BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030G16

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010265651.1|  PREDICTED: uncharacterized protein LOC104603339    128   7e-32   Nelumbo nucifera [Indian lotus]
gb|KDO59427.1|  hypothetical protein CISIN_1g022941mg                   126   1e-31   Citrus sinensis [apfelsine]
ref|XP_006453652.1|  hypothetical protein CICLE_v10009097mg             125   3e-31   
ref|XP_007011971.1|  Calcineurin-like metallo-phosphoesterase sup...    126   4e-31   Theobroma cacao [chocolate]
ref|XP_006473983.1|  PREDICTED: uncharacterized protein LOC102628519    126   5e-31   Citrus sinensis [apfelsine]
ref|XP_006453653.1|  hypothetical protein CICLE_v10009097mg             125   5e-31   
ref|XP_006453655.1|  hypothetical protein CICLE_v10009097mg             125   7e-31   
ref|XP_006453654.1|  hypothetical protein CICLE_v10009097mg             125   1e-30   Citrus clementina [clementine]
ref|XP_009761273.1|  PREDICTED: uncharacterized protein LOC104213...    123   7e-30   Nicotiana sylvestris
ref|XP_009591328.1|  PREDICTED: uncharacterized protein LOC104088...    121   4e-29   Nicotiana tomentosiformis
ref|NP_001242081.1|  uncharacterized protein LOC100808500               119   4e-29   
ref|XP_008242954.1|  PREDICTED: uncharacterized protein LOC103341243    120   6e-29   Prunus mume [ume]
gb|KJB07381.1|  hypothetical protein B456_001G031300                    116   1e-28   Gossypium raimondii
ref|XP_007202436.1|  hypothetical protein PRUPE_ppa009880mg             119   2e-28   Prunus persica
ref|XP_008336913.1|  PREDICTED: uncharacterized protein LOC103400011    118   3e-28   
ref|XP_004251764.1|  PREDICTED: uncharacterized protein LOC101246218    118   4e-28   Solanum lycopersicum
ref|XP_004288708.1|  PREDICTED: uncharacterized protein LOC101312...    117   8e-28   Fragaria vesca subsp. vesca
ref|XP_011461145.1|  PREDICTED: uncharacterized protein LOC101312...    117   9e-28   Fragaria vesca subsp. vesca
gb|KJB07376.1|  hypothetical protein B456_001G031300                    116   1e-27   Gossypium raimondii
gb|KJB07374.1|  hypothetical protein B456_001G031300                    116   1e-27   Gossypium raimondii
gb|KJB07375.1|  hypothetical protein B456_001G031300                    116   2e-27   Gossypium raimondii
ref|XP_011084007.1|  PREDICTED: uncharacterized protein LOC105166...    116   2e-27   Sesamum indicum [beniseed]
gb|KJB07380.1|  hypothetical protein B456_001G031300                    116   2e-27   Gossypium raimondii
ref|XP_009761274.1|  PREDICTED: uncharacterized protein LOC104213...    115   3e-27   Nicotiana sylvestris
ref|XP_010047135.1|  PREDICTED: uncharacterized protein LOC104436106    115   4e-27   Eucalyptus grandis [rose gum]
ref|XP_009591329.1|  PREDICTED: uncharacterized protein LOC104088...    115   6e-27   Nicotiana tomentosiformis
ref|XP_008389379.1|  PREDICTED: uncharacterized protein LOC103451733    111   1e-26   
gb|KHG29532.1|  Tartrate-resistant acid phosphatase type 5              114   2e-26   Gossypium arboreum [tree cotton]
ref|XP_009366153.1|  PREDICTED: uncharacterized protein LOC103955...    113   3e-26   
ref|XP_009358478.1|  PREDICTED: uncharacterized protein LOC103949104    113   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_010098283.1|  hypothetical protein L484_023530                   112   7e-26   
ref|XP_002324553.2|  hypothetical protein POPTR_0018s11880g             110   3e-25   
emb|CDP10206.1|  unnamed protein product                                110   3e-25   Coffea canephora [robusta coffee]
ref|XP_011017992.1|  PREDICTED: uncharacterized protein LOC105121...    109   1e-24   Populus euphratica
ref|XP_010656587.1|  PREDICTED: uncharacterized protein LOC100257...    108   1e-24   Vitis vinifera
emb|CAN67945.1|  hypothetical protein VITISV_025335                     108   2e-24   Vitis vinifera
ref|XP_010656584.1|  PREDICTED: uncharacterized protein LOC100257...    108   2e-24   
gb|KDP38654.1|  hypothetical protein JCGZ_04007                         106   1e-23   Jatropha curcas
ref|XP_011033464.1|  PREDICTED: tartrate-resistant acid phosphata...    106   1e-23   Populus euphratica
ref|XP_011017990.1|  PREDICTED: uncharacterized protein LOC105121...    105   3e-23   Populus euphratica
ref|XP_010656586.1|  PREDICTED: uncharacterized protein LOC100257...    105   3e-23   Vitis vinifera
gb|KEH37872.1|  calcineurin-like metallo-phosphoesterase superfam...  99.8    8e-22   Medicago truncatula
gb|KEH37871.1|  calcineurin-like metallo-phosphoesterase superfam...  99.8    3e-21   Medicago truncatula
gb|KFK43796.1|  hypothetical protein AALP_AA1G173800                  99.0    4e-21   Arabis alpina [alpine rockcress]
gb|KFK43795.1|  hypothetical protein AALP_AA1G173800                  99.0    4e-21   Arabis alpina [alpine rockcress]
ref|XP_006412643.1|  hypothetical protein EUTSA_v10025917mg           99.0    4e-21   Eutrema salsugineum [saltwater cress]
ref|NP_849477.1|  Calcineurin-like metallo-phosphoesterase superf...  97.4    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567863.1|  Calcineurin-like metallo-phosphoesterase superf...  97.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002523501.1|  conserved hypothetical protein                   95.1    1e-19   Ricinus communis
ref|XP_010447631.1|  PREDICTED: uncharacterized protein LOC104730196  94.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004139260.1|  PREDICTED: uncharacterized protein LOC101208944  94.7    1e-19   Cucumis sativus [cucumbers]
ref|XP_004159413.1|  PREDICTED: uncharacterized protein LOC101230039  94.7    1e-19   
ref|XP_010438095.1|  PREDICTED: uncharacterized protein LOC104721736  94.7    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008456552.1|  PREDICTED: uncharacterized protein LOC103496469  94.4    2e-19   Cucumis melo [Oriental melon]
ref|XP_006284271.1|  hypothetical protein CARUB_v10005435mg           94.0    3e-19   Capsella rubella
emb|CAA18194.1|  putative protein                                     97.8    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432916.1|  PREDICTED: uncharacterized protein LOC104717091  93.6    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009127355.1|  PREDICTED: uncharacterized protein LOC103852187  93.6    4e-19   Brassica rapa
gb|AAM65252.1|  unknown                                               93.2    5e-19   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD72545.1|  unknown protein                                      93.2    6e-19   Oryza sativa Japonica Group [Japonica rice]
emb|CDY28233.1|  BnaA01g06160D                                        92.4    9e-19   Brassica napus [oilseed rape]
ref|XP_010525815.1|  PREDICTED: uncharacterized protein LOC104803568  91.3    2e-18   Tarenaya hassleriana [spider flower]
gb|EAY99927.1|  hypothetical protein OsI_21928                        90.5    4e-18   Oryza sativa Indica Group [Indian rice]
emb|CDX68711.1|  BnaC01g07420D                                        89.0    1e-17   
ref|XP_009390567.1|  PREDICTED: uncharacterized protein LOC103976928  85.1    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841176.1|  hypothetical protein AMTR_s00086p00171090        84.7    4e-16   
ref|XP_008799627.1|  PREDICTED: uncharacterized protein LOC103714225  82.0    3e-15   Phoenix dactylifera
gb|EYU25348.1|  hypothetical protein MIMGU_mgv1a012027mg              79.7    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_010942121.1|  PREDICTED: uncharacterized protein LOC105060...  80.1    2e-14   Elaeis guineensis
gb|EYU25347.1|  hypothetical protein MIMGU_mgv1a012027mg              79.7    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_011084008.1|  PREDICTED: uncharacterized protein LOC105166...  79.3    2e-14   Sesamum indicum [beniseed]
gb|EEE65214.1|  hypothetical protein OsJ_20360                        79.7    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437963.1|  hypothetical protein SORBIDRAFT_10g005620        76.6    2e-13   Sorghum bicolor [broomcorn]
ref|XP_010656590.1|  PREDICTED: uncharacterized protein LOC104880703  73.2    4e-13   Vitis vinifera
ref|XP_006350149.1|  PREDICTED: uncharacterized protein LOC102584629  72.0    4e-13   
emb|CAN69306.1|  hypothetical protein VITISV_016078                   74.3    8e-13   Vitis vinifera
ref|XP_002869353.1|  hypothetical protein ARALYDRAFT_353720           76.3    3e-12   
ref|XP_010942120.1|  PREDICTED: uncharacterized protein LOC105060...  72.4    8e-12   
ref|NP_001145379.1|  uncharacterized protein LOC100278723             70.9    3e-11   Zea mays [maize]
gb|AFW85562.1|  hypothetical protein ZEAMMB73_864557                  70.9    3e-11   
ref|XP_007202435.1|  hypothetical protein PRUPE_ppa009880mg           68.9    5e-11   
ref|XP_003560995.1|  PREDICTED: uncharacterized protein LOC100824454  66.6    9e-10   
ref|XP_004964667.1|  PREDICTED: uncharacterized protein LOC101784573  66.6    1e-09   Setaria italica
ref|XP_010942122.1|  PREDICTED: uncharacterized protein LOC105060...  65.1    2e-09   
gb|AFW85561.1|  hypothetical protein ZEAMMB73_864557                  57.4    2e-06   
dbj|BAJ85865.1|  predicted protein                                    55.8    6e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010656589.1|  PREDICTED: uncharacterized protein LOC100257...  55.1    6e-06   
ref|XP_006655853.1|  PREDICTED: uncharacterized protein LOC102722683  50.4    2e-04   
gb|KJB07373.1|  hypothetical protein B456_001G031300                  50.1    4e-04   Gossypium raimondii



