BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030F21

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19553.1|  hypothetical protein MIMGU_mgv1a0019021mg               125   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_011084423.1|  PREDICTED: cleavage and polyadenylation spec...    129   9e-31   Sesamum indicum [beniseed]
emb|CDP05186.1|  unnamed protein product                                123   3e-30   Coffea canephora [robusta coffee]
ref|XP_004234405.1|  PREDICTED: cleavage and polyadenylation spec...    127   7e-30   Solanum lycopersicum
ref|XP_010671861.1|  PREDICTED: cleavage and polyadenylation spec...    125   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006353867.1|  PREDICTED: cleavage and polyadenylation spec...    125   2e-29   Solanum tuberosum [potatoes]
ref|XP_009342955.1|  PREDICTED: cleavage and polyadenylation spec...    125   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009342954.1|  PREDICTED: cleavage and polyadenylation spec...    125   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009340044.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    125   3e-29   
ref|XP_007220238.1|  hypothetical protein PRUPE_ppa001928mg             124   6e-29   Prunus persica
ref|XP_008234231.1|  PREDICTED: cleavage and polyadenylation spec...    124   6e-29   Prunus mume [ume]
ref|XP_008234230.1|  PREDICTED: cleavage and polyadenylation spec...    124   6e-29   Prunus mume [ume]
ref|XP_009789216.1|  PREDICTED: cleavage and polyadenylation spec...    124   7e-29   Nicotiana sylvestris
ref|XP_009605983.1|  PREDICTED: cleavage and polyadenylation spec...    124   7e-29   Nicotiana tomentosiformis
ref|XP_003548179.1|  PREDICTED: cleavage and polyadenylation spec...    123   2e-28   Glycine max [soybeans]
ref|XP_008376608.1|  PREDICTED: cleavage and polyadenylation spec...    123   2e-28   
ref|XP_008376609.1|  PREDICTED: cleavage and polyadenylation spec...    123   2e-28   
ref|XP_004171219.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    120   2e-28   
ref|XP_010421193.1|  PREDICTED: cleavage and polyadenylation spec...    122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010421194.1|  PREDICTED: cleavage and polyadenylation spec...    122   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010493506.1|  PREDICTED: cleavage and polyadenylation spec...    122   4e-28   Camelina sativa [gold-of-pleasure]
ref|NP_197776.1|  cleavage and polyadenylation specificity factor...    122   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287134.1|  hypothetical protein CARUB_v10000306mg             122   5e-28   Capsella rubella
gb|KHN18611.1|  Cleavage and polyadenylation specificity factor s...    118   5e-28   Glycine soja [wild soybean]
ref|XP_003590295.1|  Cleavage and polyadenylation specificity fac...    120   6e-28   
gb|KHG29898.1|  Cleavage and polyadenylation specificity factor s...    121   6e-28   Gossypium arboreum [tree cotton]
gb|KDP24115.1|  hypothetical protein JCGZ_25772                         121   7e-28   Jatropha curcas
ref|XP_002268591.1|  PREDICTED: cleavage and polyadenylation spec...    121   7e-28   Vitis vinifera
gb|KJB52780.1|  hypothetical protein B456_008G276300                    121   7e-28   Gossypium raimondii
ref|XP_004308076.1|  PREDICTED: cleavage and polyadenylation spec...    120   1e-27   Fragaria vesca subsp. vesca
ref|XP_008439247.1|  PREDICTED: cleavage and polyadenylation spec...    120   1e-27   Cucumis melo [Oriental melon]
ref|XP_007152251.1|  hypothetical protein PHAVU_004G114000g             120   1e-27   Phaseolus vulgaris [French bean]
ref|XP_004140773.1|  PREDICTED: cleavage and polyadenylation spec...    120   1e-27   Cucumis sativus [cucumbers]
ref|XP_006587302.1|  PREDICTED: cleavage and polyadenylation spec...    120   1e-27   Glycine max [soybeans]
ref|XP_007038719.1|  Cleavage and polyadenylation specificity fac...    119   2e-27   
gb|AAF82809.1|AF283277_1  polyadenylation cleavage/specificity fa...    120   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108351.1|  Cleavage and polyadenylation specificity fac...    120   2e-27   Morus notabilis
gb|KEH41412.1|  cleavage and polyadenylation specificity factor s...    119   2e-27   Medicago truncatula
ref|XP_006421947.1|  hypothetical protein CICLE_v10004414mg             119   3e-27   
gb|KHN41472.1|  Cleavage and polyadenylation specificity factor s...    119   3e-27   Glycine soja [wild soybean]
gb|KFK27677.1|  hypothetical protein AALP_AA8G414300                    119   4e-27   Arabis alpina [alpine rockcress]
ref|XP_006394646.1|  hypothetical protein EUTSA_v10003707mg             119   4e-27   Eutrema salsugineum [saltwater cress]
ref|XP_007038718.1|  Cleavage and polyadenylation specificity fac...    119   5e-27   
ref|XP_006421948.1|  hypothetical protein CICLE_v10004414mg             119   5e-27   Citrus clementina [clementine]
ref|XP_010454671.1|  PREDICTED: cleavage and polyadenylation spec...    119   5e-27   Camelina sativa [gold-of-pleasure]
gb|KDO52015.1|  hypothetical protein CISIN_1g004656mg                   118   5e-27   Citrus sinensis [apfelsine]
gb|KDO52014.1|  hypothetical protein CISIN_1g004656mg                   119   5e-27   Citrus sinensis [apfelsine]
ref|XP_006490412.1|  PREDICTED: cleavage and polyadenylation spec...    119   5e-27   
ref|XP_010035148.1|  PREDICTED: cleavage and polyadenylation spec...    119   5e-27   Eucalyptus grandis [rose gum]
ref|XP_010035149.1|  PREDICTED: cleavage and polyadenylation spec...    118   6e-27   Eucalyptus grandis [rose gum]
ref|XP_011008814.1|  PREDICTED: cleavage and polyadenylation spec...    118   6e-27   Populus euphratica
ref|XP_006369487.1|  Cleavage and polyadenylation specificity fac...    118   6e-27   Populus trichocarpa [western balsam poplar]
emb|CDX88053.1|  BnaA06g26440D                                          118   1e-26   
ref|XP_009150911.1|  PREDICTED: cleavage and polyadenylation spec...    117   1e-26   Brassica rapa
emb|CDX80392.1|  BnaC07g30520D                                          117   1e-26   
ref|XP_002872080.1|  CPSF100                                            117   2e-26   
ref|XP_010255376.1|  PREDICTED: cleavage and polyadenylation spec...    117   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004499957.1|  PREDICTED: cleavage and polyadenylation spec...    115   7e-26   Cicer arietinum [garbanzo]
ref|XP_002517902.1|  cleavage and polyadenylation specificity fac...    115   8e-26   Ricinus communis
ref|XP_009401035.1|  PREDICTED: cleavage and polyadenylation spec...    113   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827641.1|  hypothetical protein AMTR_s00009p00247750          107   5e-23   Amborella trichopoda
ref|XP_010934798.1|  PREDICTED: cleavage and polyadenylation spec...    105   3e-22   Elaeis guineensis
ref|XP_008787501.1|  PREDICTED: cleavage and polyadenylation spec...    104   5e-22   Phoenix dactylifera
ref|XP_010230345.1|  PREDICTED: cleavage and polyadenylation spec...  99.0    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_003565596.1|  PREDICTED: cleavage and polyadenylation spec...  99.0    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_003578687.1|  PREDICTED: cleavage and polyadenylation spec...  98.6    5e-20   Brachypodium distachyon [annual false brome]
ref|XP_010238537.1|  PREDICTED: cleavage and polyadenylation spec...  98.6    5e-20   Brachypodium distachyon [annual false brome]
tpg|DAA59080.1|  TPA: hypothetical protein ZEAMMB73_548570            97.1    2e-19   
tpg|DAA59076.1|  TPA: hypothetical protein ZEAMMB73_548570            92.4    8e-19   
ref|XP_001757858.1|  predicted protein                                94.7    1e-18   
ref|XP_008673000.1|  PREDICTED: LOC100285191 isoform X1               93.6    3e-18   
ref|XP_002466129.1|  hypothetical protein SORBIDRAFT_01g001930        93.6    3e-18   Sorghum bicolor [broomcorn]
gb|EEE70266.1|  hypothetical protein OsJ_30409                        92.8    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661571.1|  PREDICTED: cleavage and polyadenylation spec...  92.0    1e-17   Oryza brachyantha
ref|XP_002991596.1|  hypothetical protein SELMODRAFT_429848           90.9    2e-17   
ref|XP_002971541.1|  hypothetical protein SELMODRAFT_441578           90.9    2e-17   
ref|NP_001063978.1|  Os09g0569400                                     90.5    3e-17   
gb|EEC85091.1|  hypothetical protein OsI_32459                        90.5    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004956221.1|  PREDICTED: cleavage and polyadenylation spec...  89.7    5e-17   Setaria italica
gb|EMS56660.1|  Cleavage and polyadenylation specificity factor s...  81.6    2e-14   Triticum urartu
dbj|BAJ85972.1|  predicted protein                                    78.2    4e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002507150.1|  predicted protein                                77.0    9e-13   Micromonas commoda
ref|XP_002948346.1|  hypothetical protein VOLCADRAFT_31342            73.9    4e-12   Volvox carteri f. nagariensis
ref|XP_001749611.1|  hypothetical protein                             72.8    2e-11   Monosiga brevicollis MX1
emb|CEF96643.1|  Beta-lactamase-like                                  72.4    3e-11   Ostreococcus tauri
ref|XP_001691095.1|  predicted protein                                68.6    3e-10   Chlamydomonas reinhardtii
emb|CDS10120.1|  hypothetical protein LRAMOSA02797                    68.6    5e-10   Lichtheimia ramosa
emb|CDH57001.1|  cleavage and polyadenylation specificity factors...  68.6    6e-10   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005706067.1|  cleavage and polyadenylation specificity fac...  67.8    1e-09   Galdieria sulphuraria
ref|XP_004207395.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    3e-09   Hydra vulgaris
ref|XP_005825644.1|  hypothetical protein GUITHDRAFT_89302            65.9    4e-09   Guillardia theta CCMP2712
ref|XP_005768641.1|  hypothetical protein EMIHUDRAFT_256223           60.8    4e-09   Emiliania huxleyi CCMP1516
ref|XP_003074308.1|  polyadenylation cleavage/specificity factor ...  65.5    4e-09   
emb|CEJ03739.1|  hypothetical protein RMCBS344292_17717               62.4    6e-09   Rhizopus microsporus
emb|CEG66669.1|  hypothetical protein RMATCC62417_03208               62.4    6e-09   Rhizopus microsporus
gb|KFM58192.1|  Cleavage and polyadenylation specificity factor s...  64.7    8e-09   Stegodyphus mimosarum
ref|XP_011415147.1|  PREDICTED: cleavage and polyadenylation spec...  63.9    1e-08   
ref|XP_009061636.1|  hypothetical protein LOTGIDRAFT_219936           63.5    1e-08   Lottia gigantea
gb|EFA82503.1|  beta-lactamase domain-containing protein              64.3    1e-08   Heterostelium album PN500
ref|XP_005786054.1|  hypothetical protein EMIHUDRAFT_229332           61.6    1e-08   Emiliania huxleyi CCMP1516
dbj|GAM28904.1|  hypothetical protein SAMD00019534_120800             63.5    2e-08   Acytostelium subglobosum LB1
ref|XP_001638458.1|  predicted protein                                63.5    2e-08   Nematostella vectensis
emb|CCA21717.1|  cleavage and polyadenylation specificity factor ...  63.2    2e-08   Albugo laibachii Nc14
ref|XP_005104475.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    3e-08   
emb|CEI98391.1|  hypothetical protein RMCBS344292_12500               62.8    3e-08   Rhizopus microsporus
ref|XP_010214037.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    3e-08   Tinamus guttatus
ref|XP_005780234.1|  hypothetical protein EMIHUDRAFT_463197           62.8    3e-08   Emiliania huxleyi CCMP1516
ref|XP_780045.3|  PREDICTED: cleavage and polyadenylation specifi...  62.4    5e-08   
ref|XP_004682096.1|  PREDICTED: cleavage and polyadenylation spec...  62.4    5e-08   Condylura cristata
ref|XP_001415490.1|  predicted protein                                62.4    5e-08   Ostreococcus lucimarinus CCE9901
gb|ELU12868.1|  hypothetical protein CAPTEDRAFT_155355                62.4    5e-08   Capitella teleta
gb|KFD52003.1|  hypothetical protein M513_07135                       62.0    6e-08   Trichuris suis
gb|KHJ48938.1|  cleavage and polyadenylation specificity factor s...  62.0    6e-08   Trichuris suis
ref|XP_001507374.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   Ornithorhynchus anatinus [duck-billed platypus]
emb|CDJ83222.1|  unnamed protein product                              62.0    7e-08   Haemonchus contortus [red stomach worm]
