_002305246.1| hypothetical protein POPTR_0004s07730g [Populus trichocarpa]
 gb|EEE85757.1| hypothetical protein POPTR_0004s07730g [Populus trichocarpa]
Length=705

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 93/185 (50%), Gaps = 3/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQV-WTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +W +K T   +   W    +K S++  G  G    +Y FP++  A +G +YL  +K
Sbjct  27   GYMMIWSMKSTNTFYLHWWPDVLKKTSSTYLGEQGTTTLIYAFPILFIATIGSLYLHLEK  86

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +   +  +R   R +  L  P+I K  LGI+S  E+  +++F+  L W+ Y+   N F  
Sbjct  87   KYDHDHSTRFISRII-LLKRPVITKGPLGIVSWTELTFLAMFVALLVWSMYSYTHNMFAF  145

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
              ++    K   W+ ++   A   GL    CLA L  PV R  ++ + +GL  E S++YH
Sbjct  146  AALEAAQEKFQAWEVKLRSAALGLGLAGNTCLAFLFFPVTRGSSILQFVGLTSEASIKYH  205

Query  630  TWLGT  644
             WLG 
Sbjct  206  IWLGN  210



>ref|XP_004496531.1| PREDICTED: ferric reduction oxidase 2-like [Cicer arietinum]
Length=706

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 94/192 (49%), Gaps = 10/192 (5%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            +S G++ +W++ PT  +   W    + KA    FG  G    VYTFP+I  A +  +Y  
Sbjct  22   ISLGYMMVWLMMPTNTFFMHWLPDIQAKADPIYFGKQGTTILVYTFPIIFMATLASLYHH  81

Query  264  QKKQKQKEGISRQERRCLAFLSN-----PLIVKSSLGILSGIEILGVSLFIIFLAWTFYT  428
              ++     I   E   + FL       PL V   LGI+S  E   + +F++ L W+  +
Sbjct  82   MMQKGSNHDI---ESSKMGFLRKASWRKPLFVNGHLGIISRTEFSFIIMFVVLLIWSLCS  138

Query  429  RISNDFRK-TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQ  605
             +   F K  +Q  + ++ +W+ ++   A   GL+   CLA +  PV R  ++ R +GL 
Sbjct  139  YLHGMFAKVALQAANERVQMWETKLENSALALGLVGNICLAFMFFPVSRGSSILRFIGLT  198

Query  606  FEVSVRYHTWLG  641
             E S++YH WLG
Sbjct  199  SEASIKYHIWLG  210



>gb|EPS59492.1| ferric-chelate reductase, partial [Genlisea aurea]
Length=679

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 91/189 (48%), Gaps = 7/189 (4%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTW-KAAEEKASASVFG--YNGLCFAVYTFPVIAFAIVGFVY  257
            ++ G+ SL+++ P   +   W        S++ FG       F +YT PV+  +++G  Y
Sbjct  2    LAAGYFSLFVMMPISQYFHVWIPKLRSHTSSTYFGTTQGSAYFLLYTVPVLLISLLGCFY  61

Query  258  LEQKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRIS  437
            L   K K   G +   RR       P++V   LGI+S IE+  + +FI  L W     ++
Sbjct  62   LHLGKNK---GTTAGRRRRWETWRRPIVVMRGLGIVSRIELSLLIMFIALLGWNLGRFLA  118

Query  438  NDFRK-TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEV  614
             DFR  T+         WQ R+ R A R GL+    L  L  PV R  +V R+ GL  E 
Sbjct  119  TDFRNITIAPNSHTHHRWQARLERAAVRLGLVGNISLTFLFFPVTRGSSVLRIFGLTSES  178

Query  615  SVRYHTWLG  641
            S+RYH WLG
Sbjct  179  SIRYHMWLG  187



>ref|XP_002511896.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF50565.1| ferric-chelate reductase, putative [Ricinus communis]
Length=714

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 104/192 (54%), Gaps = 8/192 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKA-AEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ LWI+ PT  + R W    +EK +++  G  G    ++ FP++  A++G  Y+   K
Sbjct  30   GYLVLWIILPTNTYWRHWYGRIDEKFTSTYLGRQGQPLLLFFFPILFIAVLGCAYIHLGK  89

Query  273  QKQK---EGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            +  +   EG  R+ R  LA L  P++VK  LGI+S IE+  + +FI  L W+  T + N 
Sbjct  90   RSNQNILEGNGRKHR--LAALRKPMLVKGPLGIVSSIELAFLIMFIALLIWSLSTYLHNS  147

Query  444  FRK-TVQTKDFKLA-VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F   T Q    + A VW+ ++   +  FGL+   CL  L  PV+R  +V  L GL  E S
Sbjct  148  FSTITPQFAATRNARVWEAKLESASFLFGLVGNICLTFLFFPVVRGSSVLPLFGLTSEGS  207