>ref|XP_010265651.1| PREDICTED: uncharacterized protein LOC104603339 [Nelumbo nucifera]
Length=297

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 91/153 (59%), Gaps = 16/153 (10%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY-----GDIDSVGTYFISVSGGFRPLQ  255
            M + SWVCTL TQV LC ALY  LN G  QRS+Y     G    +  YFISV GG RPLQ
Sbjct  1    MEKTSWVCTLVTQVCLCLALYGALNIGMPQRSVYSTAIRGGGRPLDLYFISVRGGSRPLQ  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAKSFFFS  435
            +Q HLLKQME VA+   AK+V+NISELGE DPLMQN T ++ SL+VPW +   +K   + 
Sbjct  61   QQTHLLKQMEKVARIYGAKFVVNISELGEDDPLMQNGTLHFPSLKVPWYSTSTSKGKGYF  120

Query  436  LHLSCRFSS*HGSFIFTFYK*ILDFVVFKKSSF  534
            L             I T    ILD +V + SS 
Sbjct  121  L-----------KQIATPSGQILDIIVLETSSL  142



>gb|KDO59427.1| hypothetical protein CISIN_1g022941mg [Citrus sinensis]
Length=234

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_006453652.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66892.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=234

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKAYDARFVINSSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_007011971.1| Calcineurin-like metallo-phosphoesterase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY29590.1| Calcineurin-like metallo-phosphoesterase superfamily protein, 
putative [Theobroma cacao]
Length=294

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = +1

Query  103  SWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQIHLLKQ  279
            SW+CTL+TQ++LCFALY+V+N GQ ++ +Y D    +  YFISV GGFRPL+EQ HLLK 
Sbjct  6    SWLCTLATQLSLCFALYIVINLGQPEKLVYNDNSGPLDLYFISVRGGFRPLKEQNHLLKL  65

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            ME VAK    K V+NISELGEGDPL+QN T+    L+VPW
Sbjct  66   MENVAKAYDVKLVVNISELGEGDPLLQNVTRLSPLLKVPW  105



>ref|XP_006473983.1| PREDICTED: uncharacterized protein LOC102628519 [Citrus sinensis]
 gb|KDO59426.1| hypothetical protein CISIN_1g022941mg [Citrus sinensis]
Length=289

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKSYDARFVINTSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_006453653.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66893.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=253

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKAYDARFVINSSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_006453655.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66895.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=274

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKAYDARFVINSSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_006453654.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66894.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=289

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGFRPLQ  255
            R SWVCTL TQ++LC ALY+ LN GQ Q+S+Y   + + +       YFISV+GGFRPL+
Sbjct  4    RPSWVCTLITQLSLCLALYVALNLGQPQKSIYQRTNGISSNRKGLDFYFISVTGGFRPLE  63

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LLKQME VAK   A++VIN SELGE DPL QNAT  + SL+VPW
Sbjct  64   QQTLLLKQMEDVAKAYDARFVINSSELGEDDPLKQNATWLFPSLKVPW  111



>ref|XP_009761273.1| PREDICTED: uncharacterized protein LOC104213467 isoform X1 [Nicotiana 
sylvestris]
Length=289

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQ  261
            M + SWVCT+ TQV+LC +LYLV+N  Q Q+ +     D   +  YFISV+GG RP++EQ
Sbjct  1    MMKKSWVCTIVTQVSLCLSLYLVINLCQNQKPILRNGNDNIPMDIYFISVTGGVRPIEEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LLKQ+E VAKK  A++VIN+SELGE DPL+QNATQ++ S + PW
Sbjct  61   TLLLKQVEKVAKKFNARFVINVSELGEDDPLVQNATQHFPSTKTPW  106



>ref|XP_009591328.1| PREDICTED: uncharacterized protein LOC104088376 isoform X1 [Nicotiana 
tomentosiformis]
Length=289

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS---VGTYFISVSGGFRPLQEQ  261
            M + SWVCTL TQV+LC +LYLVLN  Q Q+ +  + +    +  YFISV+GG RP +EQ
Sbjct  1    MVKKSWVCTLVTQVSLCLSLYLVLNLCQNQKPILRNGNENIPMDIYFISVTGGVRPFEEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LLKQ++ VAKK  A++VIN+SELGE DPL+QNAT+++ S ++PW
Sbjct  61   TLLLKQVQKVAKKFNARFVINVSELGEDDPLVQNATRHFPSTKIPW  106



>ref|NP_001242081.1| uncharacterized protein LOC100808500 [Glycine max]
 gb|ACU23002.1| unknown [Glycine max]
Length=233

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 8/103 (8%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTYFISVSGGFRPLQEQIHL  270
            M + SW CT+ TQV LCFALY+ LN GQ Q S          YFISV GGFRP  +Q+HL
Sbjct  1    MEKTSWACTVITQVCLCFALYIALNLGQPQTS--------DLYFISVKGGFRPFTQQLHL  52

Query  271  LKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            LKQM+ VAK   A +V++ SELGE D LMQNATQ++ SL +PW
Sbjct  53   LKQMDKVAKAYNASFVVSSSELGEYDSLMQNATQHFPSLRLPW  95



>ref|XP_008242954.1| PREDICTED: uncharacterized protein LOC103341243 [Prunus mume]
Length=274

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY----GDIDSVGTYFISVSGGFRPLQE  258
            M + SWV TL  Q  LCF+LYL    GQ Q+ +Y    G    +  YFISV GGFRPL +
Sbjct  1    MEKPSWVPTLVAQACLCFSLYLAFQLGQPQKPMYHGTSGTTRPLDLYFISVGGGFRPLNQ  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q HLLKQME V KK +AK+V++IS+LG+ DPLMQN T  + SL++PW
Sbjct  61   QTHLLKQMEKVVKKYKAKFVVDISDLGKDDPLMQNGTLLFSSLKLPW  107



>gb|KJB07381.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=173

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ TL  Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTLGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>ref|XP_007202436.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
 gb|EMJ03635.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
Length=273

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS---VGTYFISVSGGFRPLQEQ  261
            M + SWV TL  Q  LCF+LYL    GQ Q+ +Y   +    +  YFISV GGFRPL +Q
Sbjct  1    MEKPSWVPTLVAQACLCFSLYLAFQLGQPQKPMYHGTNGTRPLDLYFISVGGGFRPLNQQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLKQME V KK +AK+V++IS+LG+ DPLMQN T  + SL++PW
Sbjct  61   THLLKQMEKVVKKYKAKFVVDISDLGKDDPLMQNGTLLFSSLKLPW  106