dbj|BAC35756.1|  unnamed protein product                              60.8    7e-08   Mus musculus [mouse]
ref|XP_003756188.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   Sarcophilus harrisii
ref|XP_001365312.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   Monodelphis domestica
gb|EPB87138.1|  hypothetical protein HMPREF1544_06064                 61.6    8e-08   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006839628.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   Chrysochloris asiatica
ref|NP_058552.1|  cleavage and polyadenylation specificity factor...  61.6    9e-08   Mus musculus [mouse]
ref|NP_001100223.1|  cleavage and polyadenylation specificity fac...  61.6    9e-08   Rattus norvegicus [brown rat]
ref|XP_002129804.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_007529124.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   Erinaceus europaeus [common hedgehog]
ref|XP_004352034.1|  beta-lactamase domain-containing protein         61.6    9e-08   Cavenderia fasciculata
ref|XP_006879175.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    1e-07   Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAG50992.1|  unnamed protein product                              61.2    1e-07   Homo sapiens [man]
gb|EAW81483.1|  cleavage and polyadenylation specific factor 2, 1...  61.2    1e-07   Homo sapiens [man]
gb|ELK36959.1|  Cleavage and polyadenylation specificity factor s...  61.2    1e-07   Myotis davidii
ref|XP_005871272.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
gb|ELW55806.1|  Cleavage and polyadenylation specificity factor s...  61.2    1e-07   Tupaia chinensis
ref|XP_008576222.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003787126.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_011371484.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_010834498.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Bison bison bison
ref|XP_010614631.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_008819946.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Nannospalax galili
ref|XP_008146656.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Eptesicus fuscus
ref|XP_008071140.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Carlito syrichta
ref|XP_007942690.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Orycteropus afer afer
ref|XP_002754257.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Callithrix jacchus [common marmoset]
ref|XP_002719640.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_537353.2|  PREDICTED: cleavage and polyadenylation specifi...  61.2    1e-07   Canis lupus familiaris [dogs]
gb|AAH70095.1|  Cleavage and polyadenylation specific factor 2, 1...  61.2    1e-07   Homo sapiens [man]
ref|XP_007184326.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Balaenoptera acutorostrata scammoni
ref|XP_006990947.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Peromyscus maniculatus bairdii
ref|XP_003987977.2|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Felis catus [cat]
ref|NP_787002.1|  cleavage and polyadenylation specificity factor...  61.2    1e-07   Bos taurus [bovine]
ref|XP_006155869.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_005871273.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_005390370.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Chinchilla lanigera
ref|XP_005339196.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Ictidomys tridecemlineatus
ref|XP_005343528.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Microtus ochrogaster [prairie voles]
ref|XP_005068449.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004739092.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Mustela putorius furo [black ferret]
ref|XP_004649386.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Jaculus jaculus
ref|XP_004584390.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Ochotona princeps [southern American pika]
ref|XP_004475461.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_004376734.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Trichechus manatus latirostris
ref|XP_004262395.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Orcinus orca [Orca]
ref|XP_006925597.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|NP_059133.1|  cleavage and polyadenylation specificity factor...  61.2    1e-07   Homo sapiens [man]
ref|XP_007633787.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_004883985.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_003462702.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Cavia porcellus [guinea pig]
ref|XP_003408878.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Loxodonta africana [African bush elephant]
ref|XP_003260944.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_001497134.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Equus caballus [domestic horse]
ref|NP_001244509.1|  cleavage and polyadenylation specificity fac...  61.2    1e-07   Macaca mulatta [rhesus macaque]
ref|XP_008555336.1|  PREDICTED: probable cleavage and polyadenyla...  61.2    1e-07   
ref|XP_010614630.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   
ref|XP_006754770.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  61.2    1e-07   
ref|XP_007647923.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_008696719.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Ursus maritimus [white bear]
ref|XP_006071303.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Bubalus bubalis [domestic water buffalo]
dbj|BAE24650.1|  unnamed protein product                              60.8    1e-07   Mus musculus [mouse]
ref|XP_002115881.1|  hypothetical protein TRIADDRAFT_30006            61.2    1e-07   Trichoplax adhaerens
dbj|BAE28111.1|  unnamed protein product                              60.8    1e-07   Mus musculus [mouse]
gb|KFP48087.1|  Cleavage and polyadenylation specificity factor s...  58.2    1e-07   Cathartes aura
ref|XP_004698821.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004635218.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Octodon degus
emb|CEP08367.1|  hypothetical protein                                 61.2    1e-07   Parasitella parasitica
ref|XP_006792670.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005935473.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Haplochromis burtoni
ref|XP_005731184.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Pundamilia nyererei
ref|XP_004550521.1|  PREDICTED: cleavage and polyadenylation spec...  61.2    1e-07   Maylandia zebra
ref|XP_008528425.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  60.5    1e-07   Equus przewalskii [Przewalski horse]
dbj|BAE24504.1|  unnamed protein product                              60.8    1e-07   Mus musculus [mouse]
ref|XP_011235205.1|  PREDICTED: cleavage and polyadenylation spec...  60.5    1e-07   
gb|EMT31904.1|  hypothetical protein F775_28078                       60.8    1e-07   
ref|XP_008555333.1|  PREDICTED: probable cleavage and polyadenyla...  60.8    2e-07   
emb|CAG03552.1|  unnamed protein product                              58.9    2e-07   Tetraodon nigroviridis
dbj|GAN08051.1|  cleavage and polyadenylation specificity factor ...  60.8    2e-07   Mucor ambiguus
ref|XP_004610319.1|  PREDICTED: cleavage and polyadenylation spec...  60.5    2e-07   Sorex araneus [Eurasian shrew]
ref|XP_007545403.1|  PREDICTED: cleavage and polyadenylation spec...  60.5    2e-07   
ref|XP_001951701.1|  PREDICTED: probable cleavage and polyadenyla...  60.5    2e-07   Acyrthosiphon pisum
ref|NP_001002384.1|  cleavage and polyadenylation specificity fac...  60.5    2e-07   Danio rerio [leopard danio]
ref|XP_008193780.1|  PREDICTED: probable cleavage and polyadenyla...  60.5    2e-07   Tribolium castaneum [rust-red flour beetle]
emb|CDJ87806.1|  Beta-lactamase and RNA-metabolising metallo-beta...  60.1    2e-07   Haemonchus contortus [red stomach worm]
emb|CDW57805.1|  cleavage and polyadenylation                         60.1    2e-07   Trichuris trichiura
ref|XP_005285488.1|  PREDICTED: cleavage and polyadenylation spec...  60.1    3e-07   
gb|EHJ67102.1|  putative cleavage and polyadenylation specificity...  60.1    3e-07   
gb|EGW09725.1|  Sodium/potassium/calcium exchanger 4                  60.1    3e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_004083472.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    3e-07   Oryzias latipes [Japanese rice fish]
ref|XP_007055525.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    3e-07   Chelonia mydas [green seaturtle]
ref|XP_006133719.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    3e-07   
ref|XP_005285489.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    3e-07   Chrysemys picta bellii
ref|XP_646760.1|  beta-lactamase domain-containing protein            59.7    4e-07   Dictyostelium discoideum AX4
emb|CCI40993.1|  unnamed protein product                              59.7    4e-07   Albugo candida
emb|CAG03550.1|  unnamed protein product                              59.3    4e-07   Tetraodon nigroviridis
ref|XP_001949295.2|  PREDICTED: probable cleavage and polyadenyla...  59.3    4e-07   
ref|XP_010744029.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   
ref|XP_008395681.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   Poecilia reticulata
ref|XP_008282497.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   Stegastes partitus
ref|XP_007545411.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   
ref|XP_005803161.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   Xiphophorus maculatus
ref|XP_003971833.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    4e-07   Takifugu rubripes [tiger puffer]
ref|XP_003289932.1|  hypothetical protein DICPUDRAFT_80682            59.3    5e-07   Dictyostelium purpureum
ref|XP_010014719.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    5e-07   Nestor notabilis
ref|XP_005149568.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    5e-07   Melopsittacus undulatus
ref|XP_003206716.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    5e-07   Meleagris gallopavo [common turkey]
ref|NP_001026379.1|  cleavage and polyadenylation specificity fac...  59.3    5e-07   Gallus gallus [bantam]
gb|EJD75913.1|  cleavage and polyadenylation specificity factor s...  58.9    6e-07   Loa loa
gb|EJW84982.1|  cleavage and polyadenylation specificity factor s...  58.9    6e-07   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|EFO19846.2|  cleavage and polyadenylation specificity factor s...  58.9    6e-07   Loa loa
ref|XP_001895540.1|  cleavage and polyadenylation specificity factor  58.9    6e-07   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003144223.1|  cleavage and polyadenylation specificity fac...  58.9    6e-07   
ref|XP_001321376.1|  hypothetical protein                             58.9    6e-07   Trichomonas vaginalis G3
gb|KFP78636.1|  Cleavage and polyadenylation specificity factor s...  58.9    6e-07   Apaloderma vittatum
ref|XP_009873251.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Apaloderma vittatum
ref|XP_006632745.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Lepisosteus oculatus
ref|XP_010071317.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Pterocles gutturalis
ref|XP_009688070.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Struthio camelus australis
gb|KFW90886.1|  Cleavage and polyadenylation specificity factor s...  58.9    6e-07   Phalacrocorax carbo [common cormorant]
ref|XP_009502755.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Phalacrocorax carbo [common cormorant]
ref|XP_009893658.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Charadrius vociferus
ref|XP_010165764.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Antrostomus carolinensis
ref|XP_009584324.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Fulmarus glacialis
ref|XP_009688069.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Struthio camelus australis
ref|XP_009967915.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Tyto alba [Schleiereule]
ref|XP_009981300.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Tauraco erythrolophus
ref|XP_010002024.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Chaetura pelagica
ref|XP_009935105.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Opisthocomus hoazin [hoatzin]
ref|XP_010184704.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Mesitornis unicolor