Query  618  VRYHTWLGTAMI  653
            ++YH WLG  M+
Sbjct  208  IKYHIWLGHMMM  219



>gb|EYU25131.1| hypothetical protein MIMGU_mgv1a023728mg, partial [Erythranthe 
guttata]
Length=688

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 94/189 (50%), Gaps = 3/189 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT V+   W       + S+F G  G    VYT P++  A +G +YL   +
Sbjct  9    GYIMIWIMMPTNVFWLHWSPRIHAETDSMFFGQQGANILVYTSPILLIATLGCIYLHLDR  68

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
                      +    A  + P+ V+  LGI+S  E+  + +FI+ L W+    +   F+ 
Sbjct  69   YTGDSNNRTTKDSRFATWARPVFVRGPLGIVSWTELSFILMFIVLLIWSISAYVHGMFKN  128

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
              +    K+   VW+ ++  VA   GL+   CL+ L  P+ R  ++ RL+G+  E SV+Y
Sbjct  129  ITRQSSSKIGELVWEVKLDSVALMLGLVGNICLSFLFFPINRGSSILRLVGVTSESSVKY  188

Query  627  HTWLGTAMI  653
            H WLG  ++
Sbjct  189  HIWLGHTVL  197



>ref|XP_011093123.1| PREDICTED: LOW QUALITY PROTEIN: ferric reduction oxidase 2-like 
[Sesamum indicum]
Length=681

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 92/184 (50%), Gaps = 7/184 (4%)
 Frame = +3

Query  108  LWILKPTQVWTRTWKAAEEKASASV-FGYN-GLCFAVYTFPVIAFAIVGFVYLEQKKQKQ  281
            +W++ PT  + +TW       +AS  FG   G  + V+TFPV+  A +G +YL    Q +
Sbjct  1    MWVMMPTNAYRQTWLPELRSQTASTYFGTTQGATYLVFTFPVVFIAALGCLYLHLGNQSR  60

Query  282  KEGISRQER--RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
               +++       L     PLI+K  LGI+SGIE+    +FI  L W F   +   F K 
Sbjct  61   FNNLTKGSNGGHRLGKYQRPLIIKG-LGIVSGIELAFFLMFIALLLWNFAAYLQLSFPKI  119

Query  456  VQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                  +    VW+ ++   A R GL+    L+ L  PV R  +V  +LGL +E SV+YH
Sbjct  120  TPNSAAQSGEKVWEAKLDAAALRLGLVGNIGLSFLFFPVTRGSSVLGVLGLTWEASVKYH  179

Query  630  TWLG  641
             W+G
Sbjct  180  IWVG  183



>ref|XP_004253309.1| PREDICTED: ferric reduction oxidase 4-like, partial [Solanum 
lycopersicum]
Length=222

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 89/186 (48%), Gaps = 4/186 (2%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAAEE-KASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  GW+ +W++ PT  +  +W      K +++ F   G+   ++TFP++  A V  VYL 
Sbjct  14   VFVGWLFIWVMLPTPTYKNSWTPHLLIKLNSTYFREQGINLLLFTFPIMLIAAVSCVYLH  73

Query  264  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
               +       R   +   +   P +V  SLGI++ +E++  ++F + L W+    I   
Sbjct  74   LYNKSTSN--HRSSNKVREYFRRPRLVIESLGIVNAVELIFAAMFTVLLIWSLANYIYIS  131

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            +   +   +    VW  +   VA R G +   C A L  PV R  ++  L+GL  E S++
Sbjct  132  Y-GNLHMHNPAEKVWMAKFRSVALRLGYIGNVCYAFLFFPVTRLSSILPLVGLTSESSIK  190

Query  624  YHTWLG  641
            YH WLG
Sbjct  191  YHIWLG  196



>ref|XP_010661832.1| PREDICTED: ferric reduction oxidase 2 isoform X1 [Vitis vinifera]
 emb|CBI40431.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 93/185 (50%), Gaps = 4/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +          +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F+ 
Sbjct  93   KLNNNKSKSSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGFQG  152

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  153  -IEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  211

Query  627  HTWLG  641
            H WLG
Sbjct  212  HIWLG  216



>ref|XP_002275942.2| PREDICTED: ferric reduction oxidase 2 isoform X2 [Vitis vinifera]
Length=713

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 95/185 (51%), Gaps = 5/185 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
             K     S+  +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F+ 
Sbjct  93   -KLNNNKSKSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGFQG  151

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  152  -IEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  210

Query  627  HTWLG  641
            H WLG
Sbjct  211  HIWLG  215



>ref|XP_009800600.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana sylvestris]
Length=715

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 6/187 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G+  + I+ PT ++  TW  K     A+++ FG  G+   + TFP +  A++G +YL   
Sbjct  31   GYFLILIVSPTNMYYLTWTPKIKARAATSTYFGAQGMSLLLDTFPFLFIAVLGCIYLHLS  90

Query  270  KQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISN  440
            K+   + I+R E +  LA    P+I+K  LGI++ IE+  + +FI  L W++  Y   + 
Sbjct  91   KKSSDKNINRVEGKEKLAIWRRPIIMK-GLGIVTRIELCFLVMFIALLVWSYASYLHAAF  149

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F            VW+ ++       GL+    L  L +PV R  +V +L GL  E SV
Sbjct  150  PFITPQSVAQSGQKVWEVKLEEAGLMLGLVGNVVLTFLFVPVTRGSSVLQLFGLTSEASV  209

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  210  KYHIWLG  216



>emb|CAN82573.1| hypothetical protein VITISV_034719 [Vitis vinifera]
Length=792

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 93/185 (50%), Gaps = 4/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + L+++ PT  + + W         ++ FG  G    +YTFPV+  A++G  YL   K
Sbjct  33   GILVLFVMMPTNTYKKKWFVQVVATTDSTYFGRQGATILIYTFPVLFSAVLGCAYLHLGK  92

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +          +  LA L  P++VK  LGI+S IE+L + +FI  L W+ YT +   F+ 
Sbjct  93   KLNNNKSKSSPKDRLAVLKRPVLVKGPLGIVSMIEMLFLVMFIALLVWSIYTYLRTGFQG  152

Query  453  TVQTKDFKLA--VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
             ++ K  K    +W  ++   A R  L     LA L  PV R  ++  L+GL  E S++Y
Sbjct  153  -IEDKAAKKGEKLWVSKLGAAALRLALTGNIALAFLFFPVARGSSILPLIGLTSEASIKY  211

Query  627  HTWLG  641
            H WLG
Sbjct  212  HIWLG  216



>ref|XP_008376640.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Malus 
domestica]
Length=693

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 96/186 (52%), Gaps = 5/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ +WI+ PT+ +   W    + K +++ FG  G+   +++FPV+  A +  VYL  QK
Sbjct  19   GWLVIWIMMPTKTYKNGWMPNLQSKLNSTYFGEQGVNLLLFSFPVMLIAALSCVYLHLQK  78

Query  270  KQKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            K  +    +    +   LAF   P++VK+ LGI++ IE+    +F+  L W+    +   
Sbjct  79   KSIRSPSTTTTGVKTNRLAFWRRPVVVKAPLGIVTAIELAFGLMFVSLLVWSLANYLYVS  138

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F + +        VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++
Sbjct  139  FGQ-LHMHMPGEKVWEAKFRSVSLRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIK  197

Query  624  YHTWLG  641
            YH WLG
Sbjct  198  YHIWLG  203



>ref|XP_010545917.1| PREDICTED: ferric reduction oxidase 4 [Tarenaya hassleriana]
Length=704

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 4/185 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKA-SASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+V+   W     K  + + FG  GL   + T P++  A +  VYL  +K
Sbjct  18   GWIFVWIMIPTKVFKYNWTPKLAKHLNTTYFGPQGLTIVLLTVPMMLIAALSCVYLHIQK  77

Query  273  QKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            +    G + + + C  +  +  P++V + LGI++  E     LF+  L W+    +   +
Sbjct  78   KSTDNGTANRSKICEVVGKMRRPMMVMNPLGIVTATEFTFSILFVALLVWSLGNYLYISY  137

Query  447  RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRY  626
               +   D    +WQ +      R G +   C A L  PV R   +  L+GL  E S++Y
Sbjct  138  NVHLHNDD-NAKIWQAKFRSFGLRTGYVGHICWAFLFFPVTRASTILPLVGLTSESSIKY  196

Query  627  HTWLG  641
            H WLG
Sbjct  197  HIWLG  201



>gb|KHN46714.1| Ferric reduction oxidase 2 [Glycine soja]
Length=683

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 79/149 (53%), Gaps = 6/149 (4%)
 Frame = +3

Query  213  YTFPVIAFAIVGFVYLE-QKKQKQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILG  386
            YTFP++  A +G VYL   KK       S   ++C +     P+++K  LGI+SG EI  
Sbjct  39   YTFPILLLATLGCVYLHIGKKVIHSNTESCNAKKCGVTIWKRPVLIKGPLGIVSGTEIAF  98

