BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030I21

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  92.0    6e-18   Nicotiana tomentosiformis
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  87.4    2e-16   Solanum tuberosum [potatoes]
emb|CDX92008.1|  BnaC03g33100D                                        84.0    5e-16   
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  84.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  83.6    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  83.2    6e-15   Solanum lycopersicum
ref|XP_002884331.1|  tRNA synthetase class I family protein           83.2    7e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg           83.2    7e-15   
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  82.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  82.0    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  80.1    8e-14   Brassica rapa
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  79.0    2e-13   Brassica rapa
emb|CDX74240.1|  BnaA03g28070D                                        79.0    2e-13   
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  79.0    2e-13   Brassica rapa
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  78.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  78.6    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  78.2    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  78.2    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  77.8    3e-13   Fragaria vesca subsp. vesca
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  77.8    4e-13   
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  77.8    4e-13   Nicotiana sylvestris
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  77.4    5e-13   Prunus mume [ume]
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg           77.4    5e-13   Prunus persica
ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  77.4    5e-13   Nicotiana tomentosiformis
ref|NP_186915.1|  tyrosyl-tRNA synthetase                             77.0    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   Fragaria vesca subsp. vesca
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  75.5    2e-12   
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg           74.3    5e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  73.2    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  72.0    3e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  68.6    4e-10   Elaeis guineensis
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  68.6    4e-10   Phoenix dactylifera
gb|KJB12925.1|  hypothetical protein B456_002G045400                  68.2    5e-10   Gossypium raimondii
emb|CDP19091.1|  unnamed protein product                              67.4    1e-09   Coffea canephora [robusta coffee]
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  67.0    1e-09   Phoenix dactylifera
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  66.2    2e-09   
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  66.2    2e-09   
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                66.2    3e-09   
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                65.5    4e-09   
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                 65.1    5e-09   Citrus sinensis [apfelsine]
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  65.1    6e-09   Citrus sinensis [apfelsine]
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg           62.0    7e-08   Citrus clementina [clementine]
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                   60.1    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  59.7    3e-07   Eucalyptus grandis [rose gum]
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  59.7    4e-07   Glycine max [soybeans]
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg              59.7    4e-07   Erythranthe guttata [common monkey flower]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                               59.3    5e-07   Medicago truncatula
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like            58.9    7e-07   Cicer arietinum [garbanzo]
gb|KEH32330.1|  tyrosyl-tRNA synthetase                               58.5    8e-07   Medicago truncatula
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  58.5    9e-07   Glycine max [soybeans]
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g           57.8    1e-06   Phaseolus vulgaris [French bean]
gb|KDP41896.1|  hypothetical protein JCGZ_26914                       57.8    2e-06   Jatropha curcas
gb|KHN08832.1|  Tyrosine--tRNA ligase                                 57.8    2e-06   Glycine soja [wild soybean]
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.6    3e-06   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886           56.6    4e-06   Selaginella moellendorffii
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175           56.6    4e-06   
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg              56.2    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like            56.2    5e-06   Cucumis sativus [cucumbers]
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  56.2    5e-06   
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like            56.2    6e-06   
ref|XP_001751567.1|  predicted protein                                55.8    7e-06   
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  55.5    9e-06   Populus euphratica
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          52.8    9e-05   Parachlamydia acanthamoebae
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          52.4    1e-04   
ref|NP_001043131.1|  Os01g0500900                                     49.7    8e-04   
gb|EAZ12037.1|  hypothetical protein OsJ_01916                        49.7    0.001   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  324  ARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKS  503
            A   ++RTF+LN   + F+  F++   +          SL  +S  P CS +  +   + 
Sbjct  3    AGAGAIRTFLLNATQKPFTSSFLKNISLPTCLFLHNCLSLRSFSHRPFCSISTQLTSQED  62

Query  504  EPEMESDQ---RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
             P+ E+ Q   ++ R NV++ILEERGLLESVT+++LRS+CSDPNL PLKVYCGFD
Sbjct  63   TPQPENFQHSNKKTRPNVLQILEERGLLESVTNDSLRSVCSDPNLGPLKVYCGFD  117



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +3

Query  333  ASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKSEPE  512
            + +R+ +LN   R F+  F++K P+          S   +S  P CS +   P   S+ +
Sbjct  12   SGLRSLLLNTTLRPFTSSFLRKLPLPTYLFLPNTPSHHNFSHRPFCSIS---PLTTSQED  68

Query  513  MESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
              S+   + R NV+ ILEERGLLESVTS++LRS+CSDPNL PLKVYCGFD
Sbjct  69   NFSNPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFD  118