ref|XP_009951887.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Leptosomus discolor
ref|XP_009481667.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Pelecanus crispus
ref|XP_009076241.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Acanthisitta chloris
ref|XP_009694023.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Cariama cristata
ref|XP_010118956.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Chlamydotis macqueenii
ref|XP_010207574.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Colius striatus
ref|XP_009647268.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Egretta garzetta
ref|XP_010133552.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Buceros rhinoceros silvestris
ref|XP_008942932.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Merops nubicus
ref|XP_008931835.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Manacus vitellinus
ref|XP_009279062.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Aptenodytes forsteri
ref|XP_008490686.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   
ref|XP_002200593.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   
ref|XP_006269222.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Alligator mississippiensis
ref|XP_006032867.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Alligator sinensis
ref|XP_005520240.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005417904.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Geospiza fortis
ref|XP_005483223.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Zonotrichia albicollis
ref|XP_005241978.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Falco peregrinus [peregrine]
ref|XP_005047579.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Ficedula albicollis
ref|XP_005021502.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   
ref|XP_005506196.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Columba livia [carrier pigeon]
ref|XP_007422600.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Python bivittatus
ref|XP_008110699.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Anolis carolinensis [Carolina anole]
gb|ETE64348.1|  Cleavage and polyadenylation specificity factor s...  58.9    6e-07   Ophiophagus hannah
ref|XP_001657690.1|  AAEL000118-PA                                    58.9    6e-07   
ref|XP_001850949.1|  cleavage and polyadenylation specificity fac...  58.9    6e-07   Culex quinquefasciatus
ref|XP_009928126.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   Haliaeetus albicilla
ref|XP_007422599.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    6e-07   
ref|XP_007422598.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   
ref|XP_010392610.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   
gb|ERG80852.1|  putative cleavage and polyadenylation specificity...  58.9    7e-07   
ref|XP_007255534.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   Astyanax mexicanus [blind cave fish]
ref|XP_010880559.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   Esox lucius
ref|XP_010880557.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   Esox lucius
emb|CDQ84001.1|  unnamed protein product                              58.9    7e-07   
gb|ACN10893.1|  Cleavage and polyadenylation specificity factor s...  58.9    7e-07   
ref|NP_001134023.1|  cleavage and polyadenylation specificity fac...  58.9    7e-07   
gb|KFZ48733.1|  Cleavage and polyadenylation specificity factor s...  58.9    7e-07   
gb|KFQ90264.1|  Cleavage and polyadenylation specificity factor s...  58.9    7e-07   
ref|XP_009903114.1|  PREDICTED: cleavage and polyadenylation spec...  58.9    7e-07   
gb|KDR21766.1|  putative cleavage and polyadenylation specificity...  58.9    7e-07   
ref|XP_005538034.1|  cleavage and polyadenylation specific factor...  58.9    7e-07   
gb|KHN82608.1|  putative cleavage and polyadenylation specificity...  58.9    8e-07   
ref|XP_001683769.1|  putative cleavage and polyadenylation specif...  58.5    8e-07   
ref|XP_009826610.1|  hypothetical protein, variant 4                  58.5    8e-07   
ref|XP_009826616.1|  hypothetical protein, variant 1                  58.5    8e-07   
ref|XP_009826607.1|  hypothetical protein H257_03975                  58.5    8e-07   
emb|CDQ66127.1|  unnamed protein product                              57.8    9e-07   
ref|XP_011500980.1|  PREDICTED: probable cleavage and polyadenyla...  58.5    9e-07   
ref|XP_009826614.1|  hypothetical protein, variant 8                  58.5    9e-07   
ref|XP_009826613.1|  hypothetical protein, variant 7                  58.5    9e-07   
ref|XP_008869266.1|  hypothetical protein, variant                    58.5    9e-07   
ref|XP_008869265.1|  hypothetical protein H310_06119                  58.5    9e-07   
ref|XP_010148765.1|  PREDICTED: cleavage and polyadenylation spec...  58.2    1e-06   
ref|XP_009826611.1|  hypothetical protein, variant 5                  58.2    1e-06   
ref|XP_009826608.1|  hypothetical protein, variant 2                  58.2    1e-06   
ref|XP_008311723.1|  PREDICTED: cleavage and polyadenylation spec...  58.2    1e-06   
gb|KDO26595.1|  hypothetical protein SPRG_07999                       58.2    1e-06   
ref|XP_008613583.1|  hypothetical protein SDRG_09428                  58.2    1e-06   
ref|XP_010285450.1|  PREDICTED: cleavage and polyadenylation spec...  58.2    1e-06   
ref|XP_010774825.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  58.2    1e-06   
ref|XP_008485729.1|  PREDICTED: probable cleavage and polyadenyla...  54.7    1e-06   
gb|KFO05468.1|  Cleavage and polyadenylation specificity factor s...  58.2    1e-06   
ref|XP_010303677.1|  PREDICTED: cleavage and polyadenylation spec...  57.8    1e-06   
ref|XP_003737142.1|  PREDICTED: probable cleavage and polyadenyla...  57.8    1e-06   
ref|XP_003737143.1|  PREDICTED: probable cleavage and polyadenyla...  57.8    1e-06   
ref|XP_003737144.1|  PREDICTED: probable cleavage and polyadenyla...  57.8    1e-06   
ref|XP_007902040.1|  PREDICTED: cleavage and polyadenylation spec...  57.8    2e-06   
ref|XP_003446332.1|  PREDICTED: cleavage and polyadenylation spec...  57.8    2e-06   
gb|ESA21701.1|  hypothetical protein GLOINDRAFT_119294                57.8    2e-06   
ref|XP_004519762.1|  PREDICTED: LOW QUALITY PROTEIN: probable cle...  57.8    2e-06   
ref|XP_005986658.1|  PREDICTED: cleavage and polyadenylation spec...  57.4    2e-06   
ref|XP_002013648.1|  GL24247                                          55.1    2e-06   
ref|XP_011203816.1|  PREDICTED: probable cleavage and polyadenyla...  57.4    2e-06   
ref|XP_011184046.1|  PREDICTED: probable cleavage and polyadenyla...  57.4    2e-06   
ref|XP_009516752.1|  hypothetical protein PHYSODRAFT_473604           56.2    2e-06   
ref|XP_011049258.1|  PREDICTED: probable cleavage and polyadenyla...  57.4    2e-06   
ref|XP_011170847.1|  PREDICTED: probable cleavage and polyadenyla...  57.4    2e-06   
ref|XP_008913556.1|  hypothetical protein, variant                    57.4    2e-06   
ref|XP_008913555.1|  hypothetical protein PPTG_17632                  57.4    2e-06   
ref|XP_009559889.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  57.4    2e-06   
gb|KFB52768.1|  hypothetical protein ZHAS_00021031                    57.4    2e-06   
gb|ETN63991.1|  cleavage and polyadenylation specificity factor       57.4    2e-06   
ref|XP_006812203.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  57.0    3e-06   
ref|XP_003876069.1|  cleavage and polyadenylation specificity fac...  57.0    3e-06   
ref|XP_002137430.2|  GA26549                                          56.6    3e-06   
ref|XP_002037143.1|  GM12754                                          56.6    3e-06   
ref|XP_002098643.1|  GE26465, isoform A                               56.6    3e-06   
ref|XP_001981406.1|  GG11633                                          56.6    3e-06   
ref|NP_651658.1|  cleavage and polyadenylation specificity factor...  56.6    3e-06   
ref|XP_002606636.1|  hypothetical protein BRAFLDRAFT_120095           56.2    4e-06   
ref|XP_002997001.1|  cleavage and polyadenylation specificity fac...  55.1    4e-06   
ref|XP_002071979.1|  GK22564                                          56.2    4e-06   
ref|XP_002054797.1|  GJ24636                                          56.2    5e-06   
ref|XP_001999467.1|  GI23051                                          56.2    5e-06   
ref|XP_001994270.1|  GH10247                                          56.2    5e-06   
ref|XP_001955372.1|  GF16269                                          56.2    5e-06   
gb|EFN82620.1|  Probable cleavage and polyadenylation specificity...  56.2    5e-06   
ref|XP_011142384.1|  PREDICTED: probable cleavage and polyadenyla...  56.2    5e-06   
ref|XP_002098644.1|  GE26465, isoform B                               55.8    5e-06   
ref|XP_006680263.1|  hypothetical protein BATDEDRAFT_12823            56.2    5e-06   
ref|NP_001120452.1|  cleavage and polyadenylation specific factor...  55.8    6e-06   
ref|XP_011258461.1|  PREDICTED: probable cleavage and polyadenyla...  55.8    6e-06   
ref|XP_001565522.2|  putative cleavage and polyadenylation specif...  55.8    7e-06   
ref|NP_001081123.1|  cleavage and polyadenylation specificity fac...  55.8    7e-06   
ref|XP_002431330.1|  Cleavage and polyadenylation specificity fac...  55.8    7e-06   
ref|XP_003485880.1|  PREDICTED: probable cleavage and polyadenyla...  55.5    8e-06   
ref|XP_003395491.1|  PREDICTED: probable cleavage and polyadenyla...  55.5    8e-06   
ref|XP_003861348.1|  cleavage and polyadenylation specificity fac...  55.5    9e-06   
ref|XP_001466050.1|  putative cleavage and polyadenylation specif...  55.5    9e-06   
emb|CBJ48436.1|  conserved unknown protein                            55.5    9e-06   
ref|XP_312464.4|  AGAP002474-PA                                       55.5    9e-06   
ref|XP_003701904.1|  PREDICTED: probable cleavage and polyadenyla...  55.5    1e-05   
ref|XP_003696322.1|  PREDICTED: probable cleavage and polyadenyla...  55.5    1e-05   
ref|XP_006561139.1|  PREDICTED: probable cleavage and polyadenyla...  55.1    1e-05   
ref|XP_006613635.1|  PREDICTED: probable cleavage and polyadenyla...  55.1    1e-05   
gb|EZA60898.1|  putative cleavage and polyadenylation specificity...  55.1    1e-05   
ref|XP_011351985.1|  PREDICTED: probable cleavage and polyadenyla...  55.1    1e-05   
ref|XP_010699590.1|  cleavage and polyadenylation specificity fac...  55.1    1e-05   
ref|XP_005715060.1|  Cleavage and polyadenylation specificity fac...  55.1    1e-05   
ref|XP_007515701.1|  predicted protein                                55.1    1e-05   
ref|XP_009495067.1|  hypothetical protein H696_02897                  55.1    1e-05   
ref|XP_008216190.1|  PREDICTED: probable cleavage and polyadenyla...  54.7    1e-05   
gb|ENN73673.1|  hypothetical protein YQE_09718                        54.7    2e-05   
gb|EFX73157.1|  hypothetical protein DAPPUDRAFT_58164                 53.9    3e-05   
gb|KFH70570.1|  hypothetical protein MVEG_03420                       53.9    3e-05   
gb|EFB19585.1|  hypothetical protein PANDA_019064                     53.1    3e-05   
ref|XP_005178538.1|  PREDICTED: probable cleavage and polyadenyla...  52.8    7e-05   
ref|XP_004340269.1|  cleavage and polyadenylation specificity fac...  52.4    9e-05   
ref|XP_011305603.1|  PREDICTED: probable cleavage and polyadenyla...  52.4    1e-04   
gb|KIH43334.1|  hypothetical protein ANCDUO_26663                     50.1    1e-04   
ref|XP_003375603.1|  cleavage and polyadenylation specificity fac...  52.0    2e-04   
ref|XP_002673225.1|  predicted protein                                51.6    2e-04   
ref|XP_009021832.1|  hypothetical protein HELRODRAFT_113444           50.4    4e-04   
gb|EKG03521.1|  cleavage and polyadenylation specificity factor, ...  50.4    4e-04   
gb|KIH66261.1|  metallo-beta-lactamase domain protein                 50.4    4e-04   
gb|EYC31771.1|  hypothetical protein Y032_0003g1227                   50.4    4e-04   
emb|CCC94633.1|  unnamed protein product                              50.1    5e-04   
ref|NP_504822.1|  Protein CPSF-2                                      50.1    6e-04   
emb|CBY19228.1|  unnamed protein product                              50.1    7e-04   
ref|XP_001913149.1|  cleavage and polyadenylation factor              50.1    7e-04   