>ref|XP_008336913.1| PREDICTED: uncharacterized protein LOC103400011 [Malus domestica]
Length=287

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRG-SWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQE  258
            MG+  SWV T+ TQV+LCF LYL    GQ +RS+     +   +  YFISV GGFRP   
Sbjct  1    MGKKPSWVPTVVTQVSLCFCLYLAFQLGQPRRSVRHGRSETRPLDLYFISVGGGFRPPTR  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q HLLKQME VAKK +A++V+++S LGE DPLMQN T ++ SL+VPW
Sbjct  61   QTHLLKQMEKVAKKYKAEFVVDVSNLGEDDPLMQNGTLHFSSLKVPW  107



>ref|XP_004251764.1| PREDICTED: uncharacterized protein LOC101246218 [Solanum lycopersicum]
Length=290

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY--GDIDSV--GTYFISVSGGFRPLQE  258
            M + SWVCTL TQ  LC +L+LVLN  Q Q+ +   G+++ +    YFISV+GG R L+E
Sbjct  1    MMKKSWVCTLITQFCLCLSLFLVLNLCQNQKPMIRNGNVNDLPMDIYFISVTGGIRTLEE  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q  LLKQ+E VAKK  A++VINISELGE DPLMQNAT  + S+++PW
Sbjct  61   QTLLLKQVEKVAKKFNARFVINISELGEDDPLMQNATWRFPSVKIPW  107



>ref|XP_004288708.1| PREDICTED: uncharacterized protein LOC101312288 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=291

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +1

Query  106  WVCTLSTQVALCFALYLVLNTGQFQRSLY--GDIDSVGTYFISVSGGFRPLQEQIHLLKQ  279
            WV T+  QV+LC  LYL    GQ Q S+Y     +S   YFISV GGFRPL++Q HLLKQ
Sbjct  7    WVPTIVAQVSLCLCLYLAFQLGQPQNSVYLHRTSESRDLYFISVRGGFRPLKQQTHLLKQ  66

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            M  VAKK +AK+V++IS+LG+ DPLMQN T ++ SL+VPW
Sbjct  67   MARVAKKYKAKFVVDISDLGKDDPLMQNGTLHFSSLKVPW  106



>ref|XP_011461145.1| PREDICTED: uncharacterized protein LOC101312288 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=289

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +1

Query  106  WVCTLSTQVALCFALYLVLNTGQFQRSLY--GDIDSVGTYFISVSGGFRPLQEQIHLLKQ  279
            WV T+  QV+LC  LYL    GQ Q S+Y     +S   YFISV GGFRPL++Q HLLKQ
Sbjct  7    WVPTIVAQVSLCLCLYLAFQLGQPQNSVYLHRTSESRDLYFISVRGGFRPLKQQTHLLKQ  66

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            M  VAKK +AK+V++IS+LG+ DPLMQN T ++ SL+VPW
Sbjct  67   MARVAKKYKAKFVVDISDLGKDDPLMQNGTLHFSSLKVPW  106



>gb|KJB07376.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=254

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ TL  Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTLGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>gb|KJB07374.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=278

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ TL  Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTLGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>gb|KJB07375.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07377.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07378.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=295

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ TL  Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTLGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>ref|XP_011084007.1| PREDICTED: uncharacterized protein LOC105166369 isoform X1 [Sesamum 
indicum]
Length=293

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVG----TYFISVSGGFRPLQE  258
            M   SW CTL TQ++LC A Y+ LN GQ Q+  +G I SVG     YFISV+GGFRPL+E
Sbjct  1    MKEKSWACTLITQLSLCIAAYIALNIGQPQKVTHGSISSVGGPTDMYFISVAGGFRPLEE  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q  LL+QM  VAK  +A++V++ISELGE D LMQNA  +    ++PW
Sbjct  61   QNLLLQQMMKVAKTYKARFVVSISELGESDSLMQNAAMFSDLQKMPW  107



>gb|KJB07380.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=296

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ TL  Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTLGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>ref|XP_009761274.1| PREDICTED: uncharacterized protein LOC104213467 isoform X2 [Nicotiana 
sylvestris]
Length=287

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 5/106 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQ  261
            M + SWVCT+ TQV+LC +LYLV+N  Q Q+ +     D   +  YFISV+GG RP++EQ
Sbjct  1    MMKKSWVCTIVTQVSLCLSLYLVINLCQNQKPILRNGNDNIPMDIYFISVTGGVRPIEEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LLKQ   VAKK  A++VIN+SELGE DPL+QNATQ++ S + PW
Sbjct  61   TLLLKQK--VAKKFNARFVINVSELGEDDPLVQNATQHFPSTKTPW  104



>ref|XP_010047135.1| PREDICTED: uncharacterized protein LOC104436106 [Eucalyptus grandis]
 gb|KCW78934.1| hypothetical protein EUGRSUZ_C00366 [Eucalyptus grandis]
Length=299

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 7/110 (6%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQ-RSLYGD--IDSVG----TYFISVSGGFRP  249
            MG+ SWVCT+ TQV LC ALY+ LN GQ Q   +Y    I S G    +YF++V GGFR 
Sbjct  1    MGKRSWVCTVFTQVCLCIALYVALNLGQPQEHRVYRKSVIRSSGRFLDSYFVTVRGGFRA  60

Query  250  LQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            L EQ  LLK +E V++   A +V+NISELG  DPLMQNATQ YQSL++PW
Sbjct  61   LNEQTRLLKLIEKVSRTYGAAFVVNISELGADDPLMQNATQRYQSLKIPW  110



>ref|XP_009591329.1| PREDICTED: uncharacterized protein LOC104088376 isoform X2 [Nicotiana 
tomentosiformis]
Length=287

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS---VGTYFISVSGGFRPLQEQ  261
            M + SWVCTL TQV+LC +LYLVLN  Q Q+ +  + +    +  YFISV+GG RP +EQ
Sbjct  1    MVKKSWVCTLVTQVSLCLSLYLVLNLCQNQKPILRNGNENIPMDIYFISVTGGVRPFEEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LLKQ   VAKK  A++VIN+SELGE DPL+QNAT+++ S ++PW
Sbjct  61   TLLLKQK--VAKKFNARFVINVSELGEDDPLVQNATRHFPSTKIPW  104



>ref|XP_008389379.1| PREDICTED: uncharacterized protein LOC103451733 [Malus domestica]
Length=163

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQIH  267
            + +WV TL TQV+LCF LYL    GQ   S+     +   +  YFISV GGFRP   Q H
Sbjct  4    KPTWVLTLVTQVSLCFCLYLAFQLGQXXSSVRHGRSERRPLDLYFISVGGGFRPPTRQTH  63

Query  268  LLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVP  396
            LLKQME VAKK +A++V+++S+LGE DPLMQN T ++ +L+VP
Sbjct  64   LLKQMEKVAKKYKAEFVVDVSDLGEDDPLMQNGTLHFSTLKVP  106



>gb|KHG29532.1| Tartrate-resistant acid phosphatase type 5 [Gossypium arboreum]
Length=312

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS-VGTYFISVSGGFRPLQEQ  261
            M     SW+ T   Q++LCFALY+VLN GQ Q+ +Y D  S    YFISV GGFR LQEQ
Sbjct  1    MERSTTSWLRTSGIQLSLCFALYIVLNLGQPQKLVYNDNGSPFDLYFISVRGGFRSLQEQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLLK M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  61   THLLKLMGYVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  106



>ref|XP_009366153.1| PREDICTED: uncharacterized protein LOC103955964 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009366154.1| PREDICTED: uncharacterized protein LOC103955964 isoform X2 [Pyrus 
x bretschneideri]
Length=295

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +1

Query  103  SWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQIHLL  273
            +WV TL TQV+LCF LYL    GQ + S+     +   +  YFISV GGFRP   Q HLL
Sbjct  6    TWVLTLVTQVSLCFCLYLAFQLGQPRSSVRHGRSERRPLDLYFISVGGGFRPPTRQTHLL  65

Query  274  KQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            KQME VA K +A++V+++S+LGE DPLMQN T ++ +L+VPW
Sbjct  66   KQMEKVANKYKAEFVVDVSDLGEDDPLMQNGTLHFSTLKVPW  107