>emb|CDX92008.1| BnaC03g33100D [Brassica napus]
Length=262

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 7/72 (10%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S +PL SS +F     S   +E+     R NVV+ILEERGLLESVTSENLRS CSDP
Sbjct  49   FSTSRAPLFSSVKF-----STSSLET--AASRSNVVDILEERGLLESVTSENLRSACSDP  101

Query  624  NLPPLKVYCGFD  659
            N+ PLKVYCGFD
Sbjct  102  NVAPLKVYCGFD  113



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            +  S++PL SS +   Q  S PE  + Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   YSTSTTPLFSSVRCSVQSTSSPETLT-QAASRPNVVDILEERGLLESITSENLRSACSDP  110

Query  624  NLPPLKVYCGFD  659
             + PLKVYCGFD
Sbjct  111  KVAPLKVYCGFD  122



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            +  S++PL SSA+   Q  S PE  S Q   R NVV+ILEERGLLES+TS NLRS CSDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVS-QAVSRPNVVDILEERGLLESITSNNLRSACSDP  110

Query  624  NLPPLKVYCGFD  659
             + PL+VYCGFD
Sbjct  111  KVTPLRVYCGFD  122



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 4/119 (3%)
 Frame = +3

Query  306  CADNTNARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQF  485
             A    A  + +R+ +LN   R F+   ++  P+          S   +S  P CS +  
Sbjct  2    AAAGAGAINSGLRSLLLNTTLRPFTSSLLRILPLPTYVFLPNTPSRHNFSHRPFCSIS--  59

Query  486  IPQLKSEPEMESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
             P   S+ ++ S    + R NV+ ILEERGLLESVTS++LRS+CSDPNL PLKVYCGFD
Sbjct  60   -PLPASQEDIFSKPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFD  117



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL SS +   Q  S  E E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   FSTSTTPLFSSVKCSIQSTSSLETE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  110

Query  624  NLPPLKVYCGFD  659
             + PL+VYCGFD
Sbjct  111  KVAPLRVYCGFD  122



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL S  +   Q  S P+ E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  89   FSTSTTPLFSYVKCSVQSTSTPQTE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  147

Query  624  NLPPLKVYCGFD  659
             + PL+VYCGFD
Sbjct  148  KVAPLRVYCGFD  159



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  110

Query  624  NLPPLKVYCGFD  659
             + PL+VYCGFD
Sbjct  111  KVAPLRVYCGFD  122



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  46   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  104

Query  624  NLPPLKVYCGFD  659
             + PL+VYCGFD
Sbjct  105  KVAPLRVYCGFD  116



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL     F P   S  E E  Q   R NVV+IL+ERGLLESVTSENLRS CSDP
Sbjct  52   FSTSTTPL-----FAPVKCSTLETEV-QAVSRPNVVDILQERGLLESVTSENLRSACSDP  105

Query  624  NLPPLKVYCGFD  659
            N+ PLKVYCGFD
Sbjct  106  NVAPLKVYCGFD  117



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  624  NLPPLKVYCGFD  659
            N+ PLKVYCGFD
Sbjct  103  NVAPLKVYCGFD  114



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  624  NLPPLKVYCGFD  659
            N+ PLKVYCGFD
Sbjct  103  NVAPLKVYCGFD  114



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 7/72 (10%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  70   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  122

Query  624  NLPPLKVYCGFD  659
            N+ PLKVYCGFD
Sbjct  123  NVAPLKVYCGFD  134



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 3/52 (6%)
 Frame = +3

Query  504  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            EPE   +Q   R NVV+ILEERGLLES+TSENLRS CSDP L PLKVYCGFD
Sbjct  72   EPE---NQVASRPNVVDILEERGLLESITSENLRSACSDPTLGPLKVYCGFD  120



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSENLRS CS+PNL PLKVYCGFD
Sbjct  76   RLNVVEILEERGLLESITSENLRSACSNPNLNPLKVYCGFD  116



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPLKVYCGFD
Sbjct  58   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFD  98



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPLKVYCGFD
Sbjct  62   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFD  102



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +3

Query  450  YSSSPLCSSAQF-IPQLKSEPEMESDQR-----QRRRNVVEILEERGLLESVTSENLRSI  611
            Y S PLC  + F +P+    P + S  +       R+NVV+ILEERGLLES+TSE LR  
Sbjct  20   YYSLPLCVPSFFRVPRFHRNPILLSAVKCLQSSSGRQNVVDILEERGLLESLTSEQLRHA  79

Query  612  CSDPNLPPLKVYCGFD  659
            CSDP++PPLKVYCGFD
Sbjct  80   CSDPSIPPLKVYCGFD  95



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR  CSDPNLPPLKVYCGFD
Sbjct  58   RPNVVEILEERGLLESITSEHLRQSCSDPNLPPLKVYCGFD  98