>gb|EYU19553.1| hypothetical protein MIMGU_mgv1a0019021mg, partial [Erythranthe 
guttata]
Length=220

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFDTSLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDTSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_011084423.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Sesamum indicum]
Length=740

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/61 (98%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDP05186.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQVKPLCGVYNENPL+YLVSVDGFNFL+DCGWNDHFD SLL+PLSRVA TVDAVLL
Sbjct  1    MGTSVQVKPLCGVYNENPLAYLVSVDGFNFLVDCGWNDHFDASLLEPLSRVAPTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004234405.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Solanum lycopersicum]
Length=739

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFDTSLLQPLSRVASTVDAVL+
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDTSLLQPLSRVASTVDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010671861.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=738

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLSR+ASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSRIASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006353867.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Solanum tuberosum]
Length=739

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGV+NENPLSYLVS+DGFNFL+DCGWNDHFDTSLLQPLSRVASTVDAVL+
Sbjct  1    MGTSVQVTPLCGVFNENPLSYLVSIDGFNFLVDCGWNDHFDTSLLQPLSRVASTVDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009342955.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Pyrus x bretschneideri]
Length=739

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009342954.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Pyrus x bretschneideri]
Length=740

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009340044.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2 [Pyrus x bretschneideri]
Length=738

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007220238.1| hypothetical protein PRUPE_ppa001928mg [Prunus persica]
 gb|EMJ21437.1| hypothetical protein PRUPE_ppa001928mg [Prunus persica]
Length=740

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008234231.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Prunus mume]
Length=739

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008234230.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Prunus mume]
Length=740

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009789216.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nicotiana sylvestris]
Length=739

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FDTSLLQPLSRVAS+VDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDQFDTSLLQPLSRVASSVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009605983.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Nicotiana tomentosiformis]
Length=739

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FDTSLLQPLSRVAS+VDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDQFDTSLLQPLSRVASSVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003548179.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform 1 [Glycine max]
 gb|KHN09330.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=738

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFD SLLQPL+RVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDPSLLQPLARVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008376608.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Malus domestica]
Length=740

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFN LIDCGWNDHFD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNLLIDCGWNDHFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008376609.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Malus domestica]
Length=739

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFN LIDCGWNDHFD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNLLIDCGWNDHFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004171219.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2-like, partial [Cucumis sativus]
Length=501

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVD FNFLIDCGWNDHFD +LLQPLSRVAST+DAVL+
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDDFNFLIDCGWNDHFDPALLQPLSRVASTIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010421193.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Camelina sativa]
Length=739

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVDGFNFLIDCGWND FDTSLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDGFNFLIDCGWNDLFDTSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010421194.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Camelina sativa]
Length=739

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVDGFNFLIDCGWND FDTSLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDGFNFLIDCGWNDLFDTSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010493506.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Camelina sativa]
Length=739

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVDGFNFLIDCGWND FDTSLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDGFNFLIDCGWNDLFDTSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_197776.1| cleavage and polyadenylation specificity factor 100 [Arabidopsis 
thaliana]
 sp|Q9LKF9.2|CPSF2_ARATH RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=AtCPSF100; Short=CPSF 100 
kDa subunit; AltName: Full=Protein EMBRYO DEFECTIVE 1265; 
AltName: Full=Protein ENHANCED SILENCING PHENOTYPE 5 [Arabidopsis 
thaliana]
 dbj|BAB10061.1| cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AAK59487.1| putative cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AAO42368.1| putative cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AED93228.1| cleavage and polyadenylation specificity factor 100 [Arabidopsis 
thaliana]
Length=739

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FDTSLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDTSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006287134.1| hypothetical protein CARUB_v10000306mg [Capsella rubella]
 gb|EOA20032.1| hypothetical protein CARUB_v10000306mg [Capsella rubella]
Length=739

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FDTSLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDTSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KHN18611.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=311

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSV+V PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFD S LQPL+RVAST+DAVLL
Sbjct  1    MGTSVRVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDPSHLQPLARVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003590295.1| Cleavage and polyadenylation specificity factor subunit [Medicago 
truncatula]
Length=630

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+D FN LIDCGWNDHFD SLLQPLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDSFNILIDCGWNDHFDPSLLQPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KHG29898.1| Cleavage and polyadenylation specificity factor subunit 2 -like 
protein [Gossypium arboreum]
Length=692

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KDP24115.1| hypothetical protein JCGZ_25772 [Jatropha curcas]
Length=741

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+D FNFLIDCGWNDHFD SLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDSFNFLIDCGWNDHFDPSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Vitis vinifera]
 emb|CBI22708.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFD S LQPL+RVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDPSFLQPLARVASTIDAVLL  60

Query  630  S  632
            +
Sbjct  61   A  61



>gb|KJB52780.1| hypothetical protein B456_008G276300 [Gossypium raimondii]
Length=742

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FD SLLQPLSRVASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDPSLLQPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004308076.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Fragaria vesca subsp. vesca]
Length=739

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQ+ PLCGVYNENPLSYLVS+DGFN LIDCGWNDHFD SLLQPLSRVAS VDAVLL
Sbjct  1    MGTSVQITPLCGVYNENPLSYLVSIDGFNLLIDCGWNDHFDPSLLQPLSRVASAVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008439247.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Cucumis melo]
Length=738

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVD FNFLIDCGWNDHFD +LLQPLSRVAST+DAVL+
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDDFNFLIDCGWNDHFDPALLQPLSRVASTIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007152251.1| hypothetical protein PHAVU_004G114000g [Phaseolus vulgaris]
 gb|ESW24245.1| hypothetical protein PHAVU_004G114000g [Phaseolus vulgaris]
Length=739

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+D FNFLIDCGWNDHFD SLLQPLSRVAST+DAVL+
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDDFNFLIDCGWNDHFDPSLLQPLSRVASTIDAVLV  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004140773.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Cucumis sativus]
 gb|KGN57386.1| hypothetical protein Csa_3G182220 [Cucumis sativus]
Length=738

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVD FNFLIDCGWNDHFD +LLQPLSRVAST+DAVL+
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDDFNFLIDCGWNDHFDPALLQPLSRVASTIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006587302.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Glycine max]
Length=739

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFD S LQPL+RVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDPSHLQPLARVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007038719.1| Cleavage and polyadenylation specificity factor 100 isoform 2 
[Theobroma cacao]
 gb|EOY23220.1| Cleavage and polyadenylation specificity factor 100 isoform 2 
[Theobroma cacao]
Length=542

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FD SLLQPLSRVA T+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDPSLLQPLSRVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|AAF82809.1|AF283277_1 polyadenylation cleavage/specificity factor 100 kDa subunit [Arabidopsis 
thaliana]
Length=739

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FDTSLL+PL RVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDTSLLEPLPRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010108351.1| Cleavage and polyadenylation specificity factor subunit 2 [Morus 
notabilis]
 gb|EXC19142.1| Cleavage and polyadenylation specificity factor subunit 2 [Morus 
notabilis]
Length=741

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWNDH D S+LQPL++VASTVDAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDHLDPSILQPLTKVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KEH41412.1| cleavage and polyadenylation specificity factor subunit 2 [Medicago 
truncatula]
Length=740

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+D FN LIDCGWNDHFD SLLQPLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDSFNILIDCGWNDHFDPSLLQPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006421947.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 gb|ESR35187.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
Length=634

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GV+NENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAST+DAVLL
Sbjct  1    MGTSVQVTPLSGVFNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KHN41472.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=775

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSV+V PLCGVYNENPLSYLVS+DGFNFL+DCGWNDHFD S LQPL+RVAST+DAVLL
Sbjct  1    MGTSVRVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDHFDPSHLQPLARVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KFK27677.1| hypothetical protein AALP_AA8G414300 [Arabis alpina]
Length=735

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWND FD SLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLVDCGWNDLFDPSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006394646.1| hypothetical protein EUTSA_v10003707mg [Eutrema salsugineum]
 gb|ESQ31932.1| hypothetical protein EUTSA_v10003707mg [Eutrema salsugineum]
Length=739

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFL+DCGWND FD SLL+PLSRVAST+DAVLL
Sbjct  1    MGTSVQVSPLCGVYNENPLSYLVSIDGFNFLVDCGWNDLFDPSLLEPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007038718.1| Cleavage and polyadenylation specificity factor 100 isoform 1 
[Theobroma cacao]
 gb|EOY23219.1| Cleavage and polyadenylation specificity factor 100 isoform 1 
[Theobroma cacao]
Length=742

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLIDCGWND FD SLLQPLSRVA T+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDCGWNDLFDPSLLQPLSRVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006421948.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 ref|XP_006490411.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Citrus sinensis]
 gb|ESR35188.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 gb|KDO52016.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=739

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GV+NENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAST+DAVLL
Sbjct  1    MGTSVQVTPLSGVFNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010454671.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Camelina sativa]
Length=739

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVSVDGFNFLIDCGWND FDTSLL+ LSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSVDGFNFLIDCGWNDLFDTSLLEALSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KDO52015.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=706

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GV+NENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAST+DAVLL
Sbjct  1    MGTSVQVTPLSGVFNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KDO52014.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=721

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GV+NENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAST+DAVLL
Sbjct  1    MGTSVQVTPLSGVFNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006490412.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Citrus sinensis]
Length=738

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GV+NENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAST+DAVLL
Sbjct  1    MGTSVQVTPLSGVFNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010035148.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Eucalyptus grandis]
 gb|KCW46443.1| hypothetical protein EUGRSUZ_K00275 [Eucalyptus grandis]
Length=735

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGF FL+DCGWNDHFD SLL PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFCFLVDCGWNDHFDPSLLHPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010035149.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Eucalyptus grandis]
 gb|KCW46444.1| hypothetical protein EUGRSUZ_K00275 [Eucalyptus grandis]
Length=734