>ref|XP_009358478.1| PREDICTED: uncharacterized protein LOC103949104 [Pyrus x bretschneideri]
Length=287

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRG-SWVCTLSTQVALCFALYLVLNTGQ---FQRSLYGDIDSVGTYFISVSGGFRPLQE  258
            MG+  SWV T+ TQV+L F LYL    GQ   + R    +   +  YFISV GGFRP   
Sbjct  1    MGKKPSWVPTVVTQVSLRFCLYLAFQLGQPWSYVRHGRSETRPLDIYFISVGGGFRPPTR  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q HLLKQME VAKK +A++V+++S LGE DPLMQN T+++ SL+VPW
Sbjct  61   QTHLLKQMEKVAKKYKAEFVVDVSNLGEDDPLMQNGTRHFSSLKVPW  107



>ref|XP_010098283.1| hypothetical protein L484_023530 [Morus notabilis]
 gb|EXB74787.1| hypothetical protein L484_023530 [Morus notabilis]
Length=272

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +1

Query  103  SWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQIHLL  273
             WV TL  Q+ALCFAL+  L  GQ Q+S++    +      +FISV GGFRP+ +Q HLL
Sbjct  6    DWVRTLVAQLALCFALFFALKLGQPQKSVHINTSESRHRDLHFISVRGGFRPVNQQTHLL  65

Query  274  KQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAK  420
            KQ+E VAK  +A++V+N+ E GE DPL+QNAT+   SL++PW    ++K
Sbjct  66   KQLEKVAKTYKARFVVNVGEFGEDDPLVQNATRIVPSLKIPWYTTTVSK  114



>ref|XP_002324553.2| hypothetical protein POPTR_0018s11880g [Populus trichocarpa]
 gb|EEF03118.2| hypothetical protein POPTR_0018s11880g [Populus trichocarpa]
Length=258

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 7/112 (6%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGF  243
            M   R SW CT   QV+L  A YL LN GQ Q+S++ + +   +       YF+SV GG+
Sbjct  1    METKRRSWACTFVLQVSLLIAFYLALNLGQPQKSIFQNRNGTSSSRRPLDVYFLSVRGGY  60

Query  244  RPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            RPL++Q  LLKQME VA   RA++V+N+SELGE DPL QNA++ +   +VPW
Sbjct  61   RPLKQQNLLLKQMEKVASFYRARFVVNVSELGEDDPLTQNASRLFPPQKVPW  112



>emb|CDP10206.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTYFISVSGGFRPLQEQIHL  270
            M   SW+CT  TQ++LCF +YL  N G    S       V TYF+SV+GGFRP  EQ  L
Sbjct  1    MKEHSWLCTFITQISLCFCVYLAFNMGDRTES---SSRPVETYFMSVAGGFRPENEQTLL  57

Query  271  LKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            LK ME VAK  + ++V++ISELGE DPL  NAT Y+QSL++PW
Sbjct  58   LKLMEKVAKVYKVQFVVSISELGENDPLGLNATWYFQSLKLPW  100



>ref|XP_011017992.1| PREDICTED: uncharacterized protein LOC105121156 isoform X2 [Populus 
euphratica]
Length=299

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGF  243
            M   R SW CT   QV+L  A YL LN GQ Q+S++ + +   +       YF+SV GG+
Sbjct  1    MEKKRRSWACTFVLQVSLLIAFYLALNLGQPQKSIFQNRNGTSSSRRPHDVYFLSVRGGY  60

Query  244  RPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            RPL+ Q  LLKQME VA   RA++V+N+SELGE DPL QNA++ +   +VPW
Sbjct  61   RPLKRQNLLLKQMEKVASFYRARFVVNVSELGEDDPLTQNASRLFPPQKVPW  112



>ref|XP_010656587.1| PREDICTED: uncharacterized protein LOC100257638 isoform X3 [Vitis 
vinifera]
 ref|XP_010656588.1| PREDICTED: uncharacterized protein LOC100257638 isoform X3 [Vitis 
vinifera]
Length=296

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ-----FQRSLYGDIDSVGTYFISVSGGFRPLQ  255
            MG+ SWV T+ TQ++LC A+ L  N G+        S  G    +  YFISV GGFRPL 
Sbjct  1    MGKPSWVRTVITQLSLCLAVLLAFNLGRPWEKPMSHSSSGSSRPLDLYFISVRGGFRPLN  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q HLLKQME  AK   A++VINISELGE DPL QN T  + +L+VPW
Sbjct  61   QQTHLLKQMEKAAKTYEARFVINISELGEDDPLTQNGTWRFSTLKVPW  108



>emb|CAN67945.1| hypothetical protein VITISV_025335 [Vitis vinifera]
Length=283

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ-----FQRSLYGDIDSVGTYFISVSGGFRPLQ  255
            MG+ SWV T+ TQ++LC A+ L  N G+        S  G    +  YFISV GGFRPL 
Sbjct  1    MGKPSWVRTVITQLSLCLAVLLAFNLGRPWEKPMSHSSSGSSRPLDLYFISVRGGFRPLN  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q HLLKQME  AK   A++VINISELGE DPL QN T  + +L+VPW
Sbjct  61   QQTHLLKQMEKAAKTYEARFVINISELGEDDPLTQNGTWRFSTLKVPW  108



>ref|XP_010656584.1| PREDICTED: uncharacterized protein LOC100257638 isoform X1 [Vitis 
vinifera]
 ref|XP_010656585.1| PREDICTED: uncharacterized protein LOC100257638 isoform X1 [Vitis 
vinifera]
 emb|CBI18679.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ-----FQRSLYGDIDSVGTYFISVSGGFRPLQ  255
            MG+ SWV T+ TQ++LC A+ L  N G+        S  G    +  YFISV GGFRPL 
Sbjct  1    MGKPSWVRTVITQLSLCLAVLLAFNLGRPWEKPMSHSSSGSSRPLDLYFISVRGGFRPLN  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q HLLKQME  AK   A++VINISELGE DPL QN T  + +L+VPW
Sbjct  61   QQTHLLKQMEKAAKTYEARFVINISELGEDDPLTQNGTWRFSTLKVPW  108



>gb|KDP38654.1| hypothetical protein JCGZ_04007 [Jatropha curcas]
Length=299

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLY--GD----IDSVGTYFISVSGGFRPLQE  258
            + SW CTL+ QV LC A Y+ LN G+    +Y  GD    I  V  YF+SV GG+R ++ 
Sbjct  4    KRSWACTLAVQVFLCIATYISLNLGEPHNFIYHSGDGSTSIRPVDAYFLSVRGGYRSIKR  63

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q HLLK ME VAK  +AK+V+NISELGE DPL +NA+  + S+ + W
Sbjct  64   QTHLLKLMENVAKAYKAKFVVNISELGEEDPLTRNASGLFSSMNISW  110



>ref|XP_011033464.1| PREDICTED: tartrate-resistant acid phosphatase type 5-like [Populus 
euphratica]
Length=296

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLY----GDIDSVGTYFISVSGGFRPLQEQI  264
            R SW CT   QV+L  A YL LN  Q   S+Y    G    +  YF+SV GG+RPL+++ 
Sbjct  4    RRSWACTFVLQVSLFIAFYLALNLDQRPTSIYNSRKGTRTPLDVYFLSVRGGYRPLKQRA  63

Query  265  HLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAKS-----FF  429
             LLKQME VA   RA++V+NISELGE DPL QNA++ +   ++PW +  ++K      F 
Sbjct  64   LLLKQMEKVANIYRARFVVNISELGEDDPLTQNASRLFPPQKIPWYSTRVSKGREAGCFL  123

Query  430  FSLHLSC  450
              ++++C
Sbjct  124  EQINITC  130



>ref|XP_011017990.1| PREDICTED: uncharacterized protein LOC105121156 isoform X1 [Populus 
euphratica]
Length=302

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 7/111 (6%)
 Frame = +1

Query  85   MRMGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT-------YFISVSGGF  243
            M   R SW CT   QV+L  A YL LN GQ Q+S++ + +   +       YF+SV GG+
Sbjct  1    MEKKRRSWACTFVLQVSLLIAFYLALNLGQPQKSIFQNRNGTSSSRRPHDVYFLSVRGGY  60