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 50/73 (68%), Gaps = 6/73 (8%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  620
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNSNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  621  PNLPPLKVYCGFD  659
             NL PLKVYCGFD
Sbjct  106  SNLGPLKVYCGFD  118



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPLKVYCGFD
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFD  100



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPLKVYCGFD
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFD  100



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 6/73 (8%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  620
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNNNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  621  PNLPPLKVYCGFD  659
             N  PLKVYCGFD
Sbjct  106  SNFGPLKVYCGFD  118



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +3

Query  501  SEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            S PE E +Q   R NVV+ILEERGLLES+TSENLRS CSDP + PL+VYCGFD
Sbjct  71   SSPETE-NQAVFRPNVVDILEERGLLESITSENLRSACSDPKVAPLRVYCGFD  122



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  534  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RR NV++ILEERGLLES+TSE LR  CSDP++PPLKVYCGFD
Sbjct  59   RRHNVIDILEERGLLESMTSEQLRHACSDPSVPPLKVYCGFD  100



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFD
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFD  98



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR +CSDP LPPLKVYCGFD
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFD  102



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR +CSDP LPPLKVYCGFD
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFD  98



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFD
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFD  98



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R NVVEILEERGLLES+TSE+LR +C+DPNL PLKVYCGFD
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFD  102



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 10/72 (14%)
 Frame = +3

Query  444  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  623
            F  S++PL SS +   Q              R NVV+ILEERGLLES+TSE+LRS CSDP
Sbjct  52   FSASTTPLLSSVKCSIQ----------STVSRPNVVDILEERGLLESITSESLRSACSDP  101

Query  624  NLPPLKVYCGFD  659
            ++ PLKVYCGFD
Sbjct  102  SVAPLKVYCGFD  113



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  471  SSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYC  650
            SS+Q  P+    P    D   R  NVV+IL+ERGL+ES+TSENLRS CS P   PLKVYC
Sbjct  49   SSSQPAPETLEAPIQGLDSSTRAPNVVDILQERGLIESITSENLRSACSTPAANPLKVYC  108

Query  651  GFD  659
            GFD
Sbjct  109  GFD  111



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +3

Query  528  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLPPLKVYCGFD  659
            +QR RNVVEILEERGL+ES+TS+NLRS  S D N PPLKVYCGFD
Sbjct  68   QQRSRNVVEILEERGLIESITSDNLRSASSLDNNHPPLKVYCGFD  112



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  492  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  656
            Q  ++P +E   R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PLKVYCGF
Sbjct  43   QSATQPTLEDSTRNLDSIAGIPNVVDILQERGLVESITSESIRSACSNPSISPLKVYCGF  102

Query  657  D  659
            D
Sbjct  103  D  103



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 5/61 (8%)
 Frame = +3

Query  492  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  656
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PLKVYCGF
Sbjct  43   QSAAQPTLEAQARNLDSLAGIPNVVDILQERGLVESITSESIRSACSNPSVSPLKVYCGF  102

Query  657  D  659
            D
Sbjct  103  D  103



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +3

Query  489  PQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            PQ   EP+    Q     NVV+ILEERGLLES+T+ENLR +CSD    PLKVYCGFD
Sbjct  46   PQPTVEPKF---QMGSTPNVVKILEERGLLESITNENLRLVCSDQTAGPLKVYCGFD  99



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 47/74 (64%), Gaps = 9/74 (12%)
 Frame = +3

Query  450  YSSSPLCS--SAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSD-  620
            YS+S L S  +A    QL       S       NVVEILE+RGLLES+TS+ LRS+CS  
Sbjct  68   YSTSSLLSQEAAAVASQLP-----RSHAANTSSNVVEILEQRGLLESLTSDGLRSVCSSS  122

Query  621  -PNLPPLKVYCGFD  659
             PN PPL+VYCGFD
Sbjct  123  APNQPPLRVYCGFD  136



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +3

Query  492  QLKSEPEMESDQRQRR-----RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGF  656
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P + PLKVYCGF
Sbjct  42   QSAAQPTLEAQARNLDSPSGIANVVDILQERGLVESITSESIRSACSNPIVSPLKVYCGF  101

Query  657  D  659
            D
Sbjct  102  D  102



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFD
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFD  99



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFD
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFD  99



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILEERGLLESVT+ENLR  CSD    PLKVYCGFD
Sbjct  117  NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFD  155



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 3/42 (7%)
 Frame = +3

Query  534  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RR+NVV+ILEERGLLESVTS+NLRS CS   +  LKVYCGFD
Sbjct  63   RRQNVVDILEERGLLESVTSDNLRSACS---ISTLKVYCGFD  101



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +3

Query  456  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  635
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  45   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  101

Query  636  LKVYCGFD  659
            LKVYCGFD
Sbjct  102  LKVYCGFD  109



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +3

Query  456  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  635
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  99

Query  636  LKVYCGFD  659
            LKVYCGFD
Sbjct  100  LKVYCGFD  107



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  456  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  635
            +S   SS   + QL+S+P+ ++    R  NVV+  E RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVQQLQSDPQTQT--HGRHPNVVDTFERRGLLESITSDNLRSLAS-SNEKT  99

Query  636  LKVYCGFD  659
            LKVYCGFD
Sbjct  100  LKVYCGFD  107



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NVV++LEERGLLESVTSENLRS CS  +   L+VYCGFD
Sbjct  48   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFD  84



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 2/39 (5%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NVV++LEERGLLESVTSENLRS CS  +   L+VYCGFD
Sbjct  75   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFD  111



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV+ ILEERGL+ES+TS+ LRS C  P  PPLKVYCGFD
Sbjct  59   NVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFD  95



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 4/40 (10%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RNVVEILEERGLLES+T + LR     PN PPL+VYCGFD
Sbjct  44   RNVVEILEERGLLESLTGDALRR----PNHPPLRVYCGFD  79



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RNV+ ILEERGLL+S+T+++LRSI S+    PLKVYCGFD
Sbjct  59   RNVIRILEERGLLDSLTNDSLRSISSNTINAPLKVYCGFD  98



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R+VV ILEERGLL+S+T++ LRSI S+    PLKVYCGFD
Sbjct  58   RSVVGILEERGLLDSITNDTLRSISSNTINAPLKVYCGFD  97



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  525  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            Q Q+  NV+ ILE+RGLL+S+T+E+LR+I S+    PLKVYCGFD
Sbjct  43   QHQQPPNVIGILEQRGLLDSITNESLRTISSNTINAPLKVYCGFD  87



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +3

Query  525  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            +R    NV+ ILEERGL+ES+TS+ LRS C  P   PLKVYCGFD
Sbjct  51   RRNNNYNVIGILEERGLVESITSDALRSACLTP--APLKVYCGFD  93



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 4/45 (9%)
 Frame = +3

Query  525  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            Q+Q  RNV+EILEERGL+ES+TS+ LR+ CS      +KVYCGFD
Sbjct  46   QQQPLRNVIEILEERGLVESITSDALRAACS----SSVKVYCGFD  86



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = +3

Query  534  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            R  NVV+ILEERGLLES+TS+NLRSI S  N   ++VYCGFD
Sbjct  79   RHPNVVDILEERGLLESLTSDNLRSISSTSN--NVRVYCGFD  118



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 7/50 (14%)
 Frame = +3

Query  525  QRQRRRN-----VVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            Q+Q RRN     V+ ILEERGL+ES+TS+ LRS C  P  PPLKVYCGFD
Sbjct  45   QQQPRRNNNNNNVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFD  92



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RRNVV ILEERGLL+S+TS+ LR    D  LPPL+VYCGFD
Sbjct  42   RRNVVHILEERGLLDSLTSDALRR--PDLPLPPLRVYCGFD  80



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RRNVVEILE+RGL+ES+  E+L+  C +    P+KVYCGFD
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDE---KPIKVYCGFD  86



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RRNVVEILE+RGL+ES+  E+L+  C +    P+KVYCGFD
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDE---KPIKVYCGFD  86



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 4/40 (10%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RNVVEILEERGLLES+T + LR      N PPL+VYCGFD
Sbjct  44   RNVVEILEERGLLESLTGDALRR----QNHPPLRVYCGFD  79



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 4/39 (10%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFD
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFD  101



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 4/39 (10%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFD
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFD  101



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 4/39 (10%)
 Frame = +3

Query  543  NVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            NV++ILE+RGLL+S+TS+NLRS     +L PLKVYCGFD
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFD  101



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RNVVE+LEERGL+ESVTSE L++ C       LKVYCGFD
Sbjct  78   RNVVEVLEERGLIESVTSEELKATCMKQR---LKVYCGFD  114



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +3

Query  522  DQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            D  + R +VV+ILEERGLLES+TS+NLRSI +      LK YCGFD
Sbjct  59   DPMRSRSSVVDILEERGLLESITSDNLRSISTTST---LKAYCGFD  101



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 4/40 (10%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            +NV++IL+ERG +E++TS NL+ I S     PLKVYCGFD
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFD  37



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 4/40 (10%)
 Frame = +3

Query  540  RNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            +NV++IL+ERG +E++TS NL+ I S     PLKVYCGFD
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFD  37



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RR+VVE+L ERGL+E+ TSE+L S  + P    LK YCGFD
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFD  84



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +3

Query  537  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLKVYCGFD  659
            RR+VVE+L ERGL+E+ TSE+L S  + P    LK YCGFD
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFD  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780