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGF FL+DCGWNDHFD SLL PLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFCFLVDCGWNDHFDPSLLHPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_011008814.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Populus euphratica]
 ref|XP_011009640.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Populus euphratica]
Length=740

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAS +DAVLL
Sbjct  1    MGTSVQVTPLSGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006369487.1| Cleavage and polyadenylation specificity factor family protein 
[Populus trichocarpa]
 gb|ERP66056.1| Cleavage and polyadenylation specificity factor family protein 
[Populus trichocarpa]
Length=740

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GVYNENPLSYLVS+DGFNFLIDCGWNDHFD SLLQPLS+VAS +DAVLL
Sbjct  1    MGTSVQVTPLSGVYNENPLSYLVSIDGFNFLIDCGWNDHFDPSLLQPLSKVASKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDX88053.1| BnaA06g26440D [Brassica napus]
Length=739

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPL+YLVS+DGFNFL+DCGWND FD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVSPLCGVYNENPLAYLVSIDGFNFLLDCGWNDLFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009150911.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Brassica rapa]
Length=739

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPL+YLVS+DGFNFL+DCGWND FD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVSPLCGVYNENPLAYLVSIDGFNFLLDCGWNDLFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDX80392.1| BnaC07g30520D [Brassica napus]
Length=739

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPL+YLVS+DGFNFL+DCGWND FD SLL+PLSRVASTVDAVLL
Sbjct  1    MGTSVQVSPLCGVYNENPLAYLVSIDGFNFLLDCGWNDLFDPSLLEPLSRVASTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002872080.1| CPSF100 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48339.1| CPSF100 [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/61 (89%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GVYNENPLSYLVS+DGFNFLIDCGWND FDTSLL+PLSRVAS++DAVLL
Sbjct  1    MGTSVQVTPLSGVYNENPLSYLVSIDGFNFLIDCGWNDLFDTSLLEPLSRVASSIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010255376.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nelumbo nucifera]
Length=739

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPL YL+S+DGFNFL+DCGWND FDTSLLQPLSR++ST+DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLCYLLSIDGFNFLVDCGWNDLFDTSLLQPLSRISSTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004499957.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Cicer arietinum]
Length=740

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVYNENPLSYLVS+DGFNFLID GWND+FD SLLQPLS+VAS++DAVLL
Sbjct  1    MGTSVQVTPLCGVYNENPLSYLVSIDGFNFLIDVGWNDNFDPSLLQPLSKVASSIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002517902.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF44420.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=740

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL GVYNENPLSYL+S+D FN LIDCGWNDHFD SLLQPLSRVAST+DAVLL
Sbjct  1    MGTSVQVTPLNGVYNENPLSYLISIDNFNLLIDCGWNDHFDPSLLQPLSRVASTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009401035.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Musa acuminata subsp. malaccensis]
Length=735

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVY+ENPL YL+S+DGFNFL+DCGWNDHFD +LLQPLSRV++ VDAVLL
Sbjct  1    MGTSVQVTPLCGVYSENPLCYLLSIDGFNFLMDCGWNDHFDPNLLQPLSRVSTKVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006827641.1| hypothetical protein AMTR_s00009p00247750 [Amborella trichopoda]
 gb|ERM95057.1| hypothetical protein AMTR_s00009p00247750 [Amborella trichopoda]
Length=737

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQ+ PL GV++ENPLSYL+S+DGFNFL+DCGWND FD  LLQPLSRV+ST+DAVLL
Sbjct  1    MGTSVQLTPLSGVHSENPLSYLLSLDGFNFLVDCGWNDFFDPELLQPLSRVSSTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010934798.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Elaeis guineensis]
Length=739

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVY+ENPL YL+S+DGFNFL+DCGWND FD +LL+PL+R+A  +DAVLL
Sbjct  1    MGTSVQVTPLCGVYSENPLCYLLSIDGFNFLMDCGWNDLFDENLLKPLARLAPKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008787501.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Phoenix dactylifera]
Length=739

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PLCGVY+E+PL YL+S+DGFNFL+DCGWND FD +LL+PL+RVA  +DAVLL
Sbjct  1    MGTSVQVTPLCGVYSESPLCYLLSIDGFNFLMDCGWNDLFDENLLKPLARVAPKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010230345.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Brachypodium distachyon]
Length=739

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW DH D SLLQPL+RVA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDHCDPSLLQPLARVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003565596.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Brachypodium distachyon]
Length=738

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW DH D SLLQPL+RVA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDHCDPSLLQPLARVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003578687.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Brachypodium distachyon]
Length=738

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW DH D SLLQPL+RVA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDHCDPSLLQPLARVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010238537.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Brachypodium distachyon]
Length=739

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW DH D SLLQPL+RVA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDHCDPSLLQPLARVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>tpg|DAA59080.1| TPA: hypothetical protein ZEAMMB73_548570 [Zea mays]
Length=766

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  DTS LQPL++VA TVDAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDTSQLQPLAKVAPTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>tpg|DAA59076.1| TPA: hypothetical protein ZEAMMB73_548570 [Zea mays]
Length=309

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  DTS LQPL++VA TVDAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDTSQLQPLAKVAPTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001757858.1| predicted protein [Physcomitrella patens]
 gb|EDQ77498.1| predicted protein [Physcomitrella patens]
Length=724

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G ++E PL YL+ VDGF FL+DCGW D FD SLL+PL  VA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAHSEAPLCYLLQVDGFRFLLDCGWTDSFDLSLLEPLKSVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008673000.1| PREDICTED: LOC100285191 isoform X1 [Zea mays]
 gb|ACL53436.1| unknown [Zea mays]
 tpg|DAA59077.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 1 [Zea mays]
 tpg|DAA59078.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 2 [Zea mays]
 tpg|DAA59079.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 3 [Zea mays]
Length=737

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  DTS LQPL++VA TVDAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDTSQLQPLAKVAPTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002466129.1| hypothetical protein SORBIDRAFT_01g001930 [Sorghum bicolor]
 gb|EER93127.1| hypothetical protein SORBIDRAFT_01g001930 [Sorghum bicolor]
Length=738

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  DTS LQPL++VA TVDAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDTSQLQPLAKVAPTVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EEE70266.1| hypothetical protein OsJ_30409 [Oryza sativa Japonica Group]
Length=1073

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  D S LQPL++VA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDPSHLQPLAKVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006661571.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Oryza brachyantha]
Length=738

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  D S LQPL+RVA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDPSHLQPLARVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002991596.1| hypothetical protein SELMODRAFT_429848 [Selaginella moellendorffii]
 gb|EFJ07350.1| hypothetical protein SELMODRAFT_429848 [Selaginella moellendorffii]
Length=715

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQ+ PL G ++E PL YL+ VD F FL+DCGWND FD SLLQPL  VA T+DAVLL
Sbjct  1    MGTSVQLTPLAGAHSEGPLCYLLQVDDFRFLLDCGWNDVFDVSLLQPLVSVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002971541.1| hypothetical protein SELMODRAFT_441578 [Selaginella moellendorffii]
 gb|EFJ27290.1| hypothetical protein SELMODRAFT_441578 [Selaginella moellendorffii]
Length=721

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQ+ PL G ++E PL YL+ VD F FL+DCGWND FD SLLQPL  VA T+DAVLL
Sbjct  1    MGTSVQLTPLAGAHSEGPLCYLLQVDDFRFLLDCGWNDVFDVSLLQPLVSVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_001063978.1| Os09g0569400 [Oryza sativa Japonica Group]
 sp|Q652P4.1|CPSF2_ORYSJ RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Oryza 
sativa Japonica Group]
 dbj|BAD46223.1| putative cleavage and polyadenylation specificity factor [Oryza 
sativa Japonica Group]
 dbj|BAF25892.1| Os09g0569400 [Oryza sativa Japonica Group]
Length=738

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  D S LQPL++VA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDPSHLQPLAKVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EEC85091.1| hypothetical protein OsI_32459 [Oryza sativa Indica Group]
Length=1195

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  D S LQPL++VA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDPSHLQPLAKVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004956221.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Setaria italica]
Length=737

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGTSVQV PL G Y E PL YL++VDGF FL+DCGW D  DTS LQ L++VA T+DAVLL
Sbjct  1    MGTSVQVTPLSGAYGEGPLCYLLAVDGFRFLLDCGWTDLCDTSQLQALAKVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EMS56660.1| Cleavage and polyadenylation specificity factor subunit 2 [Triticum 
urartu]
Length=741

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  474  PLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            PL G Y E PL YL++V GF FL+DCGW DH D +LLQPL+RVA T+DAVLLS
Sbjct  2    PLSGAYGEGPLCYLLAVAGFRFLLDCGWTDHCDPALLQPLARVAPTIDAVLLS  54



>dbj|BAJ85972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  489  YNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            Y E PL YL++VDGF FL+DCGW DH D +LLQPL+RVA T+DAVLLS
Sbjct  2    YGEGPLCYLLAVDGFRFLLDCGWTDHCDPALLQPLARVAPTIDAVLLS  49



>ref|XP_002507150.1| predicted protein [Micromonas sp. RCC299]
 ref|XP_002507151.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68408.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68409.1| predicted protein [Micromonas sp. RCC299]
Length=808

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +3

Query  453  GTSVQVKPLCGV--YNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            GT ++  PL GV    E+P  Y++ +DGF  L+DCGWND FD +LL+PL++VA+ VDAVL
Sbjct  5    GTRIKFSPLYGVQGIGEDPFCYVLDLDGFKILLDCGWNDSFDVNLLEPLAKVAAEVDAVL  64

Query  627  LS  632
            +S
Sbjct  65   IS  66



>ref|XP_002948346.1| hypothetical protein VOLCADRAFT_31342 [Volvox carteri f. nagariensis]
 gb|EFJ50753.1| hypothetical protein VOLCADRAFT_31342 [Volvox carteri f. nagariensis]
Length=375

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M TSV+  PL GV  E+PL YL+ +D F  L+DCGW+++FD S L+P+ RV   V+AVLL
Sbjct  1    METSVRFTPLSGVDAESPLCYLLEIDSFTILLDCGWDENFDESALEPIKRVLPRVNAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001749611.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85662.1| predicted protein [Monosiga brevicollis MX1]
Length=770

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M   V+V+ L GV +E+P  YL+ +DG   L+DCGW++HFDT+ L  L++VAST+D VLL
Sbjct  1    MAFIVRVEALSGVLDESPPCYLLELDGVRILLDCGWSEHFDTTQLDALAKVASTIDLVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CEF96643.1| Beta-lactamase-like [Ostreococcus tauri]
Length=800

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  390  TESLLPHNCKAQLKAKRITAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHF  569
            TE  L  + +A ++ K +   G  V V PL GV  E  + Y VS+DG N L+DCGW D F
Sbjct  2    TELALVLDGEAPVRKKEVE-RGNKVLVTPLYGVRGERAMCYHVSIDGCNILLDCGWTDAF  60

Query  570  DTSLLQPLSRVASTVDAVLLS  632
            D  +L+PL  +A  VDAVL+S
Sbjct  61   DVEMLKPLEAIAKDVDAVLIS  81



>ref|XP_001691095.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05541.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=389