Query  387  VSLFIIFLAWTFYTRISNDFRKTVQ---TKDFKLAVWQYRMLRVATRFGllteaclalll  557
            + LFI  LAW F T + N F         KD +  +W+ ++ RVA R G++   CLA + 
Sbjct  99   LFLFIALLAWVFSTSVQNSFATITPQFAAKDGQ-KIWEEKLDRVAKRLGVVGNICLAFMF  157

Query  558  lpvlRRMAVFRLLGLQFEVSVRYHTWLGT  644
             PV R  +V  LL L  E  ++YH WLG 
Sbjct  158  FPVARGSSVLPLLDLTSESCIKYHIWLGN  186



>gb|ABU54827.1| ferric reductase [Malus baccata var. xiaojinensis]
Length=721

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 94/184 (51%), Gaps = 2/184 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT  +   W     +K  ++ FG  G    +YTFP++  A +G + L    
Sbjct  39   GYMMIWIIMPTNTYYLKWFPHIHKKTDSTYFGQEGADILIYTFPILFTATMGCLLLHMGN  98

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +       R ++   A  + P +VK  +GI+S IE+  + +FI  L W+  + + + F  
Sbjct  99   KNVDINNQRAKKSYRASWNRPALVKGPIGIVSWIELSFLVMFIALLVWSISSYLHDMFAY  158

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
             T++    K  VW+ ++  V    G++    LA L  PV R  ++ +++GL  E S++YH
Sbjct  159  ATLEAAAKKEHVWENKLGSVVLTLGIVGNIGLAFLFFPVSRGSSILQIIGLTSEASIKYH  218

Query  630  TWLG  641
             WLG
Sbjct  219  IWLG  222



>ref|XP_009368745.1| PREDICTED: ferric reduction oxidase 4-like isoform X1 [Pyrus 
x bretschneideri]
Length=693

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 95/186 (51%), Gaps = 5/186 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            GW+ +WI+ PT+ +   W    + K +++ FG  G+   +++FPV+  A +  VYL  QK
Sbjct  19   GWLVIWIMMPTKTYKNGWMPNLQSKLNSTYFGEQGVNLLLFSFPVMLIAALSCVYLHLQK  78

Query  270  KQKQKEGISRQERRC--LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            K  +    +    +   LAF   P++VK+ LGI++ IE+    +F+  L W+    +   
Sbjct  79   KSIRSPSTTTTGIKTNRLAFWRRPVVVKAPLGIVTAIELAFGLMFVSLLVWSLANYLYVS  138

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F   +        VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++
Sbjct  139  FGH-LHIHMPGEKVWEAKFRSVSLRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIK  197

Query  624  YHTWLG  641
            YH WLG
Sbjct  198  YHIWLG  203



>ref|XP_010045373.1| PREDICTED: ferric reduction oxidase 7, chloroplastic-like [Eucalyptus 
grandis]
Length=732

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 96/184 (52%), Gaps = 2/184 (1%)
 Frame = +3

Query  99   WVSLWILKPTQVWTRTWKAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKKQK  278
            W++++ + PT+  T  +   E+  S +++G  G    +YT P++  A++   YL      
Sbjct  46   WIAMFFVIPTEFGTDFYTDWEDATSGTLYGTEGSALLLYTGPILLIAVLAVPYLLLSGGD  105

Query  279  QKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKT  455
              + ++ +++   L   + P++V    G+++  E +G+++F++F+AW  Y     +F   
Sbjct  106  DDDVVAEKKKSPRLRLGTFPVLVDGVFGVVTAAEFIGIAMFVVFVAWAVYGYTVVNFEML  165

Query  456  VQTKDFKLAVWQYRMLRVATR-FGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                D      + +ML+++   FGL    CLA L LPV R   + RL+G+ FE + RYH 
Sbjct  166  PTYGDLTPLEKRVQMLQMSAYIFGLTALTCLAFLFLPVARGSILLRLIGIPFEHATRYHV  225

Query  633  WLGT  644
            WLG 
Sbjct  226  WLGN  229



>ref|XP_010055095.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Eucalyptus 
grandis]
Length=722

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 96/191 (50%), Gaps = 12/191 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA--EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE--  263
            G V + I+ PT  + + W  +   +  +++ FG  G    ++TFPV+  A +G VYL   
Sbjct  35   GTVLILIMLPTNTYRKHWSVSIRAKSGTSTFFGSQGYTMLMFTFPVLFIASLGCVYLHLG  94

Query  264  QKKQKQKEGISRQER-RCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
             K  + + G +  ER + LA    P++V   LGI+S  E+  + +F+  L W+F T + N
Sbjct  95   NKSSEPRVGKNGIERSKVLATWKRPVLVSGPLGIVSWTELAFLVMFVALLIWSFATYLRN  154

Query  441  DF----RKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQF  608
             F    R+     D    VW+ ++     R GL+    LA L  PV R  +V  L GL  
Sbjct  155  SFLNIDRQGPMHGD---KVWEAKLEDSGLRLGLVGNIVLAFLFFPVTRLSSVLPLFGLTS  211

Query  609  EVSVRYHTWLG  641
            E S++YH WLG
Sbjct  212  EASIKYHIWLG  222



>ref|XP_009375512.1| PREDICTED: ferric reduction oxidase 4-like isoform X2 [Pyrus 
x bretschneideri]
Length=691

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 91/183 (50%), Gaps = 2/183 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ +WI+ PT+ +   W    + K  ++ FG  G+   +++FP++  A +  VYL  +K
Sbjct  20   GWLMMWIVLPTKTYENGWTPNLQSKLKSTYFGEQGVNLLLFSFPMMLIAALSCVYLHLEK  79

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +           R LAF   PL+V++ LGI++ +E+    +F+  L W+    +   F  
Sbjct  80   KSTSSSTGIITNR-LAFWRRPLVVQAPLGIVTAMELAFGLMFVALLVWSLANYLYVSFGY  138

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                      VW+ +   V+ R G +   C ALL  PV R  ++  L GL  E S++YH 
Sbjct  139  LHMHVPAGEKVWEAKFGSVSWRLGYIGNICWALLFFPVTRGSSILPLFGLTSESSIKYHI  198

Query  633  WLG  641
            WLG
Sbjct  199  WLG  201



>ref|XP_011470323.1| PREDICTED: ferric reduction oxidase 2-like [Fragaria vesca subsp. 
vesca]
Length=719

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QK  269
            G+  +WI+ PT  +   W      K  ++ FG  G    VYTFP++  A +G + L  Q 
Sbjct  37   GYSMIWIMMPTNTYYLHWLPDIHAKTDSTYFGQQGAGILVYTFPILFIATLGCLLLHIQN  96

Query  270  K---QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISN  440
            K    K + G+ +      +    P++VK  LGI+S IE+  +++FI  L W+  + +  
Sbjct  97   KTADNKNQSGVMK------SLWKRPVLVKGPLGIVSWIELSFLAMFIALLVWSISSYLHG  150

Query  441  DFRK-TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
             F   ++Q    +  VWQ ++   A   GL+   CLA L  PV R  ++ +L+GL  E S
Sbjct  151  MFATISLQAAAKREHVWQAKLESTALMLGLVGNICLAFLFFPVARGSSILQLVGLTSEAS  210

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  211  IKYHIWLG  218



>ref|XP_006372444.1| ferric-chelate reductase family protein [Populus trichocarpa]
 gb|ERP50241.1| ferric-chelate reductase family protein [Populus trichocarpa]
Length=685

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 91/183 (50%), Gaps = 12/183 (7%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            GW+ LW++ PT+V+   W      K +++ F   G    +++FPV+  A  G +YL  +K
Sbjct  17   GWLMLWVMLPTKVYKNAWTPKLNGKLNSTYFEGQGTNLLLFSFPVMFIAAFGCLYLHLQK  76

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
              +K    R+          P +V + LGI++ +E+  V++FI  L W+    +   F  
Sbjct  77   NLRKPNSRRR----------PALVMAPLGIVTAMELAFVAMFIALLIWSLANYLYVSFGH  126

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
                K  +  VWQ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH 
Sbjct  127  LHMHKQGE-KVWQAKFRSVSLRLGYIGNICWAFLFFPVTRGSSILPLVGLTSESSIKYHI  185

Query  633  WLG  641
            WLG
Sbjct  186  WLG  188



>ref|XP_010462520.1| PREDICTED: probable ferric reduction oxidase 1 [Camelina sativa]
Length=695

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 100/188 (53%), Gaps = 7/188 (4%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWK-AAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G   +WI+ PT  + +    +   K   S++ G  G+   +Y FP+I  A +G +YL  K
Sbjct  20   GTTFIWIMMPTSTYKKILLLSIRAKLGKSIYYGKPGVNLLLYMFPMILLAFLGCIYLHLK  79

Query  270  KQKQKEGISRQERRC-LAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDF  446
            KQ     ++  E+R     L  P++VK  LGI++  E++ +++F+  + W+    I N F
Sbjct  80   KQTTVNQLNTGEKRDKFGVLRRPMLVKGPLGIVTVTEVMFLTMFMAHILWSLTNYIYNTF  139

Query  447  RKTVQTKDFKLA---VWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
              T+ ++   L    +WQ R+  +A R G++ + CLA L  PV R  ++   +G+  E S
Sbjct  140  -VTITSESAALDEEILWQARLELIAVRVGIVGDICLAFLFYPVARGSSLLAAVGITSESS  198

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  199  IKYHIWLG  206



>ref|XP_009621944.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=712

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 92/184 (50%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +W++ PT  + + W  A   A+ S F    G     +T P++  A++G +Y+  +K
Sbjct  34   GNLMMWVIMPTFTYYQKWVPALLAATNSTFFDIQGPIMMNFTLPILFIAVLGCIYVHLEK  93

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK     S   +  L  L  P I+K  LGI++ IE+  +++FII   W F   +   +  
Sbjct  94   QKSDSVTSYCNKDWLKVLKKPKIMKP-LGIVTWIELFFLAMFIILCVWYFSAFVYFHYST  152

Query  453  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                   K + VWQ R+ R+A   GL    CL  L  PV R  ++  LLGL  E S++YH
Sbjct  153  ITTYAATKGVQVWQARIDRLALVIGLTGNICLTFLFYPVSRGSSILPLLGLTSEGSIKYH  212

Query  630  TWLG  641
             WLG
Sbjct  213  IWLG  216



>gb|EYU32154.1| hypothetical protein MIMGU_mgv1a002115mg [Erythranthe guttata]
Length=711

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 62/186 (33%), Positives = 97/186 (52%), Gaps = 9/186 (5%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +WI+ PT  +   W      A+ S F G  G     +TFP++  AI+G +YL    
Sbjct  31   GNIMMWIIMPTDTYYNDWLLHILAATNSTFFGIQGPIMLDFTFPILFIAILGCLYLHLGN  90

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            + Q     R ++  L F + P+IVK  LGI++  E+  ++LFI    W F   I + F++
Sbjct  91   KLQPNFTPRDKK--LRFATKPMIVKG-LGIVTLTELALLTLFIALCVWYFADYIRHWFKQ  147

Query  453  TVQ---TKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
             +Q    KD KL  WQ ++ RV    G+    CL  +  PV R  ++  +LGL +E S++
Sbjct  148  ALQRSIDKDEKL--WQTKLDRVGIVTGVTGNLCLTFVFYPVTRSSSILPMLGLTYESSIK  205

Query  624  YHTWLG  641
            YH W+G
Sbjct  206  YHVWIG  211



>ref|XP_009621943.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=717

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 92/184 (50%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +W++ PT  + + W  A   A+ S F    G     +T P++  A++G +Y+  +K
Sbjct  34   GNLMMWVIMPTFTYYQKWVPALLAATNSTFFDIQGPIMMNFTLPILFIAVLGCIYVHLEK  93

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK     S   +  L  L  P I+K  LGI++ IE+  +++FII   W F   +   +  
Sbjct  94   QKSDSVTSYCNKDWLKVLKKPKIMKP-LGIVTWIELFFLAMFIILCVWYFSAFVYFHYST  152

Query  453  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                   K + VWQ R+ R+A   GL    CL  L  PV R  ++  LLGL  E S++YH
Sbjct  153  ITTYAATKGVQVWQARIDRLALVIGLTGNICLTFLFYPVSRGSSILPLLGLTSEGSIKYH  212

Query  630  TWLG  641
             WLG
Sbjct  213  IWLG  216



>ref|XP_008234904.1| PREDICTED: ferric reduction oxidase 2-like [Prunus mume]
Length=705

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 93/183 (51%), Gaps = 2/183 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT  +   W     +   ++ F   G    +Y FP++  A VG   L ++K
Sbjct  24   GYMMIWIMMPTNTFYLNWFPHILKNTDSTYFEKQGAEVLIYPFPILFIATVGCFLLHRRK  83

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            +K  E   R +    A    P++VK  LGI+S IE+  V + I  L W+  + + N F  
Sbjct  84   KKADENNQRVKSSFWASWKRPVLVKGPLGIVSWIELSFVVMAIALLVWSISSYLHNMF-A  142

Query  453  TVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHT  632
            T         VW+ ++  VA   GL+   CL+LL  PV R  ++ +L+GL  E S++YH 
Sbjct  143  TAHAGVKGEQVWETKLSIVALALGLVGNFCLSLLFFPVSRGSSILQLIGLTSEASIKYHI  202

Query  633  WLG  641
            WLG
Sbjct  203  WLG  205



>ref|XP_009800598.1| PREDICTED: ferric reduction oxidase 2-like isoform X1 [Nicotiana 
sylvestris]
Length=718

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 92/184 (50%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +W++ PT  + + W  A   A+ S F    G     +T P++  A++G +Y+  +K
Sbjct  35   GNLMMWVIMPTFTYYQKWVPALLAATNSTFFDIQGPIMMNFTLPILFIAVLGCIYVHLEK  94

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK     S   +  L  L  P I+K  LGI++ IE+  +++FII   W F   +   +  
Sbjct  95   QKSYSVTSYCNKDWLKVLKKPKIIKP-LGIVTWIELFFLAMFIILCVWYFSAFVYFHYST  153

Query  453  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                   K + VWQ R+ R+A   GL    CL  L  PV R  ++  LLGL  E S++YH
Sbjct  154  ITTYAATKGVQVWQARIDRLALVIGLTGNICLTFLFYPVSRGSSILPLLGLTSEGSIKYH  213

Query  630  TWLG  641
             WLG
Sbjct  214  IWLG  217



>ref|XP_009800599.1| PREDICTED: ferric reduction oxidase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=713

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 92/184 (50%), Gaps = 3/184 (2%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTWKAAEEKASASVF-GYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G + +W++ PT  + + W  A   A+ S F    G     +T P++  A++G +Y+  +K
Sbjct  35   GNLMMWVIMPTFTYYQKWVPALLAATNSTFFDIQGPIMMNFTLPILFIAVLGCIYVHLEK  94

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRK  452
            QK     S   +  L  L  P I+K  LGI++ IE+  +++FII   W F   +   +  
Sbjct  95   QKSYSVTSYCNKDWLKVLKKPKIIKP-LGIVTWIELFFLAMFIILCVWYFSAFVYFHYST  153

Query  453  TVQTKDFK-LAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
                   K + VWQ R+ R+A   GL    CL  L  PV R  ++  LLGL  E S++YH
Sbjct  154  ITTYAATKGVQVWQARIDRLALVIGLTGNICLTFLFYPVSRGSSILPLLGLTSEGSIKYH  213

Query  630  TWLG  641
             WLG
Sbjct  214  IWLG  217



>ref|XP_009612091.1| PREDICTED: ferric reduction oxidase 2-like [Nicotiana tomentosiformis]
Length=718

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 95/187 (51%), Gaps = 6/187 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            G+  + I+ PT ++   W  K     A+++ FG  G+   + TFP +  A++G +YL  +
Sbjct  35   GYFLVLIVSPTNMYYLIWTPKIKARAATSTYFGAQGMSLLLDTFPFLFIAVLGCIYLHLR  94

Query  270  KQKQKEGISRQE-RRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTF--YTRISN  440
            K+   +  +R E ++ LA    P+IVK  LGI++ IE+    +FI  L W++  Y   + 
Sbjct  95   KKSSDKNTNRVEGKQKLAIWRRPIIVK-GLGIVTRIELCFFVMFIALLVWSYASYLHAAF  153

Query  441  DFRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSV  620
             F       +    VW+ ++       GL+    L  L +PV R  +V +L GL  E SV
Sbjct  154  PFITPQSVAESGQKVWEVKLEEAGLMLGLVGNVVLTFLFVPVARGSSVLQLFGLTSEASV  213

Query  621  RYHTWLG  641
            +YH WLG
Sbjct  214  KYHIWLG  220



>gb|EYU25132.1| hypothetical protein MIMGU_mgv1a019178mg [Erythranthe guttata]
Length=694

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 92/186 (49%), Gaps = 5/186 (3%)
 Frame = +3

Query  87   VSTGWVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE  263
            V  G++ +WI+ PT+ ++ +W    E    ++ F    +   +++FP++  A +G VYL 
Sbjct  14   VFVGYIFMWIMLPTKTYSTSWTPKLEHHLKSTYFREQSINLVLFSFPMMLIAALGCVYLH  73

Query  264  QKKQKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
              K       S  +R    +L  P +V + LGI+S +E+   ++FI  L W+    +   
Sbjct  74   LHKASN----SDSKRSYYEWLKRPAVVNAPLGIVSFVELTFAAMFIALLIWSLANYLHVG  129

Query  444  FRKTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVR  623
            F+  +   +    +WQ +   VA     +   C+A L  PV R  ++  L+GL  E S++
Sbjct  130  FKTMLIYMNPGEKMWQAKFNTVALMLAYVGNTCMAFLFFPVTRGSSILPLVGLTLESSIK  189

Query  624  YHTWLG  641
            YH WLG
Sbjct  190  YHIWLG  195



>ref|XP_008376639.1| PREDICTED: ferric reduction oxidase 2-like [Malus domestica]
Length=720

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 94/184 (51%), Gaps = 2/184 (1%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW-KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQKK  272
            G++ +WI+ PT  +   W     +K  ++ FG  G    +YTFP++  A +G + L    
Sbjct  38   GYMMIWIIMPTNTYYLKWFPHIHKKTDSTYFGQEGADILIYTFPILFTATMGCLLLHTGN  97

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFR-  449
            +       R ++   A  +   +VK  LGI+S IE+  + +FI  L W+  + + + F  
Sbjct  98   KNVDINNQRAKKSYRASWNRXALVKGPLGIVSWIELSFLVMFIALLVWSISSYLHDMFAY  157

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
             T++    K  VW+ ++  VA   G++    LA L  PV R  ++ +++GL  E S++YH
Sbjct  158  ATLEAAAKKEHVWENKLGSVALTLGIVGNIGLAFLFFPVSRGSSILQIIGLTSEASIKYH  217

Query  630  TWLG  641
             WLG
Sbjct  218  IWLG  221



>ref|XP_010919103.1| PREDICTED: ferric reduction oxidase 2-like [Elaeis guineensis]
Length=673

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 87/181 (48%), Gaps = 9/181 (5%)
 Frame = +3

Query  108  LWILKPTQVWTRTWKAAEEKASASV-FGYNGLCFAVYTFPVIAFAIVGFV--YLEQKKQK  278
            +W++ PT+ + +TW+      + S  FG  G    ++TFP++  A VG +  +LEQK   
Sbjct  2    MWVVVPTRTYRKTWQPKLLSETNSTWFGRQGTTILIFTFPILFIAAVGCICLHLEQKSGN  61

Query  279  QKEGISRQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISNDFRKTV  458
               G     RR L     P++VK  LGI+S IE+     F+  L W F   +S       
Sbjct  62   AHSG---SLRRRLEAWRKPVLVKGPLGIVSAIELAFCLKFLALLIWAFSNYVSVGL---A  115

Query  459  QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYHTWL  638
              K      WQ ++  V    GL+   C A L  PV R  ++  L+GL  E S+RYH WL
Sbjct  116  NLKAEGAESWQAKLGTVGVMLGLVGNICCAFLFFPVARGSSLLPLVGLTSEASIRYHVWL  175

Query  639  G  641
            G
Sbjct  176  G  176



>ref|XP_007135107.1| hypothetical protein PHAVU_010G101500g [Phaseolus vulgaris]
 gb|ESW07101.1| hypothetical protein PHAVU_010G101500g [Phaseolus vulgaris]
Length=718

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 92/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  96   GWVSLWILKPTQVWTRTW--KAAEEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLEQK  269
            GW+ +W++ PT  +   W  K   +  + +  G  G    +YTFP++  A +G VYL   
Sbjct  33   GWIFIWVMSPTNTYRERWLPKYRAKTNTTTYLGSKGSNLLMYTFPILLIATLGCVYLHIT  92

Query  270  KQKQKEGIS--RQERRCLAFLSNPLIVKSSLGILSGIEILGVSLFIIFLAWTFYTRISND  443
            K+     +     ++  +A    P+++K  LGI+SG E+    +FI  L W+F   + N 
Sbjct  93   KKTNDSTMESCNSKKHKVAIWKRPVLIKGPLGIVSGTELAFFLMFIALLVWSFAATLRNK  152

Query  444  FRKTV--QTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVS  617
            F K       +    +WQ ++   A  FG++   CL  +  PV R  ++  LLGL  E  
Sbjct  153  FAKVTPESAAEDGHNIWQEKVDITALMFGVVGNICLVFMFFPVARGSSLLPLLGLTSESC  212

Query  618  VRYHTWLG  641
            ++YH WLG
Sbjct  213  IKYHIWLG  220



>ref|XP_004140754.1| PREDICTED: ferric reduction oxidase 4-like [Cucumis sativus]
Length=697

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 97/184 (53%), Gaps = 5/184 (3%)
 Frame = +3

Query  99   WVSLWILKPTQVWTRTWKAA-EEKASASVFGYNGLCFAVYTFPVIAFAIVGFVYLE-QKK  272
            W+ LWI+ PT+++   W        +++ F   G    +++FP++  A++G  YL  QKK
Sbjct  18   WLWLWIMLPTKLYKNYWTPKLNMNLNSTFFREQGTNLLLFSFPIMLMAVLGCFYLHFQKK  77

Query  273  QKQKEGISRQERRCLAFLSNPLIVKSSLGILSGIEIL-GVSLFIIFLAWTFYTRISNDFR  449
              + +      +R  +FL  P++V + LGI++ +EI+ GVS F++ L W+    +   F 
Sbjct  78   SSELDPKPFSTQRGESFLKRPVVVMNPLGIVNTLEIMFGVS-FLLLLIWSLGNYLYVSFG  136

Query  450  KTVQTKDFKLAVWQYRMLRVATRFGllteaclallllpvlRRMAVFRLLGLQFEVSVRYH  629
              +   +    +W+ +   V+ R G +   C A L  PV R  ++  L+GL  E S++YH
Sbjct  137  H-LHRDNVGETIWELKFRSVSLRVGYIGNICWAFLFFPVTRGSSLLPLIGLTSESSIKYH  195

Query  630  TWLG  641
             WLG
Sbjct  196  IWLG  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250