Query  244  RPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVP  396
            RPL+ Q  LLKQME VA   RA++V+N+SELGE DPL QNA++ +   +VP
Sbjct  61   RPLKRQNLLLKQMEKVASFYRARFVVNVSELGEDDPLTQNASRLFPPQKVP  111



>ref|XP_010656586.1| PREDICTED: uncharacterized protein LOC100257638 isoform X2 [Vitis 
vinifera]
Length=307

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ-----FQRSLYGDIDSVGTYFISVSGGFRPLQ  255
            MG+ SWV T+ TQ++LC A+ L  N G+        S  G    +  YFISV GGFRPL 
Sbjct  1    MGKPSWVRTVITQLSLCLAVLLAFNLGRPWEKPMSHSSSGSSRPLDLYFISVRGGFRPLN  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVP  396
            +Q HLLKQME  AK   A++VINISELGE DPL QN T  + +L+VP
Sbjct  61   QQTHLLKQMEKAAKTYEARFVINISELGEDDPLTQNGTWRFSTLKVP  107



>gb|KEH37872.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=215

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT--YFISVSGGFRPLQEQI  264
            M + S  CTL  Q+ LC ALY+ LN GQ Q  L  +        YFISV+GGFR + +Q+
Sbjct  1    MEKTSCACTLLIQLCLCCALYIALNLGQPQTLLNTNATQQDNDIYFISVNGGFRTINQQL  60

Query  265  HLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            HLL  ME VAK  +A +V+  S+LG  DPLMQNAT  + SL +PW
Sbjct  61   HLLNMMEKVAKAYKASFVVCTSKLGGDDPLMQNATLRFPSLRLPW  105



>gb|KEH37871.1| calcineurin-like metallo-phosphoesterase superfamily protein 
[Medicago truncatula]
Length=299

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI--DSVGTYFISVSGGFRPLQEQI  264
            M + S  CTL  Q+ LC ALY+ LN GQ Q  L  +        YFISV+GGFR + +Q+
Sbjct  1    MEKTSCACTLLIQLCLCCALYIALNLGQPQTLLNTNATQQDNDIYFISVNGGFRTINQQL  60

Query  265  HLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            HLL  ME VAK  +A +V+  S+LG  DPLMQNAT  + SL +PW
Sbjct  61   HLLNMMEKVAKAYKASFVVCTSKLGGDDPLMQNATLRFPSLRLPW  105



>gb|KFK43796.1| hypothetical protein AALP_AA1G173800 [Arabis alpina]
Length=286

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G        D D+ G    +FISV+GGFR +  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLVVYVSLHLGHPFFFSSNDGDNAGVLDLHFISVAGGFRQIHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLL+ ME VA+ ++AK+V++ SE GE DPL+QNAT+   SL++PW
Sbjct  61   THLLRLMERVAETHKAKFVVSTSEYGEEDPLLQNATRLSSSLKLPW  106



>gb|KFK43795.1| hypothetical protein AALP_AA1G173800 [Arabis alpina]
Length=282

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G        D D+ G    +FISV+GGFR +  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLVVYVSLHLGHPFFFSSNDGDNAGVLDLHFISVAGGFRQIHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLL+ ME VA+ ++AK+V++ SE GE DPL+QNAT+   SL++PW
Sbjct  61   THLLRLMERVAETHKAKFVVSTSEYGEEDPLLQNATRLSSSLKLPW  106



>ref|XP_006412643.1| hypothetical protein EUTSA_v10025917mg [Eutrema salsugineum]
 gb|ESQ54096.1| hypothetical protein EUTSA_v10025917mg [Eutrema salsugineum]
Length=285

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G        D DS G    +FISVSGGFRP Q Q
Sbjct  1    MNKSSWGCTIFIQLSLCLVVYVSLHLGHPFFFSSNDGDSAGALDLHFISVSGGFRPPQRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+ ME VA+  +A++V++ SE GE DPL+QNAT+    L++PW
Sbjct  61   TRLLRLMERVAETYKARFVVSTSEHGEEDPLLQNATRVSSKLKLPW  106



>ref|NP_849477.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 gb|ABK59675.1| At4g30993 [Arabidopsis thaliana]
 gb|AEE85841.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=209

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGD-IDSVGTYFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L++G   F  S  GD    +  +FISV+GGFRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIIYVSLHSGHPFFFSSDDGDNATPLDLHFISVAGGFRPLNHQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAKSFFFSLH  441
              LL+ ME VA+  +AK+V++ SE GE DP +QNAT+   SL++PW    +  S +F  H
Sbjct  61   TRLLRLMEKVAETYKAKFVVSSSEQGEEDPFLQNATRLSSSLKLPW-YTRMKGSGYFREH  119

Query  442  LSCRF  456
            +   F
Sbjct  120  IKMPF  124



>ref|NP_567863.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
 dbj|BAC43670.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85840.1| Calcineurin-like metallo-phosphoesterase superfamily protein 
[Arabidopsis thaliana]
Length=285

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGD-IDSVGTYFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L++G   F  S  GD    +  +FISV+GGFRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIIYVSLHSGHPFFFSSDDGDNATPLDLHFISVAGGFRPLNHQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAKSFFFSLH  441
              LL+ ME VA+  +AK+V++ SE GE DP +QNAT+   SL++PW    +  S +F  H
Sbjct  61   TRLLRLMEKVAETYKAKFVVSSSEQGEEDPFLQNATRLSSSLKLPW-YTRMKGSGYFREH  119

Query  442  LSCRF  456
            +   F
Sbjct  120  IKMPF  124



>ref|XP_002523501.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38840.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDS---VGTYFISVSGGFRPLQE  258
            + SWVC+L  QV LC  +YL LN GQ Q  +Y   G I S   +  YF+SV G +R +++
Sbjct  4    KRSWVCSLVLQVCLCVVVYLALNLGQPQNFVYFSRGGITSTRNLDVYFLSVRGSYRDIKQ  63

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAK  420
            Q HLLK ME VAK  + K+V+NISELGE DPL +NA++ + S+ VPW   + +K
Sbjct  64   QSHLLKLMENVAKVYKVKFVVNISELGEDDPLTKNASRLFSSMNVPWYTTIASK  117



>ref|XP_010447631.1| PREDICTED: uncharacterized protein LOC104730196 [Camelina sativa]
Length=277

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGDIDSVGTYFISVSGG-FRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G   F  +   +   +  YFISV+GG FRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIVYVSLHLGDPFFSSNDVDNATPLDLYFISVAGGGFRPLHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLL+ ME  A+  +AK+V++ SE GE DPL+Q+AT+   SL++PW
Sbjct  61   THLLRLMEKAAETYKAKFVVSSSEHGEDDPLLQHATRVSSSLKLPW  106



>ref|XP_004139260.1| PREDICTED: uncharacterized protein LOC101208944 [Cucumis sativus]
 gb|KGN60758.1| hypothetical protein Csa_2G009460 [Cucumis sativus]
Length=288

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQ  261
            M   S   TL  Q+ LCFA YL LN G+ +   +    D + +  YFISV GG R ++E+
Sbjct  1    MADPSISTTLLAQLCLCFAFYLSLNMGRSKNYDFLKIPDQNPLDFYFISVWGGLRSVKEE  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAK  420
              LLKQME +AK + AK++++I E GE D LMQN T Y+ SL+VPW +I  ++
Sbjct  61   TLLLKQMEKMAKVSHAKFILHIREPGENDRLMQNGTWYFSSLKVPWHSIRASR  113



>ref|XP_004159413.1| PREDICTED: uncharacterized protein LOC101230039 [Cucumis sativus]
Length=288

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLY---GDIDSVGTYFISVSGGFRPLQEQ  261
            M   S   TL  Q+ LCFA YL LN G+ +   +    D + +  YFISV GG R ++E+
Sbjct  1    MADPSISTTLLAQLCLCFAFYLSLNMGRSKNYDFLKIPDQNPLDFYFISVWGGLRSVKEE  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAK  420
              LLKQME +AK + AK++++I E GE D LMQN T Y+ SL+VPW +I  ++
Sbjct  61   TLLLKQMEKMAKVSHAKFILHIREPGENDRLMQNGTWYFSSLKVPWHSIRASR  113



>ref|XP_010438095.1| PREDICTED: uncharacterized protein LOC104721736 [Camelina sativa]
Length=277

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGDIDSVGTYFISVSGG-FRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G   F  +   +   +  YFISV+GG FRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIVYVSLHLGHPFFSSNDVDNATPLDLYFISVAGGGFRPLHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLL+ ME  A+  +AK+V++ SE GE DPL+Q+A++   SL++PW
Sbjct  61   THLLRLMEKAAETYKAKFVVSSSEHGEDDPLLQHASRVSSSLKIPW  106



>ref|XP_008456552.1| PREDICTED: uncharacterized protein LOC103496469 [Cucumis melo]
Length=287

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 3/113 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ---FQRSLYGDIDSVGTYFISVSGGFRPLQEQ  261
            M   S   T+  QV LCFA YL LN G+   +      D + +  YFISV GG R ++E+
Sbjct  1    MADPSISTTVLAQVCLCFAFYLCLNMGRSKNYDLLKIRDENPLDFYFISVWGGLRSVKEE  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AILLAK  420
              LLKQME +AK + AK++++I E GE D LMQN T Y+ SL+VPW +I  ++
Sbjct  61   TLLLKQMEKMAKVSHAKFILHIREPGENDRLMQNGTWYFSSLKVPWHSIRASR  113



>ref|XP_006284271.1| hypothetical protein CARUB_v10005435mg [Capsella rubella]
 gb|EOA17169.1| hypothetical protein CARUB_v10005435mg [Capsella rubella]
Length=283

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ---FQRSLYGDIDSVGTYFISVSGG-FRPLQE  258
            M + SW CT+  Q++LC  +Y+ L+ G       +  G+   +  YFISV+GG FRPL  
Sbjct  1    MKQSSWGCTIFIQLSLCLIVYVSLHLGHPFFSSNNDGGNAAPLDLYFISVAGGGFRPLHH  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW*AI  408
            Q  LL+ ME  A+  +AK+V++ SELGE DPL+QNAT+   SL++PW  I
Sbjct  61   QTRLLRLMEKAAETYKAKFVVSSSELGEKDPLLQNATRVSSSLKLPWYTI  110



>emb|CAA18194.1| putative protein [Arabidopsis thaliana]
 emb|CAB79817.1| putative protein [Arabidopsis thaliana]
Length=2895

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +1

Query  91    MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGD-IDSVGTYFISVSGGFRPLQEQ  261
             M + SW CT+  Q++LC  +Y+ L++G   F  S  GD    +  +FISV+GGFRPL  Q
Sbjct  2386  MKQSSWGCTIFIQLSLCLIIYVSLHSGHPFFFSSDDGDNATPLDLHFISVAGGFRPLNHQ  2445

Query  262   IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
               LL+ ME VA+  +AK+V++ SE GE DP +QNAT+   SL++PW
Sbjct  2446  TRLLRLMEKVAETYKAKFVVSSSEQGEEDPFLQNATRLSSSLKLPW  2491



>ref|XP_010432916.1| PREDICTED: uncharacterized protein LOC104717091 [Camelina sativa]
Length=281

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGDIDSVGTYFISVSGG-FRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G   F  +   +   +  YFISV+GG FRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIVYVSLHLGHPFFSSNDVDNATPLDLYFISVAGGGFRPLHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             HLL+ ME  A+  +AK+V++ SE GE DPL+Q+A++   SL++PW
Sbjct  61   THLLRLMEKAAETYKAKFVVSSSEHGEDDPLLQHASRVSSSLKLPW  106



>ref|XP_009127355.1| PREDICTED: uncharacterized protein LOC103852187 [Brassica rapa]
Length=285

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G    S   D D+ G    +FISVSGGFRPL  Q
Sbjct  1    MKKSSWGCTIFIQLSLCLIVYVSLHFGHQSLSSSNDGDNAGALDLHFISVSGGFRPLHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+ ME VA+  +AK+V++ SE GE D L+ N T+   +L++PW
Sbjct  61   TRLLRLMERVAETYKAKFVVSTSEHGEEDLLLLNDTRVSSTLKLPW  106



>gb|AAM65252.1| unknown [Arabidopsis thaliana]
Length=285

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLYGD-IDSVGTYFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L++G   F  S  GD    +  +FISV+GGFRPL  Q
Sbjct  1    MKQSSWGCTIFIQLSLCLIIYVSLHSGHPFFFSSDDGDNATPLDLHFISVAGGFRPLNHQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+ ME VA+  +AK+V++ SE GE D  +QNAT+   SL++PW
Sbjct  61   TRLLRLMEKVAETYKAKFVVSSSEQGEEDSFLQNATRLSSSLKLPW  106



>dbj|BAD72545.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD72508.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAH01165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=298

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 13/117 (11%)
 Frame = +1

Query  88   RMGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLY-----------GDIDSVGTYFIS  228
            R  R  W  T++ QVALC A+Y   + G+  F R+             G     G  F+S
Sbjct  8    RSKRPPWSRTVAVQVALCVAMYAAFSLGEPRFHRNRGRGGGGGVEASLGRGGRGGVSFLS  67

Query  229  VSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            V+GG RP  EQ  LL+QME +AK  + K+V+++++LGE DPL QN + Y+Q+L++PW
Sbjct  68   VAGGARPAAEQARLLRQMESIAKAYKVKFVVDVAQLGEEDPLWQNGSLYFQALKIPW  124



>emb|CDY28233.1| BnaA01g06160D [Brassica napus]
Length=285

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G    S   D D+ G    +FISVSGGFRPL  Q
Sbjct  1    MKKSSWGCTIFIQLSLCLIVYVSLHFGHQSLSSSNDGDNAGALDLHFISVSGGFRPLHRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+ ME VA   +AK+V++ SE GE D L+ N T+   +L++PW
Sbjct  61   TRLLRLMERVAGTYKAKFVVSTSEHGEEDLLLLNDTRVSSTLKLPW  106



>ref|XP_010525815.1| PREDICTED: uncharacterized protein LOC104803568 [Tarenaya hassleriana]
Length=288

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 5/106 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDS---VGTYFISVSGGFRPLQEQ  261
            M +  W CT+  Q++LC A+Y+ L+ G+    L+ D D+   +  +FI+VSGG RPL +Q
Sbjct  1    MRQSPWACTIFIQLSLCVAIYVSLHLGRSL--LFSDADNGRHLDLHFITVSGGSRPLHQQ  58

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LLK M  VA+   A+ V++IS++G+ DPL +NAT+   SL++PW
Sbjct  59   NRLLKLMGSVARSYNARVVVSISDIGDKDPLFRNATRVSSSLKLPW  104



>gb|EAY99927.1| hypothetical protein OsI_21928 [Oryza sativa Indica Group]
Length=298

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (60%), Gaps = 13/117 (11%)
 Frame = +1

Query  88   RMGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRS--------LYGDIDSVG---TYFIS  228
            R  R  W  T++ QVALC A+Y   + G+    R+        +   +D  G     F+S
Sbjct  8    RSKRPPWSRTVAVQVALCVAMYAAFSLGEPRLHRNRGRGGGGGVEASLDRGGRGGVSFLS  67

Query  229  VSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            V+GG RP  EQ  LL+QME +AK  + K+V+++++LGE DPL QN + Y+Q+L++PW
Sbjct  68   VAGGARPAAEQARLLRQMESIAKAYKVKFVVDVAQLGEEDPLWQNGSLYFQALKIPW  124



>emb|CDX68711.1| BnaC01g07420D [Brassica napus]
Length=285

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 3/106 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGT---YFISVSGGFRPLQEQ  261
            M + SW CT+  Q++LC  +Y+ L+ G        D D+ G    +FISVS GFRPLQ Q
Sbjct  1    MKKSSWGCTVFIQLSLCLIVYVSLHFGHQSLLSSNDDDNAGALDLHFISVSCGFRPLQRQ  60

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+ ME VA+  +AK+V++ SE GE D L+ N T+   +L++PW
Sbjct  61   TRLLRLMERVAETYKAKFVVSTSEDGEEDLLLLNDTRVSSTLKLPW  106



>ref|XP_009390567.1| PREDICTED: uncharacterized protein LOC103976928 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 8/106 (8%)
 Frame = +1

Query  103  SWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI-------DSVGTYFISVSGGFRPLQEQ  261
            S+  TL  QVALC ALY   + G  Q S                 YF+SV GG R  +EQ
Sbjct  12   SYRRTLVIQVALCLALYAAFHIGTPQPSPASSPGGARLGGKPADLYFMSVRGGVRTPREQ  71

Query  262  IHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
              LL+QME VAK   A +V+NI+ELGE DPL+QNAT ++   E+PW
Sbjct  72   SQLLEQMEKVAKTYGANFVVNIAELGERDPLLQNATSHFPR-EIPW  116



>ref|XP_006841176.1| hypothetical protein AMTR_s00086p00171090 [Amborella trichopoda]
 gb|ERN02851.1| hypothetical protein AMTR_s00086p00171090 [Amborella trichopoda]
Length=283

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTYFISVSGGFRPLQEQIHL  270
            MGR SW  T+ TQ AL   L++ L  G+ ++        +  YFISV GG RP  ++  L
Sbjct  1    MGR-SWTMTVFTQCALFILLWVALYMGKSEKPRRAS--PLDLYFISVGGGERPPSDRTLL  57

Query  271  LKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            L+QME  A+  + K++++I+ELGE DPL++NAT  + SL+VPW
Sbjct  58   LRQMEKTARFYKVKFIVSIAELGEEDPLVKNATLEFPSLKVPW  100



>ref|XP_008799627.1| PREDICTED: uncharacterized protein LOC103714225 [Phoenix dactylifera]
Length=302

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI------DSVGTYFISVSGGFRPLQE  258
            + SW  TL  Q ALC ALY   N G+ Q +    +      +S+  YF+SV GG R  +E
Sbjct  7    KPSWGRTLVIQAALCLALYAAFNIGRPQAARDARLQSKLHRESLDLYFLSVRGGLRSPRE  66

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q HLL QM+  AK  +AK+V+NI ELGE DPL++NAT ++  +E+PW
Sbjct  67   QAHLLHQMDKAAKIYKAKFVVNIGELGEDDPLLRNATFHFPLVEIPW  113



>gb|EYU25348.1| hypothetical protein MIMGU_mgv1a012027mg [Erythranthe guttata]
Length=240

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ----FQRSLYGDIDSVGTYFISVSGGFRPLQE  258
            M   SW CTL  Q++LC A Y+ LN GQ     Q+  +G   S   YFI+V+GG   LQ+
Sbjct  1    MKEKSWRCTLIAQLSLCAAAYIALNIGQPQNQNQKLTHGRRSSSHIYFITVNGGSTSLQQ  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q  LL+QM  V +    ++VI+ISELGE +PL+QNAT + + L +PW
Sbjct  61   QTLLLQQMVKVKRICDIRFVIDISELGESEPLLQNATMFPELLNMPW  107



>ref|XP_010942121.1| PREDICTED: uncharacterized protein LOC105060209 isoform X2 [Elaeis 
guineensis]
Length=307

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +1

Query  103  SWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI------DSVGTYFISVSGGFRPLQEQI  264
            SW  TL+ Q ALC ALY   N G+ Q      +       S+  YF+SV GG R  +EQ 
Sbjct  18   SWGRTLAIQAALCLALYAAFNIGRPQAPRDARLQSMLRRKSLDLYFLSVRGGLRSPREQA  77

Query  265  HLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             LL +ME  AK  +AK+V+NI ELGE DPL++NAT ++  LE+PW
Sbjct  78   QLLHKMERAAKIYKAKFVVNIGELGEDDPLLRNATLHFPLLEIPW  122



>gb|EYU25347.1| hypothetical protein MIMGU_mgv1a012027mg [Erythranthe guttata]
Length=263

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ----FQRSLYGDIDSVGTYFISVSGGFRPLQE  258
            M   SW CTL  Q++LC A Y+ LN GQ     Q+  +G   S   YFI+V+GG   LQ+
Sbjct  1    MKEKSWRCTLIAQLSLCAAAYIALNIGQPQNQNQKLTHGRRSSSHIYFITVNGGSTSLQQ  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            Q  LL+QM  V +    ++VI+ISELGE +PL+QNAT + + L +PW
Sbjct  61   QTLLLQQMVKVKRICDIRFVIDISELGESEPLLQNATMFPELLNMPW  107



>ref|XP_011084008.1| PREDICTED: uncharacterized protein LOC105166369 isoform X2 [Sesamum 
indicum]
Length=265

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVG----TYFISVSGGFRPLQE  258
            M   SW CTL TQ++LC A Y+ LN GQ Q+  +G I SVG     YFISV+GGFRPL+E
Sbjct  1    MKEKSWACTLITQLSLCIAAYIALNIGQPQKVTHGSISSVGGPTDMYFISVAGGFRPLEE  60

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDP--LMQNATQYYQSLE  390
            Q  LL+Q  M +   +  +  + +  G+  P  L +    Y Q+L+
Sbjct  61   QNLLLQQAAMFSDLQKMPWYTSGALGGQAQPYFLKKVKIPYGQTLD  106



>gb|EEE65214.1| hypothetical protein OsJ_20360 [Oryza sativa Japonica Group]
Length=311

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 26/130 (20%)
 Frame = +1

Query  88   RMGRGSWVCTLSTQVALCFALYLVLNTGQ--FQRSLY-----------GDIDSVGTYFIS  228
            R  R  W  T++ QVALC A+Y   + G+  F R+             G     G  F+S
Sbjct  8    RSKRPPWSRTVAVQVALCVAMYAAFSLGEPRFHRNRGRGGGGGVEASLGRGGRGGVSFLS  67

Query  229  VSGGFRPLQEQIHLL-------------KQMEMVAKKNRAKYVINISELGEGDPLMQNAT  369
            V+GG RP  EQ  L              ++ME +AK  + K+V+++++LGE DPL QN +
Sbjct  68   VAGGARPAAEQARLPNGKCAGFLPFLSPRRMESIAKAYKVKFVVDVAQLGEEDPLWQNGS  127

Query  370  QYYQSLEVPW  399
             Y+Q+L++PW
Sbjct  128  LYFQALKIPW  137



>ref|XP_002437963.1| hypothetical protein SORBIDRAFT_10g005620 [Sorghum bicolor]
 gb|EER89330.1| hypothetical protein SORBIDRAFT_10g005620 [Sorghum bicolor]
Length=294

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = +1

Query  94   GRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSV----------GTYFISVSGGF  243
            GR  W CT++ Q ALC ALY   + G+ Q    G ++++             F+SV+GG 
Sbjct  8    GRPPWRCTVAVQAALCLALYAAFSLGEPQLIPRGGVNALGRGARGGGGGDVAFLSVAGGA  67

Query  244  RPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            R   EQ  LL+QME +AK    K+V+++++LGE DPL QN + Y+Q+L +PW
Sbjct  68   RGPIEQARLLRQMETIAKVYEVKFVLDVAQLGEDDPLWQNGSMYFQALNIPW  119



>ref|XP_010656590.1| PREDICTED: uncharacterized protein LOC104880703 [Vitis vinifera]
 ref|XP_010656591.1| PREDICTED: uncharacterized protein LOC104880703 [Vitis vinifera]
 emb|CBI18681.3| unnamed protein product [Vitis vinifera]
Length=110

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +1

Query  217  YFISVSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQ  360
            YFISV GGFRPL +Q HLLKQME  AK  +A++VINISELGE D L Q
Sbjct  15   YFISVRGGFRPLNQQTHLLKQMEKAAKTYKARFVINISELGEDDQLTQ  62



>ref|XP_006350149.1| PREDICTED: uncharacterized protein LOC102584629 [Solanum tuberosum]
Length=73

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  220  FISVSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNAT  369
            FISV+GG R L+EQ  LLKQ+E VAKK  A++VINISELGE DPLMQN +
Sbjct  16   FISVTGGIRTLEEQTLLLKQVEKVAKKFNARFVINISELGEDDPLMQNVS  65



>emb|CAN69306.1| hypothetical protein VITISV_016078 [Vitis vinifera]
Length=218

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQ-FQRSLYGDID----SVGTYFISVSGGFRPLQ  255
            MG+ SWV T+ TQ++LC A+ L  N G+ +++ +          +  YFISV GGFRPL 
Sbjct  1    MGKPSWVRTVITQLSLCLAVLLAFNLGRPWEKPMSQSSSGSSRPLDLYFISVRGGFRPLN  60

Query  256  EQIHLLKQMEMVAKKNRAKYVINISE-LGEGDPLMQNATQYYQSLEV  393
            +Q HLLKQME  AK  +A+Y   +S   G G  L Q    + ++L++
Sbjct  61   QQTHLLKQMEKAAKTYKARYSTRVSRGRGTGYFLKQIKIPFGKTLDI  107



>ref|XP_002869353.1| hypothetical protein ARALYDRAFT_353720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45612.1| hypothetical protein ARALYDRAFT_353720 [Arabidopsis lyrata subsp. 
lyrata]
Length=2855

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  217   YFISVSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVP  396
             +FISVSGGFRPL  Q  LL+ ME VA+  +AK+V++ SE GE D L+QNAT+   SL++P
Sbjct  2616  HFISVSGGFRPLHHQTRLLRLMEKVAETYKAKFVLSSSEHGEQDSLLQNATRLSSSLKLP  2675

Query  397   W  399
             W
Sbjct  2676  W  2676



>ref|XP_010942120.1| PREDICTED: uncharacterized protein LOC105060209 isoform X1 [Elaeis 
guineensis]
Length=316

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 15/116 (13%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI------DSVGTYFISVSGGFRPLQE  258
            + SW  TL+ Q ALC ALY   N G+ Q      +       S+  YF+SV GG R  +E
Sbjct  16   KPSWGRTLAIQAALCLALYAAFNIGRPQAPRDARLQSMLRRKSLDLYFLSVRGGLRSPRE  75

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQN---------ATQYYQSLEVPW  399
            Q  LL +ME  AK  +AK+V+NI ELGE DPL++N         AT ++  LE+PW
Sbjct  76   QAQLLHKMERAAKIYKAKFVVNIGELGEDDPLLRNLVSMVVPLQATLHFPLLEIPW  131



>ref|NP_001145379.1| uncharacterized protein LOC100278723 [Zea mays]
 gb|ACG47110.1| hypothetical protein [Zea mays]
Length=288

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTY-------FISVSGGFRPLQ  255
            R  W CT++ Q ALC ALY   + G+ Q    G +D++G         F+SV+GG R   
Sbjct  9    RPPWRCTVAVQAALCLALYAAFSLGEPQLIPRGGVDALGRGARGGGVAFLSVAGGARGPI  68

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LL+QME  AK    K+V+++++LG  DPL QN + Y+Q+L +PW
Sbjct  69   DQERLLRQMETTAKLYEVKFVLDVTQLGADDPLWQNGSTYFQALNIPW  116



>gb|AFW85562.1| hypothetical protein ZEAMMB73_864557 [Zea mays]
Length=288

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTY-------FISVSGGFRPLQ  255
            R  W CT++ Q ALC ALY   + G+ Q    G +D++G         F+SV+GG R   
Sbjct  9    RPPWRCTVAVQAALCLALYAAFSLGEPQLIPRGGVDALGRGARGGGVAFLSVAGGARGPI  68

Query  256  EQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            +Q  LL+QME  AK    K+V+++++LG  DPL QN + Y+Q+L +PW
Sbjct  69   DQERLLRQMETTAKLYEVKFVLDVTQLGADDPLWQNGSMYFQALNIPW  116



>ref|XP_007202435.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
 gb|EMJ03634.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
Length=196

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +1

Query  91   MGRGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDID---SVGTYFISVSGGFRPLQEQ  261
            M + SWV TL  Q  LCF+LYL    GQ Q+ +Y   +    +  YFISV GGFRPL +Q
Sbjct  1    MEKPSWVPTLVAQACLCFSLYLAFQLGQPQKPMYHGTNGTRPLDLYFISVGGGFRPLNQQ  60

Query  262  IHLLKQ  279
             HLLKQ
Sbjct  61   THLLKQ  66



>ref|XP_003560995.1| PREDICTED: uncharacterized protein LOC100824454 [Brachypodium 
distachyon]
 ref|XP_010227950.1| PREDICTED: uncharacterized protein LOC100824454 [Brachypodium 
distachyon]
 ref|XP_010227951.1| PREDICTED: uncharacterized protein LOC100824454 [Brachypodium 
distachyon]
Length=299

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 9/109 (8%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQ--------RSLYGDIDSVGTYFISVSGGFRPL  252
            R  W  T++ Q A+C ALY   + G  Q         +  G     G  F+SV+GG R  
Sbjct  19   RPPWRRTVAIQAAICLALYAAFSLGDPQLQPRGGGGAAALGRGGRGGVSFLSVAGGTREP  78

Query  253  QEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
             +Q  LL+QME +AK    K V+++++ G+ D L Q+ + Y+Q+L++PW
Sbjct  79   AKQARLLRQMEHIAKAYEVKLVLDVAQFGD-DTLWQDGSMYFQTLKIPW  126



>ref|XP_004964667.1| PREDICTED: uncharacterized protein LOC101784573 [Setaria italica]
Length=299

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  220  FISVSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            F+SV+GG R   +Q  LL+QME VAK    K+V++I++  E DPL QN + Y+Q+L +PW
Sbjct  65   FLSVAGGARATADQARLLRQMEAVAKVYEVKFVLDIAQSRENDPLWQNGSMYFQALNIPW  124



>ref|XP_010942122.1| PREDICTED: uncharacterized protein LOC105060209 isoform X3 [Elaeis 
guineensis]
Length=258

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 6/95 (6%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDI------DSVGTYFISVSGGFRPLQE  258
            + SW  TL+ Q ALC ALY   N G+ Q      +       S+  YF+SV GG R  +E
Sbjct  16   KPSWGRTLAIQAALCLALYAAFNIGRPQAPRDARLQSMLRRKSLDLYFLSVRGGLRSPRE  75

Query  259  QIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQN  363
            Q  LL +ME  AK  +AK+V+NI ELGE DPL++N
Sbjct  76   QAQLLHKMERAAKIYKAKFVVNIGELGEDDPLLRN  110



>gb|AFW85561.1| hypothetical protein ZEAMMB73_864557 [Zea mays]
Length=312

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 31/132 (23%)
 Frame = +1

Query  97   RGSWVCTLSTQVALCFALYLVLNTGQFQRSLYGDIDSVGTY-------FISVSGGFRPLQ  255
            R  W CT++ Q ALC ALY   + G+ Q    G +D++G         F+SV+GG R   
Sbjct  9    RPPWRCTVAVQAALCLALYAAFSLGEPQLIPRGGVDALGRGARGGGVAFLSVAGGARGPI  68

Query  256  EQIHLLKQ------------------------MEMVAKKNRAKYVINISELGEGDPLMQN  363
            +Q  LL+Q                        ME  AK    K+V+++++LG  DPL QN
Sbjct  69   DQERLLRQPCVSTGSTVIDVRFDGLHMPDPRLMETTAKLYEVKFVLDVTQLGADDPLWQN  128

Query  364  ATQYYQSLEVPW  399
             + Y+Q+L +PW
Sbjct  129  GSMYFQALNIPW  140



>dbj|BAJ85865.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86952.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +1

Query  220  FISVSGGFRPLQEQIHLLKQMEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            F+SV+GG R   +Q  LL+QME  AK    K V++++  G+ DPL +N + ++Q+L +PW
Sbjct  59   FLSVAGGARSPADQDRLLRQMESTAKIYEVKLVLDVARFGD-DPLWKNGSLHFQALNIPW  117



>ref|XP_010656589.1| PREDICTED: uncharacterized protein LOC100257638 isoform X4 [Vitis 
vinifera]
Length=241

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            ME  AK   A++VINISELGE DPL QN T  + +L+VPW
Sbjct  1    MEKAAKTYEARFVINISELGEDDPLTQNGTWRFSTLKVPW  40



>ref|XP_006655853.1| PREDICTED: uncharacterized protein LOC102722683 [Oryza brachyantha]
Length=214

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            ME +AK    K+V+++++LGE DPL QN + Y+Q+L++PW
Sbjct  1    MESIAKAYEVKFVLDVAQLGEEDPLWQNGSLYFQALKIPW  40



>gb|KJB07373.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07379.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=229

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  MEMVAKKNRAKYVINISELGEGDPLMQNATQYYQSLEVPW  399
            M  VAK    K+V+NISELGE DPLMQN T+    L VPW
Sbjct  1    MGNVAKAYDLKFVVNISELGEDDPLMQNVTRLSPLLNVPW  40



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600