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M T V+  PLCGV  ++PL  L+ +D +  L+DCGW+D FD +LL P+ +V   +DAVLL
Sbjct  1    METVVRYTPLCGVGEDSPLCSLLEIDDYTILLDCGWDDSFDVALLDPVLKVLPRIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDS10120.1| hypothetical protein LRAMOSA02797 [Absidia idahoensis var. thermophila]
Length=780

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NENPL YL+ +D    L+DCGW+D FDT  L  L +VA  +DAVL+
Sbjct  1    MTSYIKFTPISGAKNENPLCYLLEIDEVKILLDCGWSDTFDTQDLANLKKVAKQIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDH57001.1| cleavage and polyadenylation specificity factorsubunit 2 [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=783

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NENPL YL+ +D    L+DCGW+D FDT  L  L +VA  +DAVL+
Sbjct  1    MTSYIKFTPISGAKNENPLCYLLEIDEVKILLDCGWSDTFDTDDLANLKKVAKQIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005706067.1| cleavage and polyadenylation specificity factor subunit 2 [Galdieria 
sulphuraria]
 gb|EME29547.1| cleavage and polyadenylation specificity factor subunit 2 [Galdieria 
sulphuraria]
Length=747

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNEN-PLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            M + ++  PL GV  E+  + YL+ +D F  L+DCGWND F+ +LL+PL R+A  VDAVL
Sbjct  1    MSSILRFTPLYGVKTEDLAVCYLLEIDDFRILLDCGWNDRFEETLLEPLRRIAPRVDAVL  60

Query  627  LS  632
            +S
Sbjct  61   IS  62



>ref|XP_004207395.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Hydra vulgaris]
Length=105

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  PL G  +E PL YL+ VD F FL+DCGW+++    +++ + R A ++DAVLL
Sbjct  1    MTSIIRFTPLSGAQDEGPLCYLLQVDEFKFLLDCGWDENLSQDVIENIKRHAHSIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005825644.1| hypothetical protein GUITHDRAFT_89302 [Guillardia theta CCMP2712]
 gb|EKX38664.1| hypothetical protein GUITHDRAFT_89302 [Guillardia theta CCMP2712]
Length=770

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V+  PLCG  +E PL YL+ +D    L+DCGW+++FD   L+ L ++A T+DA+LL
Sbjct  1    MSSLVKFTPLCGARSEEPLCYLLEIDEACILLDCGWDENFDVVSLRKLIKIAPTLDAILL  60

Query  630  S  632
            +
Sbjct  61   T  61



>ref|XP_005768641.1| hypothetical protein EMIHUDRAFT_256223, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD16212.1| hypothetical protein EMIHUDRAFT_256223, partial [Emiliania huxleyi 
CCMP1516]
Length=86

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  444  TAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAV  623
            T + TSV   PL G       S L+ VDG   L+DCGW   FD S+L+PL  VA+ VDAV
Sbjct  13   TTVRTSVHFTPLRGSSGGAAPSGLLEVDGLTLLLDCGWEPPFDVSVLEPLRGVAARVDAV  72

Query  624  LLS  632
            LLS
Sbjct  73   LLS  75



>ref|XP_003074308.1| polyadenylation cleavage/specificity factor 100 kDa subunit (ISS) 
[Ostreococcus tauri]
Length=807

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = +3

Query  390  TESLLPHNCKAQLKAKRITAMGTSVQVKPLCGVYN-------ENPLSYLVSVDGFNFLID  548
            TE  L  + +A ++ K +   G  V V PL GV         E  + Y VS+DG N L+D
Sbjct  2    TELALVLDGEAPVRKKEVE-RGNKVLVTPLYGVRGVDFDGAGERAMCYHVSIDGCNILLD  60

Query  549  CGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            CGW D FD  +L+PL  +A  VDAVL+S
Sbjct  61   CGWTDAFDVEMLKPLEAIAKDVDAVLIS  88



>emb|CEJ03739.1| hypothetical protein RMCBS344292_17717 [Rhizopus microsporus]
Length=181

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D FD   L  L +++  +DAVLL
Sbjct  1    MTSYIKFTPISGSKNEDPLCYLLEIDEVKILLDCGWSDSFDIDSLSNLKKISKQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CEG66669.1| hypothetical protein RMATCC62417_03208 [Rhizopus microsporus]
Length=181

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D FD   L  L +++  +DAVLL
Sbjct  1    MTSYIKFTPISGSKNEDPLCYLLEIDEVKILLDCGWSDSFDIDSLSNLKKISKQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KFM58192.1| Cleavage and polyadenylation specificity factor subunit 2, partial 
[Stegodyphus mimosarum]
Length=749

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++ PL GVY+E+P  Y++ VD F FL+DCGW+++F+ + ++ L +    +DAVLL
Sbjct  1    MTSIIKLLPLSGVYSEDPHCYILQVDEFRFLLDCGWDENFNMTHIKELKKHIHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_011415147.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Crassostrea gigas]
Length=333

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++P  G +NE+P  Y++ VD F FL+DCGW++ F    ++ + R A  +DA+LL
Sbjct  1    MTSIIKLQPFSGAHNESPPCYMLQVDEFRFLLDCGWDEDFSMEFIKEIKRHAHQIDAILL  60

Query  630  S  632
            +
Sbjct  61   T  61



>ref|XP_009061636.1| hypothetical protein LOTGIDRAFT_219936 [Lottia gigantea]
 gb|ESO87744.1| hypothetical protein LOTGIDRAFT_219936 [Lottia gigantea]
Length=335

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++    G  +E+P  YL+ VD F FL+DCGWN++FD S+L+ L R    +DAVLL
Sbjct  1    MTSIIKLHVFSGANDESPPCYLLQVDEFRFLLDCGWNENFDMSMLKELKRHIHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EFA82503.1| beta-lactamase domain-containing protein [Polysphondylium pallidum 
PN500]
Length=738

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNE-NPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            M + ++  PL G  NE +P  YL+ +D F  L+DCGWN   D S+L+PL  VA+ +DA+L
Sbjct  1    MTSIIKFTPLSGGANEISPPCYLLEIDEFTILLDCGWNHSLDLSILEPLKAVANKIDAIL  60

Query  627  LS  632
            LS
Sbjct  61   LS  62



>ref|XP_005786054.1| hypothetical protein EMIHUDRAFT_229332 [Emiliania huxleyi CCMP1516]
 gb|EOD33625.1| hypothetical protein EMIHUDRAFT_229332 [Emiliania huxleyi CCMP1516]
Length=216

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  444  TAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAV  623
            T + TSV   PL G       S L+ VDG   L+DCGW   FD S+L+PL  VA+ VDAV
Sbjct  13   TTVRTSVHFTPLRGSSGGAAPSGLLEVDGLTLLLDCGWEPPFDVSVLEPLRGVAARVDAV  72

Query  624  LLS  632
            LLS
Sbjct  73   LLS  75



>dbj|GAM28904.1| hypothetical protein SAMD00019534_120800, partial [Acytostelium 
subglobosum LB1]
Length=737

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNEN-PLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            M + ++  PL G  NE+ P  YL+ +D F  L+DCGWN   D SLL+PL +VA  ++A+L
Sbjct  9    MTSIIKFTPLSGGANEDAPPCYLLEIDDFVILLDCGWNHSLDISLLEPLKKVAHRINAIL  68

Query  627  LS  632
            LS
Sbjct  69   LS  70



>ref|XP_001638458.1| predicted protein [Nematostella vectensis]
 gb|EDO46395.1| predicted protein [Nematostella vectensis]
Length=737

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L G ++E PL YL+ VD F FL+DCGWN+  D  +++ + R    VDAVL+
Sbjct  1    MTSIIKLNVLSGAHDEAPLCYLLQVDEFRFLLDCGWNETLDMEIMESIKRHVQQVDAVLV  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CCA21717.1| cleavage and polyadenylation specificity factor subunit putative 
[Albugo laibachii Nc14]
 emb|CCA21858.1| cleavage and polyadenylation specificity factor subunit putative 
[Albugo laibachii Nc14]
Length=731

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  462  VQVKPLCGVYNENPL-SYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            +   PL GVY+ +P  +YL+ +D    L+DCGW D +DT LL+PL +VA  +D VL+S
Sbjct  4    ITFTPLYGVYSRDPCCAYLLEIDEVCILLDCGWTDQYDTELLKPLQKVADRIDLVLIS  61



>ref|XP_005104475.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Aplysia californica]
Length=410

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L G  +E+P  YL+ VD F FL+DCGW++ F    +Q L RV+  VDAVLL
Sbjct  1    MTSIIKLHALSGARDESPPCYLLQVDEFRFLLDCGWDEDFSMDFVQDLRRVSHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CEI98391.1| hypothetical protein RMCBS344292_12500 [Rhizopus microsporus]
Length=598

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D FD   L  L +++  +DAVLL
Sbjct  1    MTSYIKFTPISGSKNEDPLCYLLEIDEVKILLDCGWSDSFDIDSLSNLKKISKQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010214037.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tinamus guttatus]
 gb|KGL77996.1| Cleavage and polyadenylation specificity factor subunit 2 [Tinamus 
guttatus]
Length=782

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  LCGV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLCGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005780234.1| hypothetical protein EMIHUDRAFT_463197 [Emiliania huxleyi CCMP1516]
 gb|EOD27805.1| hypothetical protein EMIHUDRAFT_463197 [Emiliania huxleyi CCMP1516]
Length=547

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +3

Query  444  TAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAV  623
            T + TSV   PL G       S L+ VDG   L+DCGW   FD S+L+PL  VA+ VDAV
Sbjct  13   TTVRTSVHFTPLRGSSGGAAPSGLLEVDGLTLLLDCGWEPPFDVSVLEPLRGVAARVDAV  72

Query  624  LLS  632
            LLS
Sbjct  73   LLS  75



>ref|XP_780045.3| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform 1 [Strongylocentrotus purpuratus]
Length=773

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++ P  GV +E+P  Y++ VD F FL+DCGW++HF    ++ L +    VDAVLL
Sbjct  1    MTSIIKLTPFSGVLDESPPCYMLQVDEFRFLLDCGWDEHFTMENIEGLKKHIHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004682096.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Condylura cristata]
Length=746

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   +L  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDILDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001415490.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93782.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=715

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  504  LSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            + Y VS+DG N L+DCGWND FD  +L+PL+ +A  VDAVL+S
Sbjct  1    MCYHVSIDGCNILLDCGWNDKFDVDMLKPLAAIAPKVDAVLIS  43



>gb|ELU12868.1| hypothetical protein CAPTEDRAFT_155355 [Capitella teleta]
Length=728

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++P  GV  E+P  Y++ VD F+FL+DCGW++ FD   ++ L +    +DAVLL
Sbjct  1    MTSIIKLQPFSGVDGESPPCYMLQVDEFHFLLDCGWDEEFDPVFMENLKKHLPQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KFD52003.1| hypothetical protein M513_07135 [Trichuris suis]
 gb|KFD71382.1| hypothetical protein M514_07135 [Trichuris suis]
Length=768

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V+++PL GV +E PL Y++ VD F+FL+DCGW+  FD   +  L      +DAVLL
Sbjct  1    MTSIVKLEPLSGVMDETPLCYVLQVDDFHFLLDCGWDSLFDMQYIDRLRVWVPHIDAVLL  60

Query  630  S  632
            +
Sbjct  61   T  61



>gb|KHJ48938.1| cleavage and polyadenylation specificity factor subunit 2 family 
protein [Trichuris suis]
Length=771

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V+++PL GV +E PL Y++ VD F+FL+DCGW+  FD   +  L      +DAVLL
Sbjct  1    MTSIVKLEPLSGVMDETPLCYVLQVDDFHFLLDCGWDSLFDMQYIDRLRVWVPHIDAVLL  60

Query  630  S  632
            +
Sbjct  61   T  61



>ref|XP_001507374.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ornithorhynchus anatinus]
 ref|XP_007658721.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ornithorhynchus anatinus]
 ref|XP_007658722.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ornithorhynchus anatinus]
Length=782

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLKKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDJ83222.1| unnamed protein product [Haemonchus contortus]
Length=871

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +3

Query  447  AMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            AM + V+++PL GV +E PL YL+ ++    L+DCGW+D FD + ++ +   AS + AVL
Sbjct  18   AMSSVVKLEPLSGVKDEGPLCYLLQIEETYLLLDCGWDDKFDMAYIESIKSRASQISAVL  77

Query  627  LS  632
            ++
Sbjct  78   IT  79



>dbj|BAC35756.1| unnamed protein product [Mus musculus]
Length=296

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003756188.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Sarcophilus harrisii]
Length=782

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001365312.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Monodelphis domestica]
 ref|XP_007472622.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Monodelphis domestica]
Length=782

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EPB87138.1| hypothetical protein HMPREF1544_06064 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=741

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D F    L  L +VA  +DAV+L
Sbjct  1    MTSYIKFTPISGAKNEDPLCYLLEIDEVKILLDCGWSDSFKEEDLANLKKVAKQIDAVVL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006839628.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Chrysochloris asiatica]
Length=782

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_058552.1| cleavage and polyadenylation specificity factor subunit 2 [Mus 
musculus]
 ref|XP_006516134.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Mus musculus]
 sp|O35218.1|CPSF2_MOUSE RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Mus 
musculus]
 gb|AAB66830.1| cleavage and polyadenylation specificity factor [Mus musculus]
 gb|AAH13628.1| Cleavage and polyadenylation specific factor 2 [Mus musculus]
 gb|EDL18871.1| cleavage and polyadenylation specific factor 2 [Mus musculus]
Length=782

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_001100223.1| cleavage and polyadenylation specificity factor subunit 2 [Rattus 
norvegicus]
 gb|EDL81741.1| cleavage and polyadenylation specific factor 2 (predicted) [Rattus 
norvegicus]
Length=782

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002129804.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ciona intestinalis]
Length=784

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  PL G  NE P  YL+ VD F FL+DCGW++ FD  ++  + +  S VDA+LL
Sbjct  1    MTSIIKFTPLAGALNEGPNCYLLQVDEFTFLLDCGWSEDFDMDVINNVMKHISQVDAMLL  60

Query  630  S  632
            +
Sbjct  61   T  61



>ref|XP_007529124.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Erinaceus europaeus]
Length=782

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDVIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004352034.1| beta-lactamase domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG15314.1| beta-lactamase domain-containing protein [Dictyostelium fasciculatum]
Length=768

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNE-NPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVL  626
            M + ++  PLCG   +  P  YL+ +D F  L+DCGWN   D SLL  L +VA+ VDA+L
Sbjct  1    MTSVIKFTPLCGGAGQITPPCYLLEIDNFCILLDCGWNAKLDISLLDELKKVANKVDAIL  60

Query  627  LS  632
            L+
Sbjct  61   LT  62



>ref|XP_006879175.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Elephantulus edwardii]
Length=782

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVREESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>dbj|BAG50992.1| unnamed protein product [Homo sapiens]
Length=644

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EAW81483.1| cleavage and polyadenylation specific factor 2, 100kDa, isoform 
CRA_c [Homo sapiens]
Length=690

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|ELK36959.1| Cleavage and polyadenylation specificity factor subunit 2 [Myotis 
davidii]
Length=687

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005871272.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Myotis brandtii]
 ref|XP_006103164.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Myotis lucifugus]
Length=715

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|ELW55806.1| Cleavage and polyadenylation specificity factor subunit 2 [Tupaia 
chinensis]
Length=723

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008576222.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Galeopterus variegatus]
Length=748

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  56   MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  115

Query  630  S  632
            S
Sbjct  116  S  116



>ref|XP_003787126.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Otolemur garnettii]
Length=750

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_011371484.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Pteropus vampyrus]
Length=751

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010834498.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Bison bison bison]
 ref|XP_010834499.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Bison bison bison]
 ref|XP_010834500.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Bison bison bison]
 ref|XP_010834501.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Bison bison bison]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010614631.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Fukomys damarensis]
 gb|KFO18284.1| Cleavage and polyadenylation specificity factor subunit 2 [Fukomys 
damarensis]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008819946.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nannospalax galili]
 ref|XP_008819947.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nannospalax galili]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008146656.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Eptesicus fuscus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008071140.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tarsius syrichta]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007942690.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Orycteropus afer afer]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002754257.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Callithrix jacchus]
 ref|XP_003939897.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Saimiri boliviensis boliviensis]
 ref|XP_009004711.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Callithrix jacchus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002719640.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Oryctolagus cuniculus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_537353.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform 1 [Canis lupus familiaris]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|AAH70095.1| Cleavage and polyadenylation specific factor 2, 100kDa [Homo 
sapiens]
 gb|AIC56518.1| CPSF2, partial [synthetic construct]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007184326.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007184327.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007184328.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Balaenoptera acutorostrata scammoni]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006990947.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Peromyscus maniculatus bairdii]
 ref|XP_006990948.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Peromyscus maniculatus bairdii]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003987977.2| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Felis catus]
 ref|XP_006933129.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Felis catus]
 ref|XP_007095006.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Panthera tigris altaica]
 ref|XP_007095007.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Panthera tigris altaica]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_787002.1| cleavage and polyadenylation specificity factor subunit 2 [Bos 
taurus]
 ref|XP_004018003.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ovis aries]
 ref|XP_005222184.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Bos taurus]
 ref|XP_005695386.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Capra hircus]
 ref|XP_005695387.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Capra hircus]
 ref|XP_005695388.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Capra hircus]
 ref|XP_005910321.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Bos mutus]
 ref|XP_005957307.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Pantholops hodgsonii]
 ref|XP_005957308.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Pantholops hodgsonii]
 ref|XP_006071304.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Bubalus bubalis]
 ref|XP_006071305.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Bubalus bubalis]
 ref|XP_006071306.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X4 [Bubalus bubalis]
 ref|XP_006071307.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X5 [Bubalus bubalis]
 ref|XP_006071308.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X6 [Bubalus bubalis]
 ref|XP_006071309.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X7 [Bubalus bubalis]
 ref|XP_006071310.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X8 [Bubalus bubalis]
 sp|Q10568.1|CPSF2_BOVIN RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Bos 
taurus]
 emb|CAA53535.1| Cleavage and Polyadenylation specificity factor (CPSF) 100kD 
subunit [Bos taurus]
 tpg|DAA17284.1| TPA: cleavage and polyadenylation specificity factor subunit 
2 [Bos taurus]
 gb|ELR45701.1| Cleavage and polyadenylation specificity factor subunit 2 [Bos 
mutus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006155869.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tupaia chinensis]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005871273.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Myotis brandtii]
 ref|XP_006103162.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Myotis lucifugus]
 ref|XP_006103163.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Myotis lucifugus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005390370.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Chinchilla lanigera]
 ref|XP_005390371.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Chinchilla lanigera]
 ref|XP_005390372.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Chinchilla lanigera]
 ref|XP_005390373.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X4 [Chinchilla lanigera]
 ref|XP_005390374.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X5 [Chinchilla lanigera]
 ref|XP_005390375.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X6 [Chinchilla lanigera]
 ref|XP_005390376.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X7 [Chinchilla lanigera]
 ref|XP_005390377.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X8 [Chinchilla lanigera]
 ref|XP_005390378.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X9 [Chinchilla lanigera]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005339196.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ictidomys tridecemlineatus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005343528.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Microtus ochrogaster]
 ref|XP_005343529.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Microtus ochrogaster]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005068449.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Mesocricetus auratus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004739092.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Mustela putorius furo]
 ref|XP_004739093.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Mustela putorius furo]
 ref|XP_004739094.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Mustela putorius furo]
 ref|XP_004797191.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Mustela putorius furo]
 ref|XP_004797192.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Mustela putorius furo]
 ref|XP_004797193.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Mustela putorius furo]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004649386.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Jaculus jaculus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004584390.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ochotona princeps]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004475461.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform 1 [Dasypus novemcinctus]
 ref|XP_004475462.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform 2 [Dasypus novemcinctus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004376734.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Trichechus manatus latirostris]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004262395.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Orcinus orca]
 ref|XP_004311573.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tursiops truncatus]
 ref|XP_007105098.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Physeter catodon]
 ref|XP_007454777.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Lipotes vexillifer]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006925597.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Pteropus alecto]
 ref|XP_006925598.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Pteropus alecto]
 gb|ELK01144.1| Cleavage and polyadenylation specificity factor subunit 2 [Pteropus 
alecto]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_059133.1| cleavage and polyadenylation specificity factor subunit 2 [Homo 
sapiens]
 ref|XP_001147277.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Pan troglodytes]
 ref|XP_003832826.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Pan paniscus]
 ref|XP_005267824.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Homo sapiens]
 sp|Q9P2I0.2|CPSF2_HUMAN RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Homo 
sapiens]
 gb|EAW81480.1| cleavage and polyadenylation specific factor 2, 100kDa, isoform 
CRA_a [Homo sapiens]
 gb|EAW81482.1| cleavage and polyadenylation specific factor 2, 100kDa, isoform 
CRA_a [Homo sapiens]
 dbj|BAG50953.1| unnamed protein product [Homo sapiens]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007633787.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Cricetulus griseus]
 gb|ERE73422.1| cleavage and polyadenylation specificity factor subunit 2 [Cricetulus 
griseus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004883985.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Heterocephalus glaber]
 ref|XP_004837079.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Heterocephalus glaber]
 gb|EHB02479.1| Cleavage and polyadenylation specificity factor subunit 2 [Heterocephalus 
glaber]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003462702.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Cavia porcellus]
 ref|XP_004394542.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Odobenus rosmarus divergens]
 ref|XP_004434268.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ceratotherium simum simum]
 ref|XP_006184253.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Camelus ferus]
 ref|XP_006208274.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Vicugna pacos]
 ref|XP_006741424.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Leptonychotes weddellii]
 ref|XP_008696711.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Ursus maritimus]
 ref|XP_010967009.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Camelus bactrianus]
 ref|XP_010986402.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Camelus dromedarius]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003408878.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Loxodonta africana]
 ref|XP_010587114.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Loxodonta africana]
 ref|XP_010587115.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Loxodonta africana]
 ref|XP_010587116.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Loxodonta africana]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003260944.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform 1 [Nomascus leucogenys]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001497134.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoformX1 [Equus caballus]
 ref|XP_005605466.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Equus caballus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_001244509.1| cleavage and polyadenylation specificity factor subunit 2 [Macaca 
mulatta]
 ref|XP_003902228.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Papio anubis]
 ref|XP_005562103.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Macaca fascicularis]
 ref|XP_005562104.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Macaca fascicularis]
 ref|XP_005562105.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Macaca fascicularis]
 ref|XP_005562106.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X4 [Macaca fascicularis]
 ref|XP_007985819.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Chlorocebus sabaeus]
 ref|XP_010382796.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Rhinopithecus roxellana]
 ref|XP_010382797.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Rhinopithecus roxellana]
 ref|XP_010382798.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Rhinopithecus roxellana]
 gb|EHH28117.1| hypothetical protein EGK_18472 [Macaca mulatta]
 gb|EHH63837.1| hypothetical protein EGM_16889 [Macaca fascicularis]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008555336.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Microplitis demolitor]
Length=739

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V++  + G  NE+P  YL+ +D    L+DCGWN+ FD S ++ L R    +DAVLL
Sbjct  1    MTSIVKLHAISGAMNESPPCYLLEIDEVKILLDCGWNEQFDESFIRELKRHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010614630.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Fukomys damarensis]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006754770.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2 [Myotis davidii]
Length=792

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007647923.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Cricetulus griseus]
Length=799

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  18   MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  77

Query  630  S  632
            S
Sbjct  78   S  78



>ref|XP_008696719.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Ursus maritimus]
Length=715

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006071303.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Bubalus bubalis]
Length=805

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  24   MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  83

Query  630  S  632
            S
Sbjct  84   S  84



>dbj|BAE24650.1| unnamed protein product [Mus musculus]
Length=396

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_002115881.1| hypothetical protein TRIADDRAFT_30006 [Trichoplax adhaerens]
 gb|EDV21733.1| hypothetical protein TRIADDRAFT_30006 [Trichoplax adhaerens]
Length=745

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L G  +E P  YL+ VD FNFL+DCGW+++FD  +++ + R    +DAVLL
Sbjct  1    MTSIIRMTVLSGGQDEGPPCYLLQVDEFNFLLDCGWDENFDMEMMERVKRHIHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>dbj|BAE28111.1| unnamed protein product [Mus musculus]
Length=412

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KFP48087.1| Cleavage and polyadenylation specificity factor subunit 2, partial 
[Cathartes aura]
Length=140

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004698821.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Echinops telfairi]
Length=779

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSLDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004635218.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Octodon degus]
Length=782

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSLDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CEP08367.1| hypothetical protein [Parasitella parasitica]
Length=755

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D F    L  L +VA  +DAV+L
Sbjct  1    MTSYIKFTPISGAKNEDPLCYLLEIDEVKILLDCGWSDSFKEEDLVNLKKVAKQIDAVVL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006792670.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Neolamprologus brichardi]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F T ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVLEESALCYLLQVDEFRFLLDCGWDENFSTEIIDAMKRHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005935473.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Haplochromis burtoni]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F T ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVLEESALCYLLQVDEFRFLLDCGWDENFSTEIIDAMKRHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005731184.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Pundamilia nyererei]
 ref|XP_005731185.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Pundamilia nyererei]
 ref|XP_005731186.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X3 [Pundamilia nyererei]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F T ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVLEESALCYLLQVDEFRFLLDCGWDENFSTEIIDAMKRHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004550521.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Maylandia zebra]
 ref|XP_004550522.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Maylandia zebra]
Length=787

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F T ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVLEESALCYLLQVDEFRFLLDCGWDENFSTEIIDAMKRHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008528425.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2 [Equus przewalskii]
Length=381

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>dbj|BAE24504.1| unnamed protein product [Mus musculus]
Length=493

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSVDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_011235205.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Ailuropoda melanoleuca]
Length=385

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EMT31904.1| hypothetical protein F775_28078 [Aegilops tauschii]
Length=748

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MGT+VQV PL G Y E PL YL++VDGF FL+              P  RVA T+DAVLL
Sbjct  1    MGTAVQVMPLSGAYGEGPLCYLLAVDGFRFLLAAAGPTTATPPSSTPSPRVAPTIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008555333.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Microplitis demolitor]
Length=738

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + G  NE+P  YL+ +D    L+DCGWN+ FD S ++ L R    +DAVLL
Sbjct  1    MTSIIKLHAISGAMNESPPCYLLEIDEVKILLDCGWNEQFDESFIRELKRHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CAG03552.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=206

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>dbj|GAN08051.1| cleavage and polyadenylation specificity factor subunit 2 isoform 
X2 [Mucor ambiguus]
Length=783

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++  P+ G  NE+PL YL+ +D    L+DCGW+D F    L  L +VA  +DAV+L
Sbjct  1    MTSYIKFTPISGAKNEDPLCYLLEIDEAKILLDCGWSDSFREEDLANLKKVAKQIDAVVL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004610319.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Sorex araneus]
Length=782

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L G+  E+ L YL+ VD F FL+DCGW++HF   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGLQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007545403.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Poecilia formosa]
Length=841

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = +3

Query  423  QLKAKRITAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRV  602
            ++   R   M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R 
Sbjct  46   EMHKNRKGKMTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRY  105

Query  603  ASTVDAVLLS  632
               VDAVLLS
Sbjct  106  VHQVDAVLLS  115



>ref|XP_001951701.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Acyrthosiphon pisum]
Length=729

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++   L G +NE+P  YL+ +D F FL+DCGW++ F   ++  L R    +DAVLL
Sbjct  1    MTSIIKFYTLSGAHNESPPCYLLQIDEFKFLLDCGWDERFSMGVVNKLKRYIHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_001002384.1| cleavage and polyadenylation specificity factor subunit 2 [Danio 
rerio]
 gb|AAH76029.1| Cleavage and polyadenylation specific factor 2 [Danio rerio]
Length=790

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++ F   ++  L R    VDAVLL
Sbjct  1    MTSIIKLTALSGVQEESALCYLLQVDEFRFLLDCGWDETFSMDIIDSLKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008193780.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Tribolium castaneum]
 gb|EFA07272.1| hypothetical protein TcasGA2_TC014506 [Tribolium castaneum]
Length=733

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L G  +E+P  Y++ VD    L+DCGW++HFD  +++ + R   T+DAVL+
Sbjct  1    MTSIIKLQALSGAMDESPPCYILQVDEVRILLDCGWDEHFDMEIIKEMRRHVHTIDAVLI  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CDJ87806.1| Beta-lactamase and RNA-metabolising metallo-beta-lactamase domain 
containing protein [Haemonchus contortus]
Length=1014

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V+++PL GV +E PL YL+ ++    L+DCGW+D FD + ++ +   AS + AVL+
Sbjct  162  MSSVVKLEPLSGVKDEGPLCYLLQIEETYLLLDCGWDDKFDMAYIESIKSRASQISAVLI  221

Query  630  S  632
            +
Sbjct  222  T  222



>emb|CDW57805.1| cleavage and polyadenylation [Trichuris trichiura]
Length=787

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + V+++PL GV +E PL Y++ VD F+FL+DCGW+  F+   +  L      +DAVLL
Sbjct  1    MTSIVKLEPLSGVMDETPLCYVLQVDDFHFLLDCGWDSLFNMQYIDRLRVWVPHIDAVLL  60

Query  630  S  632
            +
Sbjct  61   T  61



>ref|XP_005285488.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Chrysemys picta bellii]
Length=795

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  444  TAMGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAV  623
            + M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAV
Sbjct  11   SKMTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKYVHQVDAV  70

Query  624  LLS  632
            LLS
Sbjct  71   LLS  73



>gb|EHJ67102.1| putative cleavage and polyadenylation specificity factor 100 
kDa subunit [Danaus plexippus]
Length=818

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++   L G  +E+P  Y++ VD F FL+DCGW++ FD   ++ L R  +++DAVLL
Sbjct  1    MTSIIKFHCLSGAGDESPPCYVLQVDEFKFLLDCGWDEKFDMDFIKELKRHVNSIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EGW09725.1| Sodium/potassium/calcium exchanger 4 [Cricetulus griseus]
Length=1206

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW++HF   ++  L +    +DAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_004083472.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Oryzias latipes]
Length=787

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F  L+DCGW++HF   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRILLDCGWDEHFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007055525.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Chelonia mydas]
Length=771

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006133719.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Pelodiscus sinensis]
 ref|XP_006133720.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Pelodiscus sinensis]
 ref|XP_006133721.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Pelodiscus sinensis]
Length=783

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005285489.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Chrysemys picta bellii]
Length=783

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_646760.1| beta-lactamase domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q55BS1.1|CPSF2_DICDI RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Dictyostelium 
discoideum]
 gb|EAL72546.1| beta-lactamase domain-containing protein [Dictyostelium discoideum 
AX4]
Length=784

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++   L G  +E+P  YL+ +D F  L+DCG + + D SLL+PL +VA  +DAVLL
Sbjct  1    MASIIKFTALSGAKDESPPCYLLEIDDFCILLDCGLSYNLDFSLLEPLEKVAKKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>emb|CCI40993.1| unnamed protein product [Albugo candida]
Length=970

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +3

Query  462  VQVKPLCGVYNENPL-SYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            +   PL GV + +P  +YL+ +D    L+DCGW D +DT LL+PL +VA  +D VL+S
Sbjct  4    ITFTPLYGVCSRDPCCAYLLEIDEVCILLDCGWTDQYDTELLKPLQKVADRIDLVLIS  61



>emb|CAG03550.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=765

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001949295.2| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Acyrthosiphon pisum]
Length=724

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++   L G +NE+P  YL+ +D F FL+DCGW++ F   ++  L R    +DAVLL
Sbjct  1    MTSIIKFYTLSGAHNESPPCYLLQIDEFKFLLDCGWDELFSMGVVNKLKRYIHQIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010744029.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Larimichthys crocea]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008395681.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Poecilia reticulata]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_008282497.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Stegastes partitus]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_007545411.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Poecilia formosa]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005803161.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Xiphophorus maculatus]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003971833.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Takifugu rubripes]
Length=787

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAVSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRYVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003289932.1| hypothetical protein DICPUDRAFT_80682 [Dictyostelium purpureum]
 gb|EGC33550.1| hypothetical protein DICPUDRAFT_80682 [Dictyostelium purpureum]
Length=752

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            MG+ V+   L G  NE P  YL+ +D F  L+DCG +   D SLL+PL + A  +DAVLL
Sbjct  1    MGSIVKFTALSGGDNEKPPCYLLEIDDFCILLDCGLSYDLDFSLLEPLKKYADKIDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010014719.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nestor notabilis]
 gb|KFQ51312.1| Cleavage and polyadenylation specificity factor subunit 2 [Nestor 
notabilis]
Length=782

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLKKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_005149568.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Melopsittacus undulatus]
Length=782

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLKKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003206716.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Meleagris gallopavo]
Length=782

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLKKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|NP_001026379.1| cleavage and polyadenylation specificity factor subunit 2 [Gallus 
gallus]
 emb|CAH65295.1| hypothetical protein RCJMB04_15m16 [Gallus gallus]
Length=782

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLKKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EJD75913.1| cleavage and polyadenylation specificity factor subