BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030M14

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg                111   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_003536498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    110   4e-24   Glycine max [soybeans]
gb|KHN02770.1|  DEAD-box ATP-dependent RNA helicase 7                   110   4e-24   Glycine soja [wild soybean]
ref|XP_003556075.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   1e-23   Glycine max [soybeans]
gb|KHN15708.1|  DEAD-box ATP-dependent RNA helicase 7                   109   1e-23   Glycine soja [wild soybean]
tpg|DAA40575.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    108   3e-23   
ref|XP_008670328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   4e-23   Zea mays [maize]
gb|EYU25021.1|  hypothetical protein MIMGU_mgv1a027128mg                107   5e-23   Erythranthe guttata [common monkey flower]
ref|XP_006357902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    107   5e-23   Solanum tuberosum [potatoes]
gb|EPS64456.1|  hypothetical protein M569_10323                         107   6e-23   Genlisea aurea
ref|XP_004240751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    107   7e-23   Solanum lycopersicum
ref|XP_009587639.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    107   9e-23   Nicotiana tomentosiformis
ref|XP_009767597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    106   1e-22   Nicotiana sylvestris
gb|EAZ09787.1|  hypothetical protein OsI_32075                          105   2e-22   Oryza sativa Indica Group [Indian rice]
gb|KDO65345.1|  hypothetical protein CISIN_1g005470mg                   104   2e-22   Citrus sinensis [apfelsine]
ref|XP_006660856.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   3e-22   Oryza brachyantha
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   3e-22   Brachypodium distachyon [annual false brome]
ref|XP_004957391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   3e-22   Setaria italica
ref|XP_002460541.1|  hypothetical protein SORBIDRAFT_02g030210          105   3e-22   Sorghum bicolor [broomcorn]
gb|KDO65346.1|  hypothetical protein CISIN_1g005470mg                   104   3e-22   Citrus sinensis [apfelsine]
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396             105   3e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_011076505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   3e-22   
gb|ACF80743.1|  unknown                                                 103   4e-22   Zea mays [maize]
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                   104   4e-22   Citrus sinensis [apfelsine]
ref|XP_011101144.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   5e-22   Sesamum indicum [beniseed]
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                   104   6e-22   Citrus sinensis [apfelsine]
ref|XP_010275981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   6e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg             104   6e-22   Citrus clementina [clementine]
ref|XP_002269873.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   6e-22   Vitis vinifera
gb|KJB39373.1|  hypothetical protein B456_007G009400                    103   7e-22   Gossypium raimondii
gb|KJB39371.1|  hypothetical protein B456_007G009400                    103   7e-22   Gossypium raimondii
ref|XP_008652955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   1e-21   Zea mays [maize]
gb|KJB39369.1|  hypothetical protein B456_007G009400                    103   1e-21   Gossypium raimondii
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                   103   1e-21   Gossypium arboreum [tree cotton]
gb|KJB39370.1|  hypothetical protein B456_007G009400                    103   1e-21   Gossypium raimondii
ref|XP_008652953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   1e-21   Zea mays [maize]
ref|XP_010940916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   1e-21   Elaeis guineensis
ref|XP_008652954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   1e-21   
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                   103   1e-21   Gossypium arboreum [tree cotton]
emb|CDP05280.1|  unnamed protein product                                103   2e-21   Coffea canephora [robusta coffee]
ref|XP_004506292.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   2e-21   Cicer arietinum [garbanzo]
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg             102   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_004496645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   2e-21   
ref|XP_002318863.2|  DEAD box RNA helicase family protein               102   3e-21   
ref|XP_011030003.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   3e-21   Populus euphratica
ref|XP_004496646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   3e-21   Cicer arietinum [garbanzo]
gb|EAZ45398.1|  hypothetical protein OsJ_30047                          102   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063702.1|  Os09g0520700                                       102   3e-21   
ref|XP_001764376.1|  predicted protein                                  102   3e-21   
ref|XP_004308148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   3e-21   Fragaria vesca subsp. vesca
sp|Q41382.1|RH7_SPIOL  RecName: Full=DEAD-box ATP-dependent RNA h...    102   4e-21   Spinacia oleracea
ref|XP_002510890.1|  dead box ATP-dependent RNA helicase, putative      101   5e-21   Ricinus communis
ref|XP_007038495.1|  DEAD-box ATP-dependent RNA helicase 7              102   8e-21   
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7              101   8e-21   Morus notabilis
ref|XP_007143335.1|  hypothetical protein PHAVU_007G063700g             101   8e-21   Phaseolus vulgaris [French bean]
ref|XP_009407947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   9e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP22369.1|  hypothetical protein JCGZ_26200                         100   1e-20   Jatropha curcas
ref|XP_009628542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   1e-20   
ref|XP_009628541.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   1e-20   Nicotiana tomentosiformis
ref|XP_008812489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Phoenix dactylifera
ref|XP_009349718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009343503.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Pyrus x bretschneideri [bai li]
gb|KFK27951.1|  hypothetical protein AALP_AA8G452500                    100   2e-20   Arabis alpina [alpine rockcress]
ref|XP_008234340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Prunus mume [ume]
ref|XP_007220217.1|  hypothetical protein PRUPE_ppa002304mg             100   2e-20   Prunus persica
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                      100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Cucumis melo [Oriental melon]
ref|XP_009781160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   2e-20   Nicotiana sylvestris
emb|CAA68194.1|  RNA helicase                                           100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003592391.1|  DEAD-box ATP-dependent RNA helicase              99.8    2e-20   Medicago truncatula
ref|XP_008376504.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    2e-20   Malus domestica [apple tree]
ref|XP_009398738.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348047.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    3e-20   Solanum tuberosum [potatoes]
ref|XP_004234150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    3e-20   Solanum lycopersicum
ref|XP_009130201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.0    4e-20   Brassica rapa
ref|XP_006858006.1|  hypothetical protein AMTR_s00069p00191130        99.4    4e-20   Amborella trichopoda
ref|XP_010934579.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.0    4e-20   Elaeis guineensis
gb|AAF40306.1|AF156667_1  RNA helicase                                98.6    6e-20   Vigna radiata [mung bean]
gb|KJB52899.1|  hypothetical protein B456_008G282800                  98.6    6e-20   Gossypium raimondii
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.6    6e-20   Camelina sativa [gold-of-pleasure]
gb|KJB52898.1|  hypothetical protein B456_008G282800                  98.6    7e-20   Gossypium raimondii
gb|EMT03655.1|  DEAD-box ATP-dependent RNA helicase 7                 98.6    7e-20   
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.6    7e-20   Eucalyptus grandis [rose gum]
ref|XP_002322430.2|  DEAD box RNA helicase family protein             98.2    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.2    8e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.2    8e-20   Camelina sativa [gold-of-pleasure]
gb|KEH26427.1|  DEAD-box ATP-dependent RNA helicase                   98.2    8e-20   Medicago truncatula
ref|XP_011041667.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.2    8e-20   Populus euphratica
ref|XP_008364874.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.2    9e-20   
gb|AAK62631.1|  AT5g62190/mmi9_10                                     97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87236.1|  BnaC09g05510D                                        97.4    1e-19   
ref|XP_009112011.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  97.4    2e-19   Brassica rapa
emb|CDY16789.1|  BnaA09g05930D                                        97.1    2e-19   Brassica napus [oilseed rape]
ref|XP_010693660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.1    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009345013.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.1    2e-19   
ref|XP_004172086.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.3    4e-19   
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg           96.3    4e-19   Capsella rubella
ref|XP_004143712.1|  PREDICTED: uncharacterized protein LOC101209696  96.3    6e-19   
ref|XP_010555319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.6    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370           92.8    6e-18   
ref|XP_009346936.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.2    6e-18   
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027           92.4    7e-18   
ref|XP_010059508.1|  PREDICTED: nucleolar RNA helicase 2-like         90.1    3e-17   
ref|XP_010068038.1|  PREDICTED: acetyl-coenzyme A synthetase, chl...  85.1    4e-16   
ref|XP_005854803.1|  dead deah box rna                                86.7    7e-16   Nannochloropsis gaditana CCMP526
gb|KJB39372.1|  hypothetical protein B456_007G009400                  85.9    1e-15   Gossypium raimondii
ref|XP_005645158.1|  DEAD-domain-containing protein                   85.5    1e-15   Coccomyxa subellipsoidea C-169
gb|ETK72184.1|  hypothetical protein L915_20663                       82.4    2e-15   Phytophthora parasitica
gb|EMS52016.1|  DEAD-box ATP-dependent RNA helicase 7                 85.5    2e-15   Triticum urartu
ref|XP_008914911.1|  hypothetical protein PPTG_18629                  84.7    3e-15   Phytophthora parasitica INRA-310
gb|EWM21167.1|  dead deah box rna                                     83.6    8e-15   Nannochloropsis gaditana
gb|ETP29814.1|  hypothetical protein F442_21078                       83.2    1e-14   Phytophthora parasitica P10297
gb|ETI31844.1|  hypothetical protein F443_21248                       82.8    1e-14   Phytophthora parasitica P1569
ref|XP_010938270.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    1e-14   Elaeis guineensis
ref|XP_002904811.1|  DEAD/DEAH box RNA helicase, putative             81.6    3e-14   Phytophthora infestans T30-4
ref|XP_011399479.1|  DEAD-box ATP-dependent RNA helicase 7            81.3    5e-14   Auxenochlorella protothecoides
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835            80.1    8e-14   Chlorella variabilis
ref|XP_003058076.1|  predicted protein                                80.5    9e-14   Micromonas pusilla CCMP1545
ref|XP_001417262.1|  predicted protein                                79.0    2e-13   Ostreococcus lucimarinus CCE9901
emb|CEP17128.1|  hypothetical protein                                 78.2    5e-13   Parasitella parasitica
ref|XP_002507890.1|  predicted protein                                77.0    9e-13   Micromonas commoda
ref|XP_009837773.1|  hypothetical protein H257_12310                  76.6    1e-12   Aphanomyces astaci
emb|CDS09503.1|  hypothetical protein LRAMOSA10863                    76.6    1e-12   Lichtheimia ramosa
ref|XP_004300425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  74.7    2e-12   Fragaria vesca subsp. vesca
dbj|GAN03042.1|  nucleolar RNA helicase 2-like isoform X2             75.9    3e-12   Mucor ambiguus
gb|EPB89647.1|  hypothetical protein HMPREF1544_03579                 75.5    3e-12   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH59679.1|  nucleolar rna helicase 2-like                        75.5    3e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007512398.1|  predicted protein                                75.1    4e-12   Bathycoccus prasinos
ref|XP_003078811.1|  putative RNA helicase (ISS)                      75.1    4e-12   Ostreococcus tauri
emb|CEG79803.1|  hypothetical protein RMATCC62417_14224               73.9    7e-12   Rhizopus microsporus
ref|XP_008873274.1|  hypothetical protein H310_09087                  74.3    7e-12   Aphanomyces invadans
gb|EIE87311.1|  hypothetical protein RO3G_12022                       73.9    1e-11   Rhizopus delemar RA 99-880
emb|CBK20101.2|  unnamed protein product                              73.2    1e-11   Blastocystis hominis
emb|CEI86541.1|  hypothetical protein RMCBS344292_00980               73.6    1e-11   Rhizopus microsporus
emb|CEG65973.1|  hypothetical protein RMATCC62417_02639               73.2    2e-11   Rhizopus microsporus
ref|XP_005838835.1|  hypothetical protein GUITHDRAFT_102470           71.6    6e-11   Guillardia theta CCMP2712
ref|XP_007054740.1|  PREDICTED: nucleolar RNA helicase 2-like         71.2    7e-11   
ref|XP_009496395.1|  hypothetical protein H696_04240                  71.2    7e-11   Fonticula alba
emb|CCA17723.1|  DEAD/DEAH box RNA helicase putative                  71.2    8e-11   Albugo laibachii Nc14
ref|XP_006273547.1|  PREDICTED: nucleolar RNA helicase 2-like         70.9    9e-11   Alligator mississippiensis
gb|EMP40574.1|  Nucleolar RNA helicase 2                              71.2    9e-11   Chelonia mydas [green seaturtle]
ref|XP_006630629.1|  PREDICTED: nucleolar RNA helicase 2-like         70.9    1e-10   Lepisosteus oculatus
ref|XP_005297367.1|  PREDICTED: nucleolar RNA helicase 2              70.5    1e-10   
ref|XP_010887236.1|  PREDICTED: nucleolar RNA helicase 2-like         70.5    1e-10   Esox lucius
ref|XP_009520796.1|  hypothetical protein PHYSODRAFT_326516           70.1    2e-10   Phytophthora sojae
ref|XP_002112077.1|  hypothetical protein TRIADDRAFT_55752            70.1    2e-10   Trichoplax adhaerens
ref|XP_006820781.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  69.7    2e-10   Saccoglossus kowalevskii
ref|XP_002738237.2|  PREDICTED: nucleolar RNA helicase 2-like iso...  69.7    2e-10   Saccoglossus kowalevskii
ref|XP_005815128.1|  PREDICTED: nucleolar RNA helicase 2-like         69.7    2e-10   Xiphophorus maculatus
ref|XP_002502509.1|  DEAD/DEAH box RNA helicase                       69.7    2e-10   Micromonas commoda
ref|XP_010789411.1|  PREDICTED: nucleolar RNA helicase 2-like         67.8    3e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011406566.1|  PREDICTED: ATP-dependent RNA helicase DDX50-...  68.6    3e-10   
emb|CDQ75565.1|  unnamed protein product                              69.3    3e-10   Oncorhynchus mykiss
gb|ACH85363.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             69.3    3e-10   Salmo salar
emb|CEI94647.1|  hypothetical protein RMCBS344292_08852               69.3    3e-10   Rhizopus microsporus
gb|KDO19871.1|  hypothetical protein SPRG_14901                       69.3    3e-10   Saprolegnia parasitica CBS 223.65
ref|XP_008611506.1|  hypothetical protein SDRG_07451                  69.3    3e-10   Saprolegnia diclina VS20
ref|XP_006125341.1|  PREDICTED: nucleolar RNA helicase 2              69.3    3e-10   
ref|XP_003056927.1|  DEAD/DEAH box RNA helicase                       69.3    4e-10   Micromonas pusilla CCMP1545
ref|NP_001120807.1|  nucleolar RNA helicase 2                         69.3    4e-10   
ref|XP_006023203.1|  PREDICTED: nucleolar RNA helicase 2-like         68.9    4e-10   
ref|XP_008364905.1|  PREDICTED: uncharacterized protein LOC103428569  65.9    5e-10   
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087            68.6    6e-10   Volvox carteri f. nagariensis
ref|XP_007549868.1|  PREDICTED: nucleolar RNA helicase 2-like         68.6    6e-10   Poecilia formosa
ref|XP_005733301.1|  PREDICTED: nucleolar RNA helicase 2-like         68.2    7e-10   Pundamilia nyererei
ref|XP_005467227.1|  PREDICTED: nucleolar RNA helicase 2-like         68.2    7e-10   
ref|XP_005915179.1|  PREDICTED: nucleolar RNA helicase 2-like         68.2    8e-10   Haplochromis burtoni
ref|XP_004539930.1|  PREDICTED: nucleolar RNA helicase 2-like         68.2    8e-10   
ref|XP_008290699.1|  PREDICTED: nucleolar RNA helicase 2-like         67.8    9e-10   Stegastes partitus
ref|XP_001702450.1|  RNA helicase                                     67.8    9e-10   Chlamydomonas reinhardtii
ref|XP_004334405.1|  DEAD/DEAH box helicase domain containing pro...  67.8    1e-09   Acanthamoeba castellanii str. Neff
ref|XP_006780037.1|  PREDICTED: nucleolar RNA helicase 2-like         67.8    1e-09   Neolamprologus brichardi [lyretail cichlid]
ref|XP_009309382.1|  putative nucleolar RNA helicase II               67.4    1e-09   Trypanosoma grayi
ref|XP_005708224.1|  ATP-dependent RNA helicase                       67.4    2e-09   Galdieria sulphuraria
ref|XP_007253242.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  67.0    2e-09   
ref|XP_006406182.1|  hypothetical protein EUTSA_v10020290mg           66.6    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_007253243.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  67.0    2e-09   
ref|XP_010753600.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  67.0    2e-09   
ref|XP_003079318.1|  ATP-dependent RNA helicase (ISS)                 66.6    2e-09   
emb|CEF97957.1|  Helicase, C-terminal                                 66.6    2e-09   Ostreococcus tauri
emb|CDY46329.1|  BnaC01g31630D                                        66.6    2e-09   Brassica napus [oilseed rape]
emb|CCI44343.1|  unnamed protein product                              66.2    3e-09   Albugo candida
ref|XP_002883355.1|  hypothetical protein ARALYDRAFT_479746           66.2    3e-09   
ref|NP_188872.2|  putative mitochondrial RNA helicase 2               66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003976441.1|  PREDICTED: nucleolar RNA helicase 2-like         66.2    3e-09   
gb|KFH66922.1|  hypothetical protein MVEG_07447                       66.2    3e-09   Mortierella verticillata NRRL 6337
ref|XP_006297190.1|  hypothetical protein CARUB_v10013195mg           66.2    3e-09   Capsella rubella
ref|XP_009145390.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    3e-09   Brassica rapa
emb|CDY10634.1|  BnaA05g17280D                                        65.9    4e-09   Brassica napus [oilseed rape]
ref|XP_786504.3|  PREDICTED: nucleolar RNA helicase 2-like            65.9    4e-09   
ref|XP_010511255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010511251.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010488258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010488257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011490446.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  65.5    6e-09   
ref|XP_004067286.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  65.5    6e-09   
ref|XP_006297246.1|  hypothetical protein CARUB_v10013251mg           65.1    7e-09   Capsella rubella
ref|XP_009035969.1|  hypothetical protein AURANDRAFT_895              65.1    7e-09   Aureococcus anophagefferens
gb|KFK39521.1|  hypothetical protein AALP_AA3G255300                  65.1    8e-09   Arabis alpina [alpine rockcress]
ref|XP_010488255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.7    8e-09   
ref|XP_009108947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.7    8e-09   Brassica rapa
ref|XP_010488254.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.7    9e-09   Camelina sativa [gold-of-pleasure]
emb|CAD98303.1|  DEAD/DEAH box helicase, possible                     64.7    9e-09   Cryptosporidium parvum
ref|XP_666695.1|  DEAD/DEAH box helicase                              64.7    9e-09   Cryptosporidium hominis TU502
ref|XP_009919521.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    9e-09   Haliaeetus albicilla
gb|EFB22545.1|  hypothetical protein PANDA_001614                     64.7    9e-09   Ailuropoda melanoleuca
ref|XP_627813.1|  nucleolar protein GU2. eIF4A-1-family. RNA SFII...  64.7    1e-08   Cryptosporidium parvum Iowa II
emb|CBJ26838.1|  DEAD box helicase                                    64.7    1e-08   Ectocarpus siliculosus
ref|XP_002913778.1|  PREDICTED: nucleolar RNA helicase 2              64.7    1e-08   Ailuropoda melanoleuca
ref|XP_010295282.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Phaethon lepturus
ref|XP_005235246.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Falco peregrinus [peregrine]
ref|XP_005433605.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   
ref|XP_007054739.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   
ref|XP_010466510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|NP_188870.1|  DEAD-box ATP-dependent RNA helicase                 64.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004344972.1|  nucleolar RNA helicase 2                         64.3    1e-08   Capsaspora owczarzaki ATCC 30864
ref|XP_005297366.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Chrysemys picta bellii
gb|EPY22928.1|  nucleolar RNA helicase II                             63.9    2e-08   Strigomonas culicis
ref|XP_009064553.1|  hypothetical protein LOTGIDRAFT_221850           63.9    2e-08   Lottia gigantea
ref|XP_010466515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_845112.1|  nucleolar RNA helicase II                           63.9    2e-08   Trypanosoma brucei brucei TREU927
ref|XP_010466514.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010466512.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002130533.1|  PREDICTED: nucleolar RNA helicase 2              63.9    2e-08   Ciona intestinalis [sea vase]
ref|XP_002461445.1|  hypothetical protein SORBIDRAFT_02g002790        63.5    2e-08   Sorghum bicolor [broomcorn]
ref|XP_009993187.1|  PREDICTED: nucleolar RNA helicase 2-like         63.9    2e-08   Chaetura pelagica
ref|XP_011449590.1|  PREDICTED: nucleolar RNA helicase 2-like         63.9    2e-08   
gb|KCW88483.1|  hypothetical protein EUGRSUZ_A00875                   63.5    2e-08   Eucalyptus grandis [rose gum]
gb|ERZ97705.1|  hypothetical protein GLOINDRAFT_340006                63.9    2e-08   
ref|XP_007514064.1|  predicted protein                                63.9    2e-08   Bathycoccus prasinos
ref|XP_006676381.1|  hypothetical protein BATDEDRAFT_84954            63.5    2e-08   Batrachochytrium dendrobatidis JAM81
ref|XP_009487807.1|  PREDICTED: nucleolar RNA helicase 2-like         63.5    2e-08   Pelecanus crispus
ref|XP_010511242.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008943828.1|  PREDICTED: nucleolar RNA helicase 2-like         63.5    2e-08   Merops nubicus
ref|XP_002883354.1|  hypothetical protein ARALYDRAFT_479744           63.5    2e-08   
ref|XP_010164383.1|  PREDICTED: nucleolar RNA helicase 2-like         63.5    2e-08   
ref|XP_007902730.1|  PREDICTED: nucleolar RNA helicase 2-like         63.5    2e-08   Callorhinchus milii [Australian ghost shark]
ref|XP_009581978.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    2e-08   Fulmarus glacialis
ref|XP_009674650.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   Struthio camelus australis
ref|XP_010073942.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   Pterocles gutturalis
gb|EDL92964.1|  rCG22008, isoform CRA_a                               62.4    3e-08   Rattus norvegicus [brown rat]
ref|XP_004992590.1|  DEAD box polypeptide 47 isoform 1                63.2    3e-08   Salpingoeca rosetta
ref|XP_005713628.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...  63.2    3e-08   Chondrus crispus [carageen]
ref|XP_008924427.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   
ref|XP_006380943.1|  hypothetical protein POPTR_0006s02500g           63.2    3e-08   Populus trichocarpa [western balsam poplar]
emb|CDY37406.1|  BnaC05g30240D                                        62.8    3e-08   Brassica napus [oilseed rape]
ref|XP_009990339.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   Tauraco erythrolophus
emb|CDY37408.1|  BnaC05g30220D                                        63.2    3e-08   Brassica napus [oilseed rape]
ref|XP_009288813.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   
ref|XP_009324263.1|  PREDICTED: nucleolar RNA helicase 2-like         63.2    3e-08   Pygoscelis adeliae
ref|XP_011004482.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   Populus euphratica
ref|XP_011040644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    4e-08   Populus euphratica
ref|XP_002308835.2|  hypothetical protein POPTR_0006s02500g           62.8    4e-08   
ref|XP_005842380.1|  hypothetical protein GUITHDRAFT_57670            62.8    4e-08   Guillardia theta CCMP2712
ref|XP_010153144.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Eurypyga helias
ref|XP_009703721.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Cariama cristata
ref|XP_010578315.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Haliaeetus leucocephalus
ref|XP_008308798.1|  PREDICTED: nucleolar RNA helicase 2              62.8    4e-08   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EOB09008.1|  Nucleolar RNA helicase 2                              62.8    4e-08   Anas platyrhynchos [duck]
ref|XP_009892318.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Charadrius vociferus
ref|XP_005009180.1|  PREDICTED: nucleolar RNA helicase 2              62.8    4e-08   
gb|ELU03439.1|  hypothetical protein CAPTEDRAFT_52524                 62.8    4e-08   Capitella teleta
ref|XP_009865080.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Apaloderma vittatum
ref|XP_010158185.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Eurypyga helias
ref|XP_009892319.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   Charadrius vociferus
ref|XP_009094282.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    5e-08   
ref|XP_009464338.1|  PREDICTED: nucleolar RNA helicase 2-like         62.4    5e-08   Nipponia nippon
ref|XP_009949129.1|  PREDICTED: nucleolar RNA helicase 2-like         62.4    5e-08   Leptosomus discolor
ref|XP_005491116.1|  PREDICTED: nucleolar RNA helicase 2-like         62.4    5e-08   
ref|XP_004386445.1|  PREDICTED: nucleolar RNA helicase 2              62.4    5e-08   Trichechus manatus latirostris
gb|KFK39522.1|  hypothetical protein AALP_AA3G255500                  62.4    5e-08   Arabis alpina [alpine rockcress]
ref|XP_005429044.1|  PREDICTED: nucleolar RNA helicase 2-like         62.4    6e-08   Geospiza fortis
gb|ERE87186.1|  nucleolar RNA helicase 2-like protein                 62.4    6e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_001519340.2|  PREDICTED: nucleolar RNA helicase 2              62.4    6e-08   
ref|XP_003409350.1|  PREDICTED: nucleolar RNA helicase 2              62.4    6e-08   Loxodonta africana [African bush elephant]
gb|KIY95427.1|  DEAD-box ATP-dependent RNA helicase 7                 60.8    6e-08   Monoraphidium neglectum
ref|WP_037630327.1|  RNA helicase                                     58.5    6e-08   Streptomyces albidoflavus
ref|XP_009635263.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    6e-08   Egretta garzetta
ref|XP_006351994.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   Solanum tuberosum [potatoes]
ref|XP_007638831.1|  PREDICTED: nucleolar RNA helicase 2              62.4    6e-08   
ref|XP_009962090.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    6e-08   
ref|XP_006351993.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   
ref|XP_006351991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   
ref|XP_005153742.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    6e-08   
ref|XP_004251555.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    7e-08   
gb|EGV93789.1|  Nucleolar RNA helicase 2                              62.0    7e-08   
ref|XP_006889064.1|  PREDICTED: nucleolar RNA helicase 2              62.0    7e-08   
ref|XP_010197456.1|  PREDICTED: nucleolar RNA helicase 2-like         61.6    7e-08   
ref|XP_008641092.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    7e-08   
ref|XP_006972790.1|  PREDICTED: nucleolar RNA helicase 2              62.0    7e-08   
ref|XP_005990005.1|  PREDICTED: nucleolar RNA helicase 2              62.0    7e-08   
ref|XP_010011653.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    7e-08   
ref|XP_010399212.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    7e-08   
ref|WP_037701325.1|  DEAD/DEAH box helicase                           61.6    7e-08   
gb|EUD73152.1|  adenosinetriphosphatase                               62.0    8e-08   
ref|XP_001762375.1|  predicted protein                                62.0    8e-08   
ref|XP_010132216.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    8e-08   
ref|XP_010168437.1|  PREDICTED: nucleolar RNA helicase 2-like         62.0    8e-08   
gb|KEH33609.1|  DEAD-box ATP-dependent RNA helicase-like protein      61.6    8e-08   
ref|XP_005005365.1|  PREDICTED: nucleolar RNA helicase 2              62.0    8e-08   
gb|KEH33610.1|  DEAD-box ATP-dependent RNA helicase-like protein      61.6    8e-08   
ref|XP_008830862.1|  PREDICTED: nucleolar RNA helicase 2              62.0    8e-08   
ref|WP_013170431.1|  DNA helicase                                     61.6    8e-08   
ref|XP_004470594.1|  PREDICTED: nucleolar RNA helicase 2              61.6    8e-08   
ref|XP_010323935.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  61.6    8e-08   
ref|XP_007048882.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...  61.6    9e-08   
ref|XP_007423216.1|  PREDICTED: nucleolar RNA helicase 2              61.6    9e-08   
ref|XP_009814524.1|  PREDICTED: nucleolar RNA helicase 2-like         61.6    9e-08   
emb|CDP16079.1|  unnamed protein product                              61.6    9e-08   
ref|NP_001032278.1|  nucleolar RNA helicase 2                         61.6    9e-08   
ref|XP_004624414.1|  PREDICTED: nucleolar RNA helicase 2              61.6    9e-08   
ref|XP_008771332.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  61.6    9e-08   
ref|XP_010578254.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  61.6    9e-08   
ref|XP_008756606.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  61.6    9e-08   
ref|XP_009591168.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    9e-08   
ref|XP_009695874.1|  PREDICTED: nucleolar RNA helicase 2-like         61.6    9e-08   
gb|EPY83760.1|  hypothetical protein CB1_000533042                    62.0    9e-08   
ref|XP_010578253.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  61.6    1e-07   
gb|AAH59237.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             61.6    1e-07   
dbj|BAE26522.1|  unnamed protein product                              61.6    1e-07   
gb|EDL92966.1|  rCG22008, isoform CRA_c                               61.6    1e-07   
dbj|BAB26817.2|  unnamed protein product                              61.6    1e-07   
gb|AAF61690.1|AF220365_1  nucleolar RNA helicase II/Gu                61.6    1e-07   
ref|XP_007938866.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
ref|XP_008694185.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
ref|NP_062426.2|  nucleolar RNA helicase 2                            61.6    1e-07   
gb|AAD43959.3|AF159131_1  nucleolar RNA helicase II/Gu                61.6    1e-07   
ref|XP_004701442.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
ref|XP_004888573.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
gb|ESL05810.1|  nucleolar RNA helicase II                             61.2    1e-07   
gb|EPQ14283.1|  Nucleolar RNA helicase 2                              61.6    1e-07   
ref|XP_009324264.1|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_007505939.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
gb|ETE62473.1|  Nucleolar RNA helicase 2                              61.6    1e-07   
gb|ESL06796.1|  nucleolar RNA helicase II                             61.2    1e-07   
emb|CCC48181.1|  putative nucleolar RNA helicase II, fragment         61.2    1e-07   
ref|XP_006835901.1|  PREDICTED: nucleolar RNA helicase 2              61.6    1e-07   
gb|AAH30895.1|  Ddx21 protein                                         61.2    1e-07   
ref|XP_004769606.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   61.2    1e-07   
ref|XP_007048884.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...  61.2    1e-07   
ref|XP_005360167.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_005530587.1|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_005390158.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   61.2    1e-07   
sp|Q0D8N0.2|RH53_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  61.2    1e-07   
ref|XP_004769607.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   61.2    1e-07   
ref|XP_002167654.2|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_005390157.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   61.2    1e-07   
ref|XP_009082858.1|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_002954582.1|  hypothetical protein VOLCADRAFT_82854            60.8    1e-07   
ref|XP_004617168.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_005907396.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_010221060.1|  PREDICTED: uncharacterized protein LOC104575417  61.2    1e-07   
ref|XP_009905459.1|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_003755081.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
gb|ELR47909.1|  Nucleolar RNA helicase 2                              61.2    1e-07   
ref|XP_007146300.1|  hypothetical protein PHAVU_006G028900g           61.2    1e-07   
gb|EPY37911.1|  nucleolar RNA helicase II                             61.2    1e-07   
ref|XP_005876873.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   61.2    1e-07   
ref|XP_006212998.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_005326022.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_001917975.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_010113956.1|  PREDICTED: nucleolar RNA helicase 2-like         61.2    1e-07   
ref|XP_006181277.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_010984125.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_004583494.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_006105393.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   61.2    1e-07   
ref|XP_006760985.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_004326963.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_008143728.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_006915628.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_007454639.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_007167837.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_001232052.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_005657444.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   
ref|XP_010297376.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    1e-07   
ref|XP_006105394.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   61.2    2e-07   
ref|XP_011370452.1|  PREDICTED: nucleolar RNA helicase 2              61.2    2e-07   
gb|EPY43380.1|  nucleolar RNA helicase II                             60.8    2e-07   
ref|XP_005876874.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   61.2    2e-07   
ref|NP_001263383.1|  nucleolar RNA helicase 2                         61.2    2e-07   
ref|XP_010850502.1|  PREDICTED: nucleolar RNA helicase 2              61.2    2e-07   
ref|XP_007121104.1|  PREDICTED: nucleolar RNA helicase 2              61.2    2e-07   
emb|CCI10877.1|  unnamed protein product                              60.8    2e-07   
ref|XP_005978742.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_006060385.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_002190981.2|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
gb|KHG04586.1|  DEAD-box ATP-dependent RNA helicase 53 -like protein  60.8    2e-07   
ref|XP_004280850.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_005154050.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
ref|XP_009563565.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
ref|XP_004337325.1|  DEAD/DEAH box helicase domain containing pro...  60.8    2e-07   
emb|CCD17000.1|  unnamed protein product                              60.8    2e-07   
emb|CCC90744.1|  putative nucleolar RNA helicase II                   60.8    2e-07   
ref|NP_001076996.1|  nucleolar RNA helicase 2                         60.8    2e-07   
ref|XP_005699183.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_009771005.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   
ref|XP_005070876.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   60.8    2e-07   
ref|XP_004427105.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_005070877.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   60.8    2e-07   
ref|XP_010074102.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
gb|EPY25966.1|  nucleolar RNA helicase II                             60.8    2e-07   
ref|XP_005048019.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
ref|XP_005825225.1|  hypothetical protein GUITHDRAFT_158516           60.5    2e-07   
ref|XP_006273541.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  60.8    2e-07   
emb|CDR13701.1|  ATP-dependent helicase, putative                     60.8    2e-07   
ref|XP_003871902.1|  putative nucleolar RNA helicase II               60.8    2e-07   
ref|XP_421574.3|  PREDICTED: nucleolar RNA helicase 2-like            60.8    2e-07   
ref|XP_010551735.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   
emb|CBI31778.3|  unnamed protein product                              60.5    2e-07   
ref|XP_009499705.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
ref|XP_010551734.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   
ref|XP_001457977.1|  hypothetical protein                             60.8    2e-07   
ref|XP_004657939.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_008113403.1|  PREDICTED: nucleolar RNA helicase 2              60.8    2e-07   
ref|XP_009635265.1|  PREDICTED: nucleolar RNA helicase 2-like         60.8    2e-07   
ref|XP_006406184.1|  hypothetical protein EUTSA_v10020296mg           60.5    2e-07   
ref|XP_002191015.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
emb|CCW64428.1|  unnamed protein product                              60.5    2e-07   
ref|XP_010551733.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.8    2e-07   
ref|XP_009505570.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_010703777.1|  nucleolar RNA helicase II, putative              60.5    2e-07   
ref|XP_001687490.1|  putative nucleolar RNA helicase II               60.5    2e-07   
ref|XP_009484668.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  60.5    2e-07   
ref|XP_010293567.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_008924437.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_009008064.1|  PREDICTED: nucleolar RNA helicase 2              60.5    2e-07   
ref|XP_807135.1|  nucleolar RNA helicase II                           60.5    2e-07   
ref|XP_009993186.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_009967651.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_007524245.1|  PREDICTED: nucleolar RNA helicase 2              60.5    2e-07   
ref|XP_006658271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   
ref|XP_005235247.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_005433606.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_003858201.1|  nucleolar RNA helicase II, putative              60.5    2e-07   
ref|XP_001462984.2|  putative nucleolar RNA helicase II               60.5    2e-07   
gb|ERE79135.1|  nucleolar RNA helicase 2-like protein                 60.1    2e-07   
ref|XP_010187643.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    3e-07   
ref|XP_002284103.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    3e-07   
ref|XP_805705.1|  nucleolar RNA helicase II                           60.5    3e-07   
ref|XP_010604184.1|  PREDICTED: nucleolar RNA helicase 2              60.5    3e-07   
ref|XP_009094281.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    3e-07   
emb|CAN60235.1|  hypothetical protein VITISV_028850                   60.1    3e-07   
ref|XP_006841548.1|  hypothetical protein AMTR_s00003p00168720        60.5    3e-07   
ref|XP_006352957.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    3e-07   
ref|XP_009593230.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    3e-07   
ref|XP_005429045.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
ref|XP_009787018.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    3e-07   
ref|XP_005048018.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
ref|WP_009199012.1|  DNA helicase                                     60.1    3e-07   
gb|EKF27840.1|  nucleolar RNA helicase II, putative                   60.1    3e-07   
ref|XP_007217634.1|  hypothetical protein PRUPE_ppa002643mg           60.1    3e-07   
ref|XP_005530565.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
ref|XP_002718616.1|  PREDICTED: nucleolar RNA helicase 2              60.1    3e-07   
ref|XP_010126598.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
dbj|BAF57642.1|  nucleolar RNA helicase II/Gu protein                 60.1    3e-07   
gb|EYU43162.1|  hypothetical protein MIMGU_mgv1a003141mg              60.1    3e-07   
gb|EYU43163.1|  hypothetical protein MIMGU_mgv1a003141mg              60.1    3e-07   
ref|XP_005833945.1|  hypothetical protein GUITHDRAFT_159596           60.1    3e-07   
ref|XP_851746.2|  PREDICTED: nucleolar RNA helicase 2                 60.1    3e-07   
ref|XP_008229751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    3e-07   
ref|XP_004680883.1|  PREDICTED: nucleolar RNA helicase 2              60.1    3e-07   
ref|XP_008495910.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
ref|XP_008495911.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    4e-07   
ref|XP_005491115.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    4e-07   
ref|XP_009913610.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  59.7    4e-07   
gb|KDO64256.1|  hypothetical protein CISIN_1g007084mg                 59.7    4e-07   
gb|KDO64254.1|  hypothetical protein CISIN_1g007084mg                 59.7    4e-07   
ref|XP_006728966.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   59.7    4e-07   
ref|XP_010198067.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    4e-07   
ref|XP_009987183.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    4e-07   
dbj|BAE87690.1|  unnamed protein product                              59.3    4e-07   
ref|XP_009863017.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    4e-07   
emb|CCA23433.1|  DEAD/DEAH box RNA helicase putative                  59.7    4e-07   
ref|XP_006728965.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   59.7    4e-07   
ref|WP_040895679.1|  DNA helicase                                     59.7    4e-07   
gb|EKF99205.1|  nucleolar RNA helicase II, putative                   59.7    4e-07   
ref|NP_001243839.1|  nucleolar RNA helicase 2 isoform 2               59.7    4e-07   
ref|XP_009068016.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    4e-07   
gb|ESS64587.1|  nucleolar RNA helicase II                             59.7    4e-07   
ref|XP_003258244.1|  PREDICTED: nucleolar RNA helicase 2 isoform 2    59.7    4e-07   
gb|KDO64255.1|  hypothetical protein CISIN_1g007084mg                 59.3    4e-07   
ref|XP_003815960.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
ref|XP_507825.2|  PREDICTED: nucleolar RNA helicase 2 isoform X1      59.7    4e-07   
ref|XP_009456870.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   59.7    4e-07   
ref|XP_007961426.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
ref|XP_003258243.1|  PREDICTED: nucleolar RNA helicase 2 isoform 1    59.7    4e-07   
ref|XP_002820927.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
ref|XP_004701441.1|  PREDICTED: ATP-dependent RNA helicase DDX50      59.7    4e-07   
ref|NP_004719.2|  nucleolar RNA helicase 2 isoform 1                  59.7    4e-07   
ref|XP_004049558.1|  PREDICTED: nucleolar RNA helicase 2 isoform 2    59.7    4e-07   
ref|XP_003530710.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   
ref|XP_003903905.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
gb|EHH64804.1|  hypothetical protein EGM_18115                        59.7    4e-07   
gb|AAF78930.2|AAF78930  RNA helicase II/Gu protein                    59.7    4e-07   
ref|XP_004393744.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
gb|ELW65741.1|  Nucleolar RNA helicase 2                              59.7    4e-07   
ref|XP_004049557.1|  PREDICTED: nucleolar RNA helicase 2 isoform 1    59.7    4e-07   
gb|KHM99686.1|  DEAD-box ATP-dependent RNA helicase 53                59.7    4e-07   
ref|XP_005565735.1|  PREDICTED: nucleolar RNA helicase 2              59.7    4e-07   
ref|XP_001110939.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  59.7    5e-07   



>gb|EYU19497.1| hypothetical protein MIMGU_mgv1a002250mg [Erythranthe guttata]
Length=695

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            EDP A++NFRISKPL++ALKAKGIESLF IQAMTF  VLDG+D+VGRARTGQGKTLAFVL
Sbjct  116  EDPNAVSNFRISKPLKDALKAKGIESLFPIQAMTFNLVLDGSDLVGRARTGQGKTLAFVL  175

Query  661  P  663
            P
Sbjct  176  P  176



>ref|XP_003536498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=697

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  649  AFVLP  663
            AFVLP
Sbjct  171  AFVLP  175



>gb|KHN02770.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=701

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  649  AFVLP  663
            AFVLP
Sbjct  171  AFVLP  175



>ref|XP_003556075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=693

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  472  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  107  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  166

Query  652  FVLP  663
            FVLP
Sbjct  167  FVLP  170



>gb|KHN15708.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=694

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +1

Query  472  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  108  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  167

Query  652  FVLP  663
            FVLP
Sbjct  168  FVLP  171



>tpg|DAA40575.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=671

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  463  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  643  TLAFVLP  663
            TLAFVLP
Sbjct  174  TLAFVLP  180



>ref|XP_008670328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Zea mays]
 tpg|DAA40576.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=704

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  463  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  643  TLAFVLP  663
            TLAFVLP
Sbjct  174  TLAFVLP  180



>gb|EYU25021.1| hypothetical protein MIMGU_mgv1a027128mg [Erythranthe guttata]
Length=591

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  472  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            EE+E P A++NFRISKPLREALK KGIESLF IQA TF+ +L G+D+VGRARTGQGKTLA
Sbjct  7    EEDETPNAVSNFRISKPLREALKEKGIESLFPIQATTFDTILHGSDLVGRARTGQGKTLA  66

Query  652  FVLP  663
            FVLP
Sbjct  67   FVLP  70



>ref|XP_006357902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=679

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 7/72 (10%)
 Frame = +1

Query  469  DEEE-------EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
            DEEE       EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRAR
Sbjct  96   DEEEVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRAR  155

Query  628  TGQGKTLAFVLP  663
            TGQGKTLAFVLP
Sbjct  156  TGQGKTLAFVLP  167



>gb|EPS64456.1| hypothetical protein M569_10323 [Genlisea aurea]
Length=693

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP AI NFRISKPLREALKAKGIE+LF IQA TF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  100  DPNAIVNFRISKPLREALKAKGIEALFPIQAKTFTMILDGSDLVGRARTGQGKTLAFVLP  159



>ref|XP_004240751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Solanum lycopersicum]
Length=683

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E V  +++ EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRARTG
Sbjct  98   EQVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRARTG  157

Query  634  QGKTLAFVLP  663
            QGKTLAFVLP
Sbjct  158  QGKTLAFVLP  167



>ref|XP_009587639.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
tomentosiformis]
Length=692

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAFVLP  177



>ref|XP_009767597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=692

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAFVLP  177



>gb|EAZ09787.1| hypothetical protein OsI_32075 [Oryza sativa Indica Group]
Length=685

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  466  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  646  LAFVLP  663
            LAFVLP
Sbjct  156  LAFVLP  161



>gb|KDO65345.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=546

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655  VLP  663
            VLP
Sbjct  164  VLP  166



>ref|XP_006660856.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Oryza 
brachyantha]
 gb|ABG73436.1| DEAD/DEAH box helicase family protein [Oryza brachyantha]
Length=688

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  466  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  98   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  157

Query  646  LAFVLP  663
            LAFVLP
Sbjct  158  LAFVLP  163



>ref|XP_003578458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brachypodium 
distachyon]
Length=694

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  451  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
            + A GGDE+  DP A+ NFRIS+PL++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  105  LTASGGDEDPADPNALANFRISEPLKQKLKSKGINALFPIQATTFGLVLDGHDLVGRART  164

Query  631  GQGKTLAFVLP  663
            GQGKTLAFVLP
Sbjct  165  GQGKTLAFVLP  175



>ref|XP_004957391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Setaria 
italica]
Length=708

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+PLR+ LK+KGI++LF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  113  DEDPADPNALTNFRISEPLRQRLKSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGKTL  172

Query  649  AFVLP  663
            AFVLP
Sbjct  173  AFVLP  177



>ref|XP_002460541.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
 gb|EER97062.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
Length=711

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  115  DEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGNDLVGRARTGQGKTL  174

Query  649  AFVLP  663
            AFVLP
Sbjct  175  AFVLP  179



>gb|KDO65346.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
 gb|KDO65347.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=574

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655  VLP  663
            VLP
Sbjct  164  VLP  166



>ref|XP_002866477.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42736.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++NFRIS PLRE LKAKGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSNFRISAPLREKLKAKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  649  AFVLP  663
            AFVLP
Sbjct  149  AFVLP  153



>ref|XP_011076505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Sesamum indicum]
Length=1167

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  463  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
            G   E++ P A+++FRIS PL+EALK KGIESLF IQAMTF AVLDG+D+VGRARTGQGK
Sbjct  548  GVKPEDDTPNAVSSFRISNPLKEALKEKGIESLFPIQAMTFNAVLDGSDLVGRARTGQGK  607

Query  643  TLAFVLP  663
            TLAFVLP
Sbjct  608  TLAFVLP  614



>gb|ACF80743.1| unknown [Zea mays]
Length=506

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649  AFVLP  663
            AFVLP
Sbjct  174  AFVLP  178



>gb|KDO65344.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=620

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655  VLP  663
            VLP
Sbjct  164  VLP  166



>ref|XP_011101144.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Sesamum 
indicum]
Length=701

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++NFRIS PLREALK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  120  NPNALSNFRISVPLREALKSKGIESLFPIQAMTFGMILDGSDLVGRARTGQGKTLAFVLP  179



>gb|KDO65342.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=652

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655  VLP  663
            VLP
Sbjct  164  VLP  166



>ref|XP_010275981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Nelumbo nucifera]
Length=745

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++NFRISK LRE LK+KGIESLF IQAMTF+ ++DG+DMVGRARTGQGKTLAFVLP
Sbjct  154  NPNAVSNFRISKALREQLKSKGIESLFPIQAMTFDTIVDGSDMVGRARTGQGKTLAFVLP  213



>ref|XP_006421777.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 ref|XP_006490269.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Citrus 
sinensis]
 gb|ESR35017.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 gb|KDO65343.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=695

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655  VLP  663
            VLP
Sbjct  164  VLP  166



>ref|XP_002269873.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Vitis vinifera]
Length=711

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++NFRIS+PLRE LK+KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  117  NPNALSNFRISEPLREKLKSKGIEALFPIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  176



>gb|KJB39373.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=544

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655  VLP  663
            VLP
Sbjct  168  VLP  170



>gb|KJB39371.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=571

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655  VLP  663
            VLP
Sbjct  168  VLP  170



>ref|XP_008652955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Zea mays]
Length=634

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649  AFVLP  663
            AFVLP
Sbjct  174  AFVLP  178



>gb|KJB39369.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=697

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655  VLP  663
            VLP
Sbjct  168  VLP  170



>gb|KHG06829.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=695

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165

Query  655  VLP  663
            VLP
Sbjct  166  VLP  168



>gb|KJB39370.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=687

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655  VLP  663
            VLP
Sbjct  168  VLP  170



>ref|XP_008652953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 tpg|DAA62342.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=707

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649  AFVLP  663
            AFVLP
Sbjct  174  AFVLP  178



>ref|XP_010940916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=711

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  457  AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
            A G +E   +P A++ FRISK LRE LK+KGIESLF IQAMTF+++LDG+D+VGRARTGQ
Sbjct  117  ARGENEGAANPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFDSILDGSDLVGRARTGQ  176

Query  637  GKTLAFVLP  663
            GKTLAFVLP
Sbjct  177  GKTLAFVLP  185



>ref|XP_008652954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=641

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649  AFVLP  663
            AFVLP
Sbjct  174  AFVLP  178



>gb|KHG06828.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=722

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165

Query  655  VLP  663
            VLP
Sbjct  166  VLP  168



>emb|CDP05280.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 67/92 (73%), Gaps = 7/92 (8%)
 Frame = +1

Query  400  LVEPVNFkaekkkkakLMEAVGGDEE----EEDPYAITNFRISKPLREALKAKGIESLFK  567
            L EP+N   +K K   L E    DEE    EE P A+T FRIS+ LREALK KGIE LF 
Sbjct  97   LGEPMNLMKKKAK---LTEVDEDDEEKSVKEEHPNALTKFRISERLREALKVKGIEYLFP  153

Query  568  IQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  154  IQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  185



>ref|XP_004506292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cicer 
arietinum]
Length=680

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +++DP A+TNFRIS+PL+  LK KGIE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  100  KKDDPNAVTNFRISEPLKMKLKEKGIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  159

Query  655  VLP  663
            VLP
Sbjct  160  VLP  162



>ref|XP_006394423.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
 gb|ESQ31709.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
Length=679

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTL
Sbjct  102  DVEVDNPNAVSRFRISAPLREKLKQKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTL  161

Query  649  AFVLP  663
            AFVLP
Sbjct  162  AFVLP  166



>ref|XP_004496645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Cicer arietinum]
Length=666

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            +++ +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTL
Sbjct  40   EKKVDDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTL  99

Query  649  AFVLP  663
            AFVLP
Sbjct  100  AFVLP  104



>ref|XP_002318863.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE97083.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=687

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVL
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAFVL  154

Query  661  P  663
            P
Sbjct  155  P  155



>ref|XP_011030003.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=685

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVL
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAFVL  154

Query  661  P  663
            P
Sbjct  155  P  155



>ref|XP_004496646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Cicer arietinum]
Length=631

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTLAFVL
Sbjct  44   DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTLAFVL  103

Query  661  P  663
            P
Sbjct  104  P  104



>gb|EAZ45398.1| hypothetical protein OsJ_30047 [Oryza sativa Japonica Group]
Length=685

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  466  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96   GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  646  LAFVLP  663
            LAFVLP
Sbjct  156  LAFVLP  161



>ref|NP_001063702.1| Os09g0520700 [Oryza sativa Japonica Group]
 sp|Q650T9.1|RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD46678.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF25616.1| Os09g0520700 [Oryza sativa Japonica Group]
Length=696

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  466  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  107  GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  166

Query  646  LAFVLP  663
            LAFVLP
Sbjct  167  LAFVLP  172



>ref|XP_001764376.1| predicted protein [Physcomitrella patens]
 gb|EDQ70930.1| predicted protein [Physcomitrella patens]
Length=689

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++NF I K LR+ LKAKGIESLF IQA TFEAV DG DMVGRARTGQGKTLAFVLP
Sbjct  108  DPMAVSNFNIGKALRDKLKAKGIESLFPIQAQTFEAVFDGNDMVGRARTGQGKTLAFVLP  167



>ref|XP_004308148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Fragaria vesca 
subsp. vesca]
Length=680

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            +DP A+T FRIS PLR  LK KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVL
Sbjct  105  DDPNAVTKFRISAPLRAKLKEKGIEALFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVL  164

Query  661  P  663
            P
Sbjct  165  P  165



>sp|Q41382.1|RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Spinacia 
oleracea]
 emb|CAA68193.1| RNA helicase [Spinacia oleracea]
Length=685

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E EDP +++NFRISKPL++ L +KGI++LF IQAMTF+ V+DG D+VGRARTGQGKTLAF
Sbjct  102  EAEDPNSLSNFRISKPLKDVLISKGIKALFPIQAMTFDNVIDGCDLVGRARTGQGKTLAF  161

Query  655  VLP  663
            VLP
Sbjct  162  VLP  164



>ref|XP_002510890.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF51492.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=690

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +1

Query  400  LVEPVNFkaekkkkakLMEAVGGD-----EEEEDPYAITNFRISKPLREALKAKGIESLF  564
            LVEPVN K +KK K   +     D      EE+ P AI+ +RIS+ LRE LK+KGI+SLF
Sbjct  70   LVEPVNLKTKKKNKKAKIADENEDGEVETAEEDHPNAISKYRISESLREKLKSKGIQSLF  129

Query  565  KIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  130  PIQAMTFDDILDGSDLVGRARTGQGKTLAFVLP  162



>ref|XP_007038495.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
 gb|EOY22996.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
Length=1077

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP AI+ FRIS+ +RE LK+KGIESLF IQAMTF+ VLDGTD+VGRARTGQGKTLAFVLP
Sbjct  481  DPNAISRFRISEAVREKLKSKGIESLFPIQAMTFDIVLDGTDLVGRARTGQGKTLAFVLP  540



>ref|XP_010109082.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
 gb|EXC20882.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
Length=703

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +1

Query  463  GGDEE-EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            GG+E+ EE P AI+ FRIS PL+  LK KGIESLF IQAMT + +LDG+D+VGRARTGQG
Sbjct  104  GGEEKSEEHPNAISKFRISAPLKAKLKEKGIESLFPIQAMTLDTILDGSDLVGRARTGQG  163

Query  640  KTLAFVLP  663
            KTLAFVLP
Sbjct  164  KTLAFVLP  171



>ref|XP_007143335.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
 gb|ESW15329.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
Length=713

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++ FRIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  127  DPNAVSKFRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAFVLP  186



>ref|XP_009407947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D   +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTL
Sbjct  114  DNAADDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTL  173

Query  649  AFVLP  663
            AFVLP
Sbjct  174  AFVLP  178



>gb|KDP22369.1| hypothetical protein JCGZ_26200 [Jatropha curcas]
Length=709

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            EDP A + FRIS PLRE LK++GIE+LF IQAMTF  +LDG D+VGRARTGQGKTLAFVL
Sbjct  120  EDPNATSKFRISLPLREKLKSRGIEALFPIQAMTFNDILDGCDLVGRARTGQGKTLAFVL  179

Query  661  P  663
            P
Sbjct  180  P  180



>ref|XP_009628542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=655

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAFVLP
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAFVLP  178



>ref|XP_009628541.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=691

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAFVLP
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAFVLP  178



>ref|XP_008812489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=718

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++ FRISK LRE LK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  134  NPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFNLILDGSDLVGRARTGQGKTLAFVLP  193



>ref|XP_009349718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  164

Query  658  LP  663
            LP
Sbjct  165  LP  166



>ref|XP_009343503.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  164

Query  658  LP  663
            LP
Sbjct  165  LP  166



>gb|KFK27951.1| hypothetical protein AALP_AA8G452500 [Arabis alpina]
Length=683

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTLAFVLP
Sbjct  108  NPNAVSKFRISDPLREQLKKKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTLAFVLP  167



>ref|XP_008234340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Prunus mume]
Length=690

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  168



>ref|XP_007220217.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
 gb|EMJ21416.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
Length=690

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  168



>ref|NP_201025.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 sp|Q39189.2|RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Arabidopsis 
thaliana]
 dbj|BAA97183.1| RNA helicase [Arabidopsis thaliana]
 gb|AAL07216.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAP40408.1| putative DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 gb|AED97579.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
Length=671

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649  AFVLP  663
            AFVLP
Sbjct  149  AFVLP  153



>ref|XP_008467258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis melo]
Length=698

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            ++E E+P A+T FRIS+PL+  LK KGI SLF IQAMTF+ V DG+D+VGRARTGQGKTL
Sbjct  98   EKEAENPNAVTRFRISEPLKAKLKEKGISSLFPIQAMTFDTVYDGSDLVGRARTGQGKTL  157

Query  649  AFVLP  663
            AFVLP
Sbjct  158  AFVLP  162



>ref|XP_009781160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=682

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ + DG D+VGRARTGQGKTLAFVLP
Sbjct  111  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTIFDGNDLVGRARTGQGKTLAFVLP  169



>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
Length=671

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649  AFVLP  663
            AFVLP
Sbjct  149  AFVLP  153



>ref|XP_003592391.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62642.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=641

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            EDP  I+ F+IS+PLRE LK KGIESLF IQAMTF+ +L G D+VGRARTGQGKTLAFVL
Sbjct  40   EDPNGISKFKISEPLREKLKEKGIESLFPIQAMTFDIILQGCDLVGRARTGQGKTLAFVL  99

Query  661  P  663
            P
Sbjct  100  P  100



>ref|XP_008376504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Malus domestica]
Length=686

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  108  KEDPNAVSKFRISVPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  167

Query  658  LP  663
            LP
Sbjct  168  LP  169



>ref|XP_009398738.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=716

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTLAFVL
Sbjct  122  DDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTLAFVL  181

Query  661  P  663
            P
Sbjct  182  P  182



>ref|XP_006348047.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=683

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A++NFRIS PLREAL  KGI +LF IQAMTF+ +LDG+D++GRARTGQGKTLAFVLP
Sbjct  106  PNALSNFRISVPLREALITKGIHALFPIQAMTFDTILDGSDLIGRARTGQGKTLAFVLP  164



>ref|XP_004234150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
lycopersicum]
Length=682

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A++NFRIS PL+E L AKGI +LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  112  PNALSNFRISVPLKEVLNAKGINALFPIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  170



>ref|XP_009130201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brassica rapa]
Length=667

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            E+P A++ FRIS PLRE LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTLAFVL
Sbjct  99   ENPNAVSKFRISDPLREKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTLAFVL  158

Query  661  P  663
            P
Sbjct  159  P  159



>ref|XP_006858006.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
 gb|ERN19473.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
Length=722

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E +P A+ NF ISK LRE LK+KGIESLF IQAMTF+ +  GTD+VGRARTGQGKTLAFV
Sbjct  132  EANPNAVVNFNISKVLREKLKSKGIESLFPIQAMTFDTIFGGTDLVGRARTGQGKTLAFV  191

Query  658  LP  663
            LP
Sbjct  192  LP  193



>ref|XP_010934579.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=720

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A++ FRIS+ LRE LK+KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  134  NPNAVSKFRISEVLREKLKSKGIESLFPIQAMTFDLILDGSDLVGRARTGQGKTLAFVLP  193



>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
Length=713

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++  RIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  127  DPNAVSKLRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAFVLP  186



>gb|KJB52899.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=705

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  111  KSEDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAF  170

Query  655  VLP  663
            VLP
Sbjct  171  VLP  173



>ref|XP_010458375.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010458382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Camelina sativa]
Length=679

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  95   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  154

Query  649  AFVLP  663
            AFVLP
Sbjct  155  AFVLP  159



>gb|KJB52898.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=704

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            + EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  111  KSEDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAF  170

Query  655  VLP  663
            VLP
Sbjct  171  VLP  173



>gb|EMT03655.1| DEAD-box ATP-dependent RNA helicase 7 [Aegilops tauschii]
Length=687

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  451  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
            + A G +EE  DP A+ NFRIS+ L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  95   LTASGEEEEPADPNALANFRISEKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  154

Query  631  GQGKTLAFVLP  663
            GQGKTLAFVLP
Sbjct  155  GQGKTLAFVLP  165



>ref|XP_010034995.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Eucalyptus 
grandis]
 gb|KCW46257.1| hypothetical protein EUGRSUZ_K00136 [Eucalyptus grandis]
Length=703

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 3/69 (4%)
 Frame = +1

Query  466  GDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
            GD+E   EE+P A++NFRIS  LR  LK   IE+LF IQAMTF+ VLDGTD+VGRARTGQ
Sbjct  115  GDDEVAQEENPNAVSNFRISDSLRLKLKDNKIEALFPIQAMTFDIVLDGTDLVGRARTGQ  174

Query  637  GKTLAFVLP  663
            GKTLAFVLP
Sbjct  175  GKTLAFVLP  183



>ref|XP_002322430.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF06557.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=680

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVLP
Sbjct  100  DPNAVTRFRISEPLREVLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAFVLP  159



>ref|XP_010483921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=681

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  93   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  152

Query  649  AFVLP  663
            AFVLP
Sbjct  153  AFVLP  157



>ref|XP_010444062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=670

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  90   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  149

Query  649  AFVLP  663
            AFVLP
Sbjct  150  AFVLP  154



>gb|KEH26427.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=681

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +++DP A++NFRIS+PLR  LK   IE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  97   KKDDPNAVSNFRISEPLRMKLKENKIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  156

Query  655  VLP  663
            VLP
Sbjct  157  VLP  159



>ref|XP_011041667.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=684

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVLP
Sbjct  98   DPNAVTRFRISEPLRETLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAFVLP  157



>ref|XP_008364874.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Malus 
domestica]
Length=683

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP
Sbjct  104  DPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLP  163



>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
Length=671

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P A++ FRI  PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRIPAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649  AFVLP  663
            AFVLP
Sbjct  149  AFVLP  153



>emb|CDX87236.1| BnaC09g05510D [Brassica napus]
Length=637

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  649  AFVLP  663
            AFVLP
Sbjct  140  AFVLP  144



>ref|XP_009112011.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7-like [Brassica rapa]
Length=655

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  649  AFVLP  663
            AFVLP
Sbjct  140  AFVLP  144



>emb|CDY16789.1| BnaA09g05930D [Brassica napus]
Length=635

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  79   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  138

Query  649  AFVLP  663
            AFVLP
Sbjct  139  AFVLP  143



>ref|XP_010693660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P +++NFRISKPL++AL +KGI++LF IQAMTF+ V+DG D+V RARTGQGKTLAFVLP
Sbjct  99   NPNSLSNFRISKPLKDALISKGIQALFPIQAMTFDIVIDGCDLVARARTGQGKTLAFVLP  158



>ref|XP_009345013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=858

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP
Sbjct  280  DPNAVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLP  339



>ref|XP_004172086.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cucumis 
sativus]
 gb|KGN50393.1| hypothetical protein Csa_5G171750 [Cucumis sativus]
Length=696

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTGQGKTL
Sbjct  98   EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTGQGKTL  157

Query  649  AFVLP  663
            AFVLP
Sbjct  158  AFVLP  162



>ref|XP_006279587.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
 gb|EOA12485.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
Length=668

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D E ++P AI+ FRIS  LRE LK +GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAISKFRISPSLREKLKERGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  649  AFVLP  663
            AFVLP
Sbjct  149  AFVLP  153



>ref|XP_004143712.1| PREDICTED: uncharacterized protein LOC101209696 [Cucumis sativus]
Length=1247

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTGQGKTL
Sbjct  649  EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTGQGKTL  708

Query  649  AFVLP  663
            AFVLP
Sbjct  709  AFVLP  713



>ref|XP_010555319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Tarenaya hassleriana]
Length=687

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A+T FRIS P+   LK KGI +LF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  107  NPNAVTKFRISTPVVNKLKEKGIAALFPIQAMTFDMVLDGSDLVGRARTGQGKTLAFVLP  166



>ref|XP_002975210.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
 gb|EFJ23995.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
Length=626

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  36   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  95

Query  649  AFVLP  663
            AFVLP
Sbjct  96   AFVLP  100



>ref|XP_009346936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=860

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP
Sbjct  285  AVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLP  341



>ref|XP_002977618.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
 gb|EFJ21622.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
Length=663

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  73   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  132

Query  649  AFVLP  663
            AFVLP
Sbjct  133  AFVLP  137



>ref|XP_010059508.1| PREDICTED: nucleolar RNA helicase 2-like [Eucalyptus grandis]
Length=584

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +EE+P A++NFRI   LR  LK  GIE+LF IQAMTF+ ++DG D+VGRA T QGKTLAF
Sbjct  218  QEENPNALSNFRILNTLRLKLKDNGIEALFPIQAMTFDIIVDGADLVGRAHTSQGKTLAF  277

Query  655  VLP  663
            VLP
Sbjct  278  VLP  280



>ref|XP_010068038.1| PREDICTED: acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal-like 
[Eucalyptus grandis]
Length=346

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
              +P A+ NFRIS  LR  LK  GIE+LF I  MTF+ V DGTD+VGRA TGQGKTLAFV
Sbjct  6    RRNPNAVLNFRISDSLRLKLKDNGIEALFPIHPMTFDNVHDGTDLVGRACTGQGKTLAFV  65

Query  658  LP  663
            LP
Sbjct  66   LP  67



>ref|XP_005854803.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
 gb|EKU21559.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
Length=737

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            + DP A++NF+IS+  R  L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF 
Sbjct  138  DADPNALSNFKISQATRTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAFA  197

Query  658  LP  663
            LP
Sbjct  198  LP  199



>gb|KJB39372.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=605

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQ
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQ  161



>ref|XP_005645158.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20614.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=698

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP A+ NFR+S  ++  L+ KGIE+LF IQA T   +LDG D+VGRARTGQGKTLAFVLP
Sbjct  102  DPLAVDNFRLSDKVKALLREKGIEALFSIQAHTLNHLLDGFDLVGRARTGQGKTLAFVLP  161



>gb|ETK72184.1| hypothetical protein L915_20663 [Phytophthora parasitica]
Length=269

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  155  KTLAFALP  162



>gb|EMS52016.1| DEAD-box ATP-dependent RNA helicase 7 [Triticum urartu]
Length=925

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  451  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
            + A G +EE  DP A+ NFRIS  L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  333  LTASGEEEEPADPNALANFRISDKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  392

Query  631  GQGKTLAFVLP  663
            GQGKTLAFVLP
Sbjct  393  GQGKTLAFVLP  403



>ref|XP_008914911.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
 gb|ETM99820.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
Length=684

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640  KTLAFVLP  663
            KTLAFVLP
Sbjct  155  KTLAFVLP  162



>gb|EWM21167.1| dead deah box rna [Nannochloropsis gaditana]
Length=737

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            + DP A++NF+IS+     L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF 
Sbjct  138  DADPNALSNFKISQATCTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAFA  197

Query  658  LP  663
            LP
Sbjct  198  LP  199



>gb|ETP29814.1| hypothetical protein F442_21078 [Phytophthora parasitica P10297]
Length=684

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  155  KTLAFALP  162



>gb|ETI31844.1| hypothetical protein F443_21248 [Phytophthora parasitica P1569]
 gb|ETL25637.1| hypothetical protein L916_20525 [Phytophthora parasitica]
 gb|ETL78851.1| hypothetical protein L917_20399 [Phytophthora parasitica]
 gb|ETM32130.1| hypothetical protein L914_20404 [Phytophthora parasitica]
 gb|ETO60560.1| hypothetical protein F444_21264 [Phytophthora parasitica P1976]
 gb|ETP01634.1| hypothetical protein F441_21133 [Phytophthora parasitica CJ01A1]
Length=684

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  155  KTLAFALP  162



>ref|XP_010938270.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=318

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  505  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             RISK LRE LK+KGIES+F IQ MTF+++ DG+++V + RTGQGKTLAFVLP
Sbjct  84   MRISKVLREKLKSKGIESMFPIQTMTFDSIFDGSNLVCQERTGQGKTLAFVLP  136



>ref|XP_002904811.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53193.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=681

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ ++DG D++GRARTG G
Sbjct  100  VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKIVDGKDLMGRARTGMG  155

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  156  KTLAFALP  163



>ref|XP_011399479.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
 gb|KFM26541.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
Length=764

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P+A+ NF +S PL+  L++KGIESLF IQA     +L+G D+VGRARTG GKTLAFVLP
Sbjct  52   PHALDNFALSAPLKSMLRSKGIESLFDIQAACLTPLLEGRDLVGRARTGCGKTLAFVLP  110



>ref|XP_005849733.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
 gb|EFN57631.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
Length=608

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  487  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            P A+ NF++S+P++  L+AKGIE+LF IQA     +L+G D+VGRARTG GKTLAFVLP
Sbjct  2    PLALDNFKLSEPVKSLLRAKGIEALFDIQAQCLPPLLEGQDLVGRARTGCGKTLAFVLP  60



>ref|XP_003058076.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=748

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+DP  ++NF IS+ +   L+ KGI SL+ IQA TF+ VLDG D+V RA+TG GKTLAFV
Sbjct  123  EDDPLRVSNFNISREVCARLETKGITSLYGIQAQTFQHVLDGKDIVARAKTGCGKTLAFV  182

Query  658  LP  663
            LP
Sbjct  183  LP  184



>ref|XP_001417262.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95555.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=654

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE +P A+ NF +S+P++  L+ KG ++LF IQA T E  L G D+VGRARTG GKTLAF
Sbjct  78   EEPNPLALDNFALSEPVKATLRKKGFDALFAIQAETLEIALSGKDVVGRARTGCGKTLAF  137

Query  655  VLP  663
            VLP
Sbjct  138  VLP  140



>emb|CEP17128.1| hypothetical protein [Parasitella parasitica]
Length=708

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            +  DE  E+   ++NFRIS+   + LKAKGI+SLF+IQA TF+ + DG D++ RARTG G
Sbjct  84   INSDEVPEN-LRLSNFRISQGTVDNLKAKGIKSLFEIQAATFDTIFDGNDVLARARTGTG  142

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  143  KTLAFALP  150



>ref|XP_002507890.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69148.1| predicted protein [Micromonas sp. RCC299]
Length=631

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            EA  GD   ++ + ++NF +SK +   L+ KGI SL+ IQA  F+ +LDG D+VGRARTG
Sbjct  15   EASDGDASVDENH-VSNFNLSKEVCARLETKGITSLYSIQAQCFQPILDGKDLVGRARTG  73

Query  634  QGKTLAFVLP  663
             GKTLAFVLP
Sbjct  74   CGKTLAFVLP  83



>ref|XP_009837773.1| hypothetical protein H257_12310 [Aphanomyces astaci]
 gb|ETV72987.1| hypothetical protein H257_12310 [Aphanomyces astaci]
Length=683

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            ED   ++NFRIS    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAFVL
Sbjct  87   EDNPPLSNFRISAATIDNLEKRGIPTLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAFVL  146

Query  661  P  663
            P
Sbjct  147  P  147



>emb|CDS09503.1| hypothetical protein LRAMOSA10863 [Absidia idahoensis var. thermophila]
Length=681

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 2/74 (3%)
 Frame = +1

Query  448  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
            ++E  G   EE+ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEETGKHNEEDVPEHLKLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  622  ARTGQGKTLAFVLP  663
            ARTG GKTLAF LP
Sbjct  124  ARTGTGKTLAFALP  137



>ref|XP_004300425.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Fragaria 
vesca subsp. vesca]
Length=329

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            EE P A++ FRIS+PLR  LK +GI+SL  IQA TF+ +LDG D++ +A   Q KTLAFV
Sbjct  70   EETPNAVSKFRISEPLRAKLKERGIKSLSPIQARTFDTILDGFDLLAQAPADQDKTLAFV  129

Query  658  LP  663
            LP
Sbjct  130  LP  131



>dbj|GAN03042.1| nucleolar RNA helicase 2-like isoform X2 [Mucor ambiguus]
Length=705

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF LP
Sbjct  90   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTGTGKTLAFALP  145



>gb|EPB89647.1| hypothetical protein HMPREF1544_03579 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=704

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF LP
Sbjct  92   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTGTGKTLAFALP  147



>emb|CDH59679.1| nucleolar rna helicase 2-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=684

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (72%), Gaps = 2/74 (3%)
 Frame = +1

Query  448  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
            ++E  G  E+++ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEESGKHEDDQVPEHLQLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  622  ARTGQGKTLAFVLP  663
            ARTG GKTLAF LP
Sbjct  124  ARTGTGKTLAFALP  137



>ref|XP_007512398.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16998.1| predicted protein [Bathycoccus prasinos]
Length=689

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            D    +P A+ NF +S  +  AL+ KGI++LF IQA T +  L G D+VGRARTG GKTL
Sbjct  75   DARTPNPLALENFSLSPEVVSALQKKGIDALFAIQAQTLDTALSGKDIVGRARTGCGKTL  134

Query  649  AFVLP  663
            AFVLP
Sbjct  135  AFVLP  139



>ref|XP_003078811.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL51691.1| Helicase, C-terminal [Ostreococcus tauri]
Length=693

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  475  EEEDPYAITNFR-ISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            EE +P A+ NF+ ++ P++  L+ KG ++LF+IQA T E  L G D+VGRARTG GKTLA
Sbjct  75   EEPNPLALDNFKGLTDPVKTTLRKKGYDALFQIQAETLEIALGGRDVVGRARTGCGKTLA  134

Query  652  FVLP  663
            FVLP
Sbjct  135  FVLP  138



>emb|CEG79803.1| hypothetical protein RMATCC62417_14224 [Rhizopus microsporus]
Length=476

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAFAIP  131



>ref|XP_008873274.1| hypothetical protein H310_09087 [Aphanomyces invadans]
 gb|ETV98399.1| hypothetical protein H310_09087 [Aphanomyces invadans]
Length=675

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  481  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
            +D   ++NFR+S    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAFVL
Sbjct  82   DDNPPLSNFRVSAVTIKNLEKRGIATLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAFVL  141

Query  661  P  663
            P
Sbjct  142  P  142



>gb|EIE87311.1| hypothetical protein RO3G_12022 [Rhizopus delemar RA 99-880]
Length=665

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A++NFRIS+   E L+ KGI SLF+IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  70   ALSNFRISEGTIENLEKKGISSLFEIQAATFDTIYDGKDVLARARTGTGKTLAFAIP  126



>emb|CBK20101.2| unnamed protein product [Blastocystis hominis]
Length=553

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E  YA+  +RIS      L +KGI  LF IQA++F+A+ DG D++GRA TGQGKTLAF
Sbjct  10   ESESLYAMHRYRISPETIGILHSKGITELFPIQALSFDAIYDGKDLIGRAPTGQGKTLAF  69

Query  655  VLP  663
             LP
Sbjct  70   ALP  72



>emb|CEI86541.1| hypothetical protein RMCBS344292_00980 [Rhizopus microsporus]
Length=674

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            D   ++NFRIS+   + L+ KGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFEIQAATFDTIFDGKDVLARARTGTGKTLAFAIP  131



>emb|CEG65973.1| hypothetical protein RMATCC62417_02639 [Rhizopus microsporus]
Length=674

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAFAIP  131



>ref|XP_005838835.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
 gb|EKX51855.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
Length=589

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +I NFRIS+   +AL  +GI++LF IQ  TF+ + +G D++ RARTG GKTLAFVLP
Sbjct  138  SIRNFRISEKTIKALSEQGIQTLFPIQVATFDIIYEGYDLIARARTGTGKTLAFVLP  194



>ref|XP_007054740.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=681

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  105  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  164

Query  655  VLP  663
             +P
Sbjct  165  AVP  167



>ref|XP_009496395.1| hypothetical protein H696_04240 [Fonticula alba]
 gb|KCV68824.1| hypothetical protein H696_04240 [Fonticula alba]
Length=712

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +P A+TNFRISK        + I +LF IQA T++A+ DG D++G+ARTG GKT++F LP
Sbjct  101  NPLALTNFRISKETVSQFAKRNITALFPIQAQTYDAIYDGKDVIGQARTGSGKTISFGLP  160



>emb|CCA17723.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
 emb|CCA18369.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
Length=660

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            ++ +F I    ++ LK  GI +LF IQAMTF+ ++DG +++GRARTG GKTLAF LP
Sbjct  96   SLDDFAICAQTKKNLKKHGIANLFPIQAMTFDKIMDGNNLIGRARTGMGKTLAFALP  152



>ref|XP_006273547.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator mississippiensis]
Length=692

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F LP
Sbjct  128  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIVQARTGTGKTFSFALP  184



>gb|EMP40574.1| Nucleolar RNA helicase 2, partial [Chelonia mydas]
Length=1143

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  574  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  633

Query  655  VLP  663
             +P
Sbjct  634  AVP  636


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F +P
Sbjct  11   AFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSFAIP  67



>ref|XP_006630629.1| PREDICTED: nucleolar RNA helicase 2-like [Lepisosteus oculatus]
Length=777

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRISK   + L+A+G+  LF IQ  TF+ V DG D+VG+ARTG GKT +F +P
Sbjct  184  AFSNFRISKETIQLLQARGVTYLFDIQVKTFDFVFDGNDVVGQARTGTGKTFSFAIP  240



>ref|XP_005297367.1| PREDICTED: nucleolar RNA helicase 2 [Chrysemys picta bellii]
Length=813

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  237  EEEREGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  296

Query  655  VLP  663
             +P
Sbjct  297  AVP  299



>ref|XP_010887236.1| PREDICTED: nucleolar RNA helicase 2-like [Esox lucius]
Length=766

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+   A +NFRIS    + L+A+GI  LF IQ  TF +V DG D++G+ARTG GKTLAF 
Sbjct  160  EQKSGAFSNFRISPNTIKLLEARGISFLFDIQTQTFNSVYDGKDVIGQARTGTGKTLAFA  219

Query  658  LP  663
            +P
Sbjct  220  IP  221



>ref|XP_009520796.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
 gb|EGZ25508.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
Length=962

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = +1

Query  460  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            VGG    E+P  + +F I     + LKA+GI +LF IQAMTF+ +L G D++GRARTG G
Sbjct  94   VGG---TENP-PLESFDICAETVKNLKARGIHTLFPIQAMTFDKILAGKDLMGRARTGMG  149

Query  640  KTLAFVLP  663
            KTLAF LP
Sbjct  150  KTLAFALP  157



>ref|XP_002112077.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
 gb|EDV26044.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
Length=633

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  505  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            FRIS  + ++LK +GI  LF IQA TF+ V DG D++G+ARTG GKTL+F LP
Sbjct  57   FRISSAIADSLKERGITYLFPIQAQTFDYVYDGQDVIGQARTGTGKTLSFALP  109



>ref|XP_006820781.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Saccoglossus 
kowalevskii]
Length=707

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  120  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  179

Query  655  VLP  663
             LP
Sbjct  180  ALP  182



>ref|XP_002738237.2| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Saccoglossus 
kowalevskii]
Length=708

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  121  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  180

Query  655  VLP  663
             LP
Sbjct  181  ALP  183



>ref|XP_005815128.1| PREDICTED: nucleolar RNA helicase 2-like [Xiphophorus maculatus]
Length=745

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG GKT +F LP
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTGTGKTFSFALP  216



>ref|XP_002502509.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
 gb|ACO63767.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
Length=790

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + DP  + NF +S   + AL+ +GIE+LF IQA   E  L G D+VGRARTG GKTL F
Sbjct  128  NKRDPMHVDNFPLSDITKAALRKRGIETLFPIQASVLEPALQGRDVVGRARTGTGKTLGF  187

Query  655  VLP  663
             LP
Sbjct  188  SLP  190



>ref|XP_010789411.1| PREDICTED: nucleolar RNA helicase 2-like [Notothenia coriiceps]
Length=275

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS+   + LKA+G+  LF IQ+ TF +V DG D++ +ARTG GKT +F +P
Sbjct  156  AFSNFRISQVTIDKLKARGVTYLFDIQSKTFNSVFDGEDVIAQARTGTGKTFSFAVP  212



>ref|XP_011406566.1| PREDICTED: ATP-dependent RNA helicase DDX50-like [Amphimedon 
queenslandica]
Length=371

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  505  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +RISK  R+ LK++GI  LF IQ  TF+ + D  D++G+ARTG GKTL+FVLP
Sbjct  44   YRISKVSRKTLKSRGITHLFPIQYKTFDPIYDNKDVIGQARTGTGKTLSFVLP  96



>emb|CDQ75565.1| unnamed protein product [Oncorhynchus mykiss]
Length=749

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF +P
Sbjct  172  AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAFAIP  228



>gb|ACH85363.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Salmo salar]
Length=611

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF +P
Sbjct  34   AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAFAIP  90



>emb|CEI94647.1| hypothetical protein RMCBS344292_08852 [Rhizopus microsporus]
Length=694

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  230  DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAFAIP  289



>gb|KDO19871.1| hypothetical protein SPRG_14901 [Saprolegnia parasitica CBS 223.65]
Length=648

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAFVLP
Sbjct  83   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAFVLP  138



>ref|XP_008611506.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
 gb|EQC35222.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
Length=662

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAFVLP
Sbjct  82   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAFVLP  137



>ref|XP_006125341.1| PREDICTED: nucleolar RNA helicase 2 [Pelodiscus sinensis]
Length=728

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EEE   A +NF ISK   E LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  154  EEEKEGAFSNFSISKETIELLKARGVKYLFSVQVKTFQPIYDGKDVIAQARTGTGKTFSF  213

Query  655  VLP  663
             +P
Sbjct  214  AVP  216



>ref|XP_003056927.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
 gb|EEH58572.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
Length=803

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +  DP  I NF IS   + AL+ +GIESLF IQ+      L+G D+VGRARTG GKTL F
Sbjct  139  KNSDPNHIDNFPISVLTKAALRKRGIESLFPIQSAVLAPALEGRDIVGRARTGTGKTLGF  198

Query  655  VLP  663
             LP
Sbjct  199  SLP  201



>ref|NP_001120807.1| nucleolar RNA helicase 2 [Danio rerio]
 gb|AAI60629.1| Ddx21 protein [Danio rerio]
Length=759

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +1

Query  469  DEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
            ++E+E P     A +NFRIS    + L+A+G+  LF IQ  TF AV DG D++G+ARTG 
Sbjct  155  EQEKETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIGQARTGT  214

Query  637  GKTLAFVLP  663
            GKT +F +P
Sbjct  215  GKTFSFAVP  223



>ref|XP_006023203.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator sinensis]
Length=689

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F LP
Sbjct  127  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIAQARTGTGKTFSFALP  183



>ref|XP_008364905.1| PREDICTED: uncharacterized protein LOC103428569 [Malus domestica]
Length=206

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  523  LREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
            LR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGK
Sbjct  166  LRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGK  205



>ref|XP_002955657.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
 gb|EFJ43297.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
Length=727

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +  F +S+ ++  L+++ IESLF IQAMT E  L G D+VGRARTG GKTLAFVLP
Sbjct  104  LDRFPLSEQVKSMLRSQNIESLFPIQAMTLEPGLAGVDVVGRARTGCGKTLAFVLP  159



>ref|XP_007549868.1| PREDICTED: nucleolar RNA helicase 2-like [Poecilia formosa]
Length=743

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG GKT +F +P
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTGTGKTFSFAIP  216



>ref|XP_005733301.1| PREDICTED: nucleolar RNA helicase 2-like [Pundamilia nyererei]
Length=754

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  472  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  149  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  208

Query  640  KTLAFVLP  663
            KT +F +P
Sbjct  209  KTFSFAIP  216



>ref|XP_005467227.1| PREDICTED: nucleolar RNA helicase 2-like [Oreochromis niloticus]
Length=757

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F +P
Sbjct  161  AFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTGKTFSFAIP  217



>ref|XP_005915179.1| PREDICTED: nucleolar RNA helicase 2-like [Haplochromis burtoni]
Length=796

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  472  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  190  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  249

Query  640  KTLAFVLP  663
            KT +F +P
Sbjct  250  KTFSFAIP  257



>ref|XP_004539930.1| PREDICTED: nucleolar RNA helicase 2-like [Maylandia zebra]
Length=797

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  472  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  191  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  250

Query  640  KTLAFVLP  663
            KT +F +P
Sbjct  251  KTFSFAIP  258



>ref|XP_008290699.1| PREDICTED: nucleolar RNA helicase 2-like [Stegastes partitus]
Length=754

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  472  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            E+EE P     A +NFRIS+   + LKA+G+  LF IQ  TF+ V DG D++ +ARTG G
Sbjct  152  EKEETPEQREGAFSNFRISQVTIDKLKARGVSYLFDIQVKTFDPVYDGEDVIAQARTGTG  211

Query  640  KTLAFVLP  663
            KT +F +P
Sbjct  212  KTFSFAIP  219



>ref|XP_001702450.1| RNA helicase [Chlamydomonas reinhardtii]
 gb|EDO96945.1| RNA helicase [Chlamydomonas reinhardtii]
Length=737

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +  F++S+ ++  L+++ IESLF IQAMT E  ++G D+VGRARTG GKTLAF +P
Sbjct  105  GLDRFKLSEQVKSMLRSQNIESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAFTVP  161



>ref|XP_004334405.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR12392.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=723

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  499  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            ++FRIS    + L+ +G + LF IQA T++ + DG D++GRARTG GKTL+FVLP
Sbjct  119  SDFRISPTTVKLLQDRGFKCLFAIQAQTYDHIYDGKDIIGRARTGSGKTLSFVLP  173



>ref|XP_006780037.1| PREDICTED: nucleolar RNA helicase 2-like [Neolamprologus brichardi]
Length=794

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +1

Query  472  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  189  ETEETPEQKEGAFSNFRISKVTIDKLKARGVAYLFDIQVKTFNHVYDGEDVIAQARTGTG  248

Query  640  KTLAFVLP  663
            KT +F +P
Sbjct  249  KTFSFAIP  256



>ref|XP_009309382.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
 gb|KEG12393.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
Length=648

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  499  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            T+F IS    +AL+++GIE+LF +QA+T+EA++ GTD++ +ARTG GKTLAF +P
Sbjct  59   TDFGISDGTVKALRSQGIETLFPVQALTYEAIMKGTDVLVQARTGSGKTLAFSIP  113



>ref|XP_005708224.1| ATP-dependent RNA helicase [Galdieria sulphuraria]
 gb|EME31704.1| ATP-dependent RNA helicase [Galdieria sulphuraria]
Length=758

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  472  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            E  E P   T+F++SK + E L+ +G+     IQ+ TFE +  G D++GR+RTG GKTLA
Sbjct  184  EANETPVPFTSFQLSKKILEILEERGLRDATPIQSATFELIYSGRDIIGRSRTGTGKTLA  243

Query  652  FVLP  663
            FVLP
Sbjct  244  FVLP  247



>ref|XP_007253242.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Astyanax 
mexicanus]
Length=737

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG GKT +F +P
Sbjct  133  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSFAIP  189



>ref|XP_006406182.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
 gb|ESQ47635.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
Length=632

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  400  LVEPVNFkaekkkkakLMEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAM  579
            +V P  F   +     + ++        D  AI+   IS  + +ALK+KGIE LF IQ  
Sbjct  85   MVSPAGFAISESSDRGIGDSESVGSSSADGLAISELGISPEIVKALKSKGIEKLFPIQKA  144

Query  580  TFEAVLDGTDMVGRARTGQGKTLAFVLP  663
              E  + G DM+GRARTG GKTLAF +P
Sbjct  145  VLEPAMQGRDMIGRARTGTGKTLAFGIP  172



>ref|XP_007253243.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Astyanax 
mexicanus]
Length=777

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG GKT +F +P
Sbjct  173  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSFAIP  229



>ref|XP_010753600.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Larimichthys 
crocea]
 ref|XP_010753601.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Larimichthys 
crocea]
Length=754

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS+   + LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F +P
Sbjct  157  AFSNFRISQVTIDKLKARGVSYLFDIQVKTFNPVYDGEDVIAQARTGTGKTFSFAIP  213



>ref|XP_003079318.1| ATP-dependent RNA helicase (ISS) [Ostreococcus tauri]
Length=683

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG GKTLAF 
Sbjct  21   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTGTGKTLAFS  80

Query  658  LP  663
            LP
Sbjct  81   LP  82



>emb|CEF97957.1| Helicase, C-terminal [Ostreococcus tauri]
Length=765

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG GKTLAF 
Sbjct  98   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTGTGKTLAFS  157

Query  658  LP  663
            LP
Sbjct  158  LP  159



>emb|CDY46329.1| BnaC01g31630D [Brassica napus]
Length=549

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E  + G DM+GRARTG
Sbjct  92   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  151

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  152  TGKTLAFGIP  161



>emb|CCI44343.1| unnamed protein product [Albugo candida]
Length=649

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +1

Query  448  LMEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
            + +AV    +  +P ++ +F I    ++ L+  GI  LF IQAMTF  ++ G +++GRAR
Sbjct  66   IHDAVKTTTKPSNP-SVDDFAICAQTKKNLQKHGIAHLFPIQAMTFNKIIAGNNLIGRAR  124

Query  628  TGQGKTLAFVLP  663
            TG GKTLAF LP
Sbjct  125  TGMGKTLAFALP  136



>ref|XP_002883355.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59614.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  472  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
            + E D  AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG GKTLA
Sbjct  95   DSESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLA  154

Query  652  FVLP  663
            F +P
Sbjct  155  FGIP  158



>ref|NP_188872.2| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
 sp|Q9LUW5.1|RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53 [Arabidopsis 
thaliana]
 dbj|BAB01770.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAL32580.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM13255.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AEE76622.1| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
Length=616

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E+VGGD       AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG
Sbjct  97   ESVGGD-----GLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTG  151

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  152  TGKTLAFGIP  161



>ref|XP_003976441.1| PREDICTED: nucleolar RNA helicase 2-like [Takifugu rubripes]
Length=713

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS      LKA+G+  LF IQ  TF++V DG D++ +ARTG GKT +F +P
Sbjct  131  AFSNFRISPVTINKLKARGVSYLFDIQVKTFDSVYDGEDVIAQARTGTGKTFSFAIP  187



>gb|KFH66922.1| hypothetical protein MVEG_07447 [Mortierella verticillata NRRL 
6337]
Length=687

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +1

Query  463  GGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
            G   E E P    +T+++IS    +AL  +GI+SLF IQA  F  + +G D++GRARTG 
Sbjct  104  GATVENEIPENLRLTSYKISLSTVDALAKRGIKSLFPIQAEVFNPIYNGNDVLGRARTGT  163

Query  637  GKTLAFVLP  663
            GKTLAF LP
Sbjct  164  GKTLAFALP  172



>ref|XP_006297190.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
 gb|EOA30088.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
Length=636

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E V GD E  D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  91   ERVIGDSES-DGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  149

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  150  TGKTLAFGIP  159



>ref|XP_009145390.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Brassica rapa]
Length=602

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  163  TGKTLAFGIP  172



>emb|CDY10634.1| BnaA05g17280D [Brassica napus]
Length=602

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  163  TGKTLAFGIP  172



>ref|XP_786504.3| PREDICTED: nucleolar RNA helicase 2-like [Strongylocentrotus 
purpuratus]
Length=751

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  469  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
            +E +E   A +NF I     E L AKG++ LF IQA TF+ + DG D++ +ARTG GKTL
Sbjct  109  EETQEKIGAFSNFGIRPKTIEKLHAKGVKYLFPIQAQTFKPIDDGFDVIAQARTGTGKTL  168

Query  649  AFVLP  663
            +FVLP
Sbjct  169  SFVLP  173



>ref|XP_010511255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=640

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  153

Query  658  LP  663
            +P
Sbjct  154  IP  155



>ref|XP_010511251.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=616

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  153

Query  658  LP  663
            +P
Sbjct  154  IP  155



>ref|XP_010488258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X2 
[Camelina sativa]
Length=628

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  156

Query  658  LP  663
            +P
Sbjct  157  IP  158



>ref|XP_010488257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X1 
[Camelina sativa]
Length=638

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  156

Query  658  LP  663
            +P
Sbjct  157  IP  158



>ref|XP_011490446.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Oryzias 
latipes]
Length=740

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F +P
Sbjct  148  AFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTGKTFSFAIP  204



>ref|XP_004067286.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Oryzias 
latipes]
Length=775

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F +P
Sbjct  183  AFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTGKTFSFAIP  239



>ref|XP_006297246.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
 gb|EOA30144.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
Length=609

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  119  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  175



>ref|XP_009035969.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
 gb|EGB09312.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
Length=591

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLD-GTDMVGRARTGQGKTLAFVLP  663
            A+ +F +S   R+AL  +GI+ LF IQA TF A+ D G D++ RARTG GKTLAF LP
Sbjct  1    ALGDFALSTGTRQALDKRGIKVLFPIQAATFAAIFDAGKDLLARARTGTGKTLAFALP  58



>gb|KFK39521.1| hypothetical protein AALP_AA3G255300 [Arabis alpina]
Length=606

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            D  AI+   IS  + +ALK +GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  117  DGLAISELGISPEIVKALKGRGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  176



>ref|XP_010488255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Camelina sativa]
Length=594

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  176



>ref|XP_009108947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Brassica 
rapa]
Length=617

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E    G DM+GRARTG
Sbjct  88   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPATQGRDMIGRARTG  147

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  148  TGKTLAFGIP  157



>ref|XP_010488254.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Camelina sativa]
Length=606

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  176



>emb|CAD98303.1| DEAD/DEAH box helicase, possible [Cryptosporidium parvum]
Length=688

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E   +I  F +S   RE L+++GIE LF IQA +FE++    D++G+A+TG GKTLAF
Sbjct  9    ESEVDGSIDRFPLSDESREILRSRGIERLFPIQAQSFESIYGKKDVLGKAKTGTGKTLAF  68

Query  655  VLP  663
            VLP
Sbjct  69   VLP  71



>ref|XP_666695.1| DEAD/DEAH box helicase [Cryptosporidium hominis TU502]
Length=678

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E   +I  F +S   RE L+++GIE LF IQA +FE++    D++G+A+TG GKTLAF
Sbjct  9    ESEVDGSIDRFLLSDESREILRSRGIERLFPIQAQSFESIYGKKDVLGKAKTGTGKTLAF  68

Query  655  VLP  663
            VLP
Sbjct  69   VLP  71



>ref|XP_009919521.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Haliaeetus 
albicilla]
Length=238

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  56   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  115

Query  655  VLP  663
             LP
Sbjct  116  ALP  118



>gb|EFB22545.1| hypothetical protein PANDA_001614 [Ailuropoda melanoleuca]
Length=765

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+   A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  155  EQKEGAFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  214

Query  658  LP  663
            +P
Sbjct  215  IP  216



>ref|XP_627813.1| nucleolar protein GU2. eIF4A-1-family. RNA SFII helicase [Cryptosporidium 
parvum Iowa II]
 gb|EAK90174.1| nucleolar protein GU2. eIF4A-1-family. RNA SFII helicase [Cryptosporidium 
parvum Iowa II]
Length=738

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            E E   +I  F +S   RE L+++GIE LF IQA +FE++    D++G+A+TG GKTLAF
Sbjct  59   ESEVDGSIDRFPLSDESREILRSRGIERLFPIQAQSFESIYGKKDVLGKAKTGTGKTLAF  118

Query  655  VLP  663
            VLP
Sbjct  119  VLP  121



>emb|CBJ26838.1| DEAD box helicase [Ectocarpus siliculosus]
Length=694

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            ++  F IS+  +  L+ +GI +LF IQA TFE +  G D++GRARTG GKTLAF +P
Sbjct  148  SVDEFDISETTKGHLRNRGITTLFPIQAQTFEHIRRGKDLIGRARTGMGKTLAFAVP  204



>ref|XP_002913778.1| PREDICTED: nucleolar RNA helicase 2 [Ailuropoda melanoleuca]
Length=794

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+   A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184  EQKEGAFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658  LP  663
            +P
Sbjct  244  IP  245



>ref|XP_010295282.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Phaethon lepturus]
Length=703

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A TNF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  102  EEAKEGAFTNFPLSQDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  161

Query  655  VLP  663
             LP
Sbjct  162  ALP  164



>ref|XP_005235246.1| PREDICTED: nucleolar RNA helicase 2-like [Falco peregrinus]
Length=670

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG GKT AF
Sbjct  93   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFAF  152

Query  655  VLP  663
             LP
Sbjct  153  ALP  155



>ref|XP_005433605.1| PREDICTED: nucleolar RNA helicase 2-like [Falco cherrug]
Length=675

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG GKT AF
Sbjct  98   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFAF  157

Query  655  VLP  663
             LP
Sbjct  158  ALP  160



>ref|XP_007054739.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=678

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+   A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F 
Sbjct  108  EQKEGAFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSFA  167

Query  658  LP  663
            +P
Sbjct  168  IP  169



>ref|XP_010466510.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Camelina 
sativa]
Length=605

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI+   IS  + ++LKA+GIE LF IQ    E  ++G DM+GRARTG GKTLAF +P
Sbjct  119  AISELGISPEIVKSLKARGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAFGIP  175



>ref|NP_188870.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
 sp|Q9LUW6.1|RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9 [Arabidopsis 
thaliana]
 dbj|BAB01768.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM14042.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE76620.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
Length=610

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI +  IS  + +ALK +GIE LF IQ    E  ++G DM+GRARTG GKTLAF +P
Sbjct  117  AIADLGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAFGIP  173



>ref|XP_004344972.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95811.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
Length=793

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  469  DEEEEDP-YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
            DEE ++  +A+ NF +S      L A+GI +LF IQA T+  + +G D+V +ARTG GKT
Sbjct  187  DEEADNSEFALKNFGVSATSIANLHAQGIRTLFPIQAQTYHPIFEGKDIVAQARTGSGKT  246

Query  646  LAFVLP  663
            L+F LP
Sbjct  247  LSFALP  252



>ref|XP_005297366.1| PREDICTED: nucleolar RNA helicase 2-like [Chrysemys picta bellii]
Length=699

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E+   A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F 
Sbjct  129  EQKEGAFSNFCISKGTIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSFA  188

Query  658  LP  663
            +P
Sbjct  189  IP  190



>gb|EPY22928.1| nucleolar RNA helicase II [Strigomonas culicis]
 gb|EPY23267.1| nucleolar RNA helicase II [Strigomonas culicis]
Length=672

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  505  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            F ++  + +ALKAKGI++LF +QA+TF+A++ G D++ +ARTG GKTLAF +P
Sbjct  87   FDLTADMVKALKAKGIDALFPVQALTFDAIMKGKDVLVQARTGSGKTLAFGIP  139



>ref|XP_009064553.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
 gb|ESO84752.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
Length=719

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = +1

Query  463  GGDEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
            G  EEE  P     A +NFRIS    + L+  GI  LF +Q+ TF+ V  G+D++ +ART
Sbjct  108  GKQEEELSPQQKAGAFSNFRISPNTVKKLQKNGITYLFPVQSETFDIVYSGSDIITQART  167

Query  631  GQGKTLAFVLP  663
            G GKTLAF LP
Sbjct  168  GTGKTLAFSLP  178



>ref|XP_010466515.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Camelina sativa]
Length=631

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  156

Query  658  LP  663
            +P
Sbjct  157  IP  158



>ref|XP_845112.1| nucleolar RNA helicase II [Trypanosoma brucei brucei TREU927]
 gb|AAX70758.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAX80591.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAZ11553.1| nucleolar RNA helicase II, putative [Trypanosoma brucei brucei 
TREU927]
 emb|CBH11456.1| nucleolar RNA helicase Gu, putative [Trypanosoma brucei gambiense 
DAL972]
Length=632

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 8/78 (10%)
 Frame = +1

Query  454  EAVGGDEEEEDPYA--------ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTD  609
            E  G +E +++P           + F +S  + +AL+A+GI SLF +QA+TFEA++ G D
Sbjct  25   EMTGNEETDQEPNNGSAAVGRPFSEFNLSSGMVKALEAQGIVSLFPVQALTFEAIMRGED  84

Query  610  MVGRARTGQGKTLAFVLP  663
            ++ +ARTG GKTLAF +P
Sbjct  85   VLVQARTGSGKTLAFGIP  102



>ref|XP_010466514.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=635

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  156

Query  658  LP  663
            +P
Sbjct  157  IP  158



>ref|XP_010466512.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=645

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  478  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF 
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFG  156

Query  658  LP  663
            +P
Sbjct  157  IP  158



>ref|XP_002130533.1| PREDICTED: nucleolar RNA helicase 2 [Ciona intestinalis]
Length=672

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +1

Query  469  DEEEEDPYAI---TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
            D +++ P A+    NFRI++  +  LK KG+  LF IQ  +F  V DG D+V +ARTG G
Sbjct  80   DIDDQSPEALGDFNNFRITEQTKVLLKKKGVAYLFPIQIQSFNHVYDGKDVVAQARTGTG  139

Query  640  KTLAFVLP  663
            KTL+F +P
Sbjct  140  KTLSFAIP  147



>ref|XP_002461445.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
 gb|EER97966.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
Length=602

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +1

Query  454  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
            E VG D   E+   I    IS  + E L A+GI  LF IQ    E  + G DM+GRARTG
Sbjct  74   EGVGVDTGAEEGLEIARLWISPRIVEKLAARGITKLFPIQRAVLEPAMQGKDMIGRARTG  133

Query  634  QGKTLAFVLP  663
             GKTLAF +P
Sbjct  134  TGKTLAFGIP  143



>ref|XP_009993187.1| PREDICTED: nucleolar RNA helicase 2-like [Chaetura pelagica]
Length=681

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF +S+   + LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F +P
Sbjct  110  AFSNFPLSQNTIDLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTGTGKTFSFAIP  166



>ref|XP_011449590.1| PREDICTED: nucleolar RNA helicase 2-like [Crassostrea gigas]
Length=676

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  499  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            +NFR+S    E LK + +  LF IQ  TF+ V +G D++G+ARTG GKTL+F LP
Sbjct  176  SNFRLSDVTVEKLKKRNVNYLFPIQYKTFDHVYNGEDVIGQARTGTGKTLSFALP  230



>gb|KCW88483.1| hypothetical protein EUGRSUZ_A00875 [Eucalyptus grandis]
Length=435

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  400  LVEPVNFkaekkkkakLMEAVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKI  570
            LV+P N K +KKKK K      GD+E   EE+P  ++NFRIS  LR  LK  GI++LF I
Sbjct  97   LVDPENLKGKKKKKKKKTRLSDGDDEVAQEENPTVVSNFRISDSLRLKLKDNGIDALFPI  156

Query  571  QAMTFEAVLDGTDMV  615
            Q M F+ VLDGTD+V
Sbjct  157  QTMRFDIVLDGTDLV  171



>gb|ERZ97705.1| hypothetical protein GLOINDRAFT_340006 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX63905.1| Ded1p [Rhizophagus irregularis DAOM 197198w]
Length=763

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +1

Query  463  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
            G ++E  +   ++ +R+S+   + LK + IE+LF IQA TF+ + DG D++ RA+TG GK
Sbjct  148  GVEKEIPENLRLSTYRLSQTTIDLLKKREIEALFPIQAATFDMIYDGKDVLARAKTGTGK  207

Query  643  TLAFVLP  663
            TLAFVLP
Sbjct  208  TLAFVLP  214



>ref|XP_007514064.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15501.1| predicted protein [Bathycoccus prasinos]
Length=935

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            DP +I NF +      ALK KGIE+LF IQ    E    G D+V RA+TG GKTLAF LP
Sbjct  218  DPTSINNFNLHPITIAALKKKGIETLFPIQVAALEPAQSGRDVVARAKTGTGKTLAFSLP  277



>ref|XP_006676381.1| hypothetical protein BATDEDRAFT_84954 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84232.1| hypothetical protein BATDEDRAFT_84954 [Batrachochytrium dendrobatidis 
JAM81]
Length=764

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  529  EALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            E+LKA+GI  LF IQA +F+ ++ G D++GRARTG GKTLAF LP
Sbjct  154  ESLKARGIVQLFPIQAASFDPIIKGMDLLGRARTGTGKTLAFSLP  198



>ref|XP_009487807.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Pelecanus 
crispus]
Length=581

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ V DG D++ +ARTG GKT +F
Sbjct  4    EEAKEGAFSNFPLSQDTLNLLKARGVKYLFPVQVKTFQPVYDGKDLIAQARTGTGKTFSF  63

Query  655  VLP  663
             LP
Sbjct  64   ALP  66



>ref|XP_010511242.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Camelina sativa]
Length=591

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            I+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  120  ISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  175



>ref|XP_008943828.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Merops nubicus]
Length=599

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EEE   A +NF +S+     L+A+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  21   EEEKEGAFSNFPLSQNTISLLRARGVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  80

Query  655  VLP  663
             LP
Sbjct  81   ALP  83



>ref|XP_002883354.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59613.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            AI+   IS  + +ALK +GIE LF IQ    E  + G DM+GRARTG GKTLAF +P
Sbjct  121  AISELGISPEIVKALKGRGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAFGIP  177



>ref|XP_010164383.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Caprimulgus 
carolinensis]
Length=630

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF IS+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  53   EEAKEGAFSNFPISEDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  112

Query  655  VLP  663
             LP
Sbjct  113  ALP  115



>ref|XP_007902730.1| PREDICTED: nucleolar RNA helicase 2-like [Callorhinchus milii]
Length=735

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            +E+   A +NF+IS+   E LK +G+  LF IQ  TF  V +G D V +ARTG GKT +F
Sbjct  144  QEQREGAFSNFKISQETIELLKGRGVTYLFPIQVQTFNFVYNGQDCVAQARTGTGKTFSF  203

Query  655  VLP  663
             +P
Sbjct  204  AIP  206



>ref|XP_009581978.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Fulmarus glacialis]
Length=610

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKTL+F
Sbjct  58   EEAKEGAFSNFPLSENTINLLKARGVKYLFPVQVETFQPIYDGKDLIAQARTGTGKTLSF  117

Query  655  VLP  663
             LP
Sbjct  118  ALP  120



>ref|XP_009674650.1| PREDICTED: nucleolar RNA helicase 2-like [Struthio camelus australis]
Length=597

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +1

Query  457  AVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
              GG EE   E    A +NF +SK     LKA+G++ LF +Q  TF+ + DG D++ +AR
Sbjct  11   CAGGPEELTEEAREGAFSNFPLSKNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQAR  70

Query  628  TGQGKTLAFVLP  663
            TG GKT +F +P
Sbjct  71   TGTGKTFSFAIP  82



>ref|XP_010073942.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Pterocles 
gutturalis]
Length=575

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE +  A +NF +SK     LKA+ ++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  4    EEAEEGAFSNFPLSKNTINLLKARCVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  63

Query  655  VLP  663
            VLP
Sbjct  64   VLP  66



>gb|EDL92964.1| rCG22008, isoform CRA_a [Rattus norvegicus]
Length=283

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F +P
Sbjct  183  AFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIP  239



>ref|XP_004992590.1| DEAD box polypeptide 47 isoform 1 [Salpingoeca rosetta]
 gb|EGD74945.1| DEAD box polypeptide 47 isoform 1 [Salpingoeca rosetta]
Length=711

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  493  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
            A+ NF IS   R  L+  G + LF IQA TF+ ++ G D+ G+ARTG+GKTL+F LP
Sbjct  117  ALDNFDISDKSRNNLEKHGYKYLFPIQAKTFDLIMAGNDIFGKARTGEGKTLSFALP  173



>ref|XP_005713628.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-like, putative [Chondrus 
crispus]
 emb|CDF33809.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-like, putative [Chondrus 
crispus]
Length=740

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  484  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAV-LDGTDMVGRARTGQGKTLAFVL  660
            D  A+ +F +S    + LK KGIESLF IQA TF+ +  +  D++GRARTG GKTLAFVL
Sbjct  122  DTNAVASFGMSDITVKLLKDKGIESLFDIQAATFKMLRTEKKDVIGRARTGSGKTLAFVL  181

Query  661  P  663
            P
Sbjct  182  P  182



>ref|XP_008924427.1| PREDICTED: nucleolar RNA helicase 2-like [Manacus vitellinus]
Length=696

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     L A+G++ LF +QA TF+ + DG D++ +ARTG GKTL+F
Sbjct  128  EEAKEGAFSNFPLSQNTINLLTARGVKYLFPVQAKTFQPIYDGKDVIAQARTGTGKTLSF  187

Query  655  VLP  663
             LP
Sbjct  188  ALP  190



>ref|XP_006380943.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
 gb|ERP58740.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
Length=593

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = +1

Query  409  PVNFkaekkkkakLMEA-VGGDEEE----EDPYAITNFRISKPLREALKAKGIESLFKIQ  573
            P++FKA    +A +  A  G DEE+    E+   I+N  ISK +  +L  KGI  LF IQ
Sbjct  72   PLDFKASSVTQAGIAVADYGSDEEKGKGSEEGLEISNLGISKEIVNSLAKKGITKLFPIQ  131

Query  574  AMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
                E  + G DM GRARTG GKTLAF +P
Sbjct  132  KAVLEPAMQGKDMFGRARTGTGKTLAFGIP  161



>emb|CDY37406.1| BnaC05g30240D [Brassica napus]
Length=510

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 8/75 (11%)
 Frame = +1

Query  463  GGDEEEE--------DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVG  618
            GGD EE         D  AI++  IS  + +AL  +GI+ LF IQ    E  + G DM+G
Sbjct  97   GGDSEESVGSSGDGGDGLAISDLGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIG  156

Query  619  RARTGQGKTLAFVLP  663
            RARTG GKTLAF +P
Sbjct  157  RARTGTGKTLAFGIP  171



>ref|XP_009990339.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Tauraco erythrolophus]
Length=581

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTGTGKTFSF  63

Query  655  VLP  663
             +P
Sbjct  64   AVP  66



>emb|CDY37408.1| BnaC05g30220D [Brassica napus]
Length=601

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 8/75 (11%)
 Frame = +1

Query  463  GGDEEEE--------DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVG  618
            GGD EE         D  AI++  IS  + +AL  +GI+ LF IQ    E  + G DM+G
Sbjct  97   GGDSEESVGSSGDGGDGLAISDLGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIG  156

Query  619  RARTGQGKTLAFVLP  663
            RARTG GKTLAF +P
Sbjct  157  RARTGTGKTLAFGIP  171



>ref|XP_009288813.1| PREDICTED: nucleolar RNA helicase 2-like [Aptenodytes forsteri]
Length=615

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  38   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  97

Query  655  VLP  663
             LP
Sbjct  98   ALP  100



>ref|XP_009324263.1| PREDICTED: nucleolar RNA helicase 2-like [Pygoscelis adeliae]
Length=711

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  475  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  134  EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  193

Query  655  VLP  663
             LP
Sbjct  194  ALP  196



Lambda      K        H        a         alpha
   0.315    0.130    0.362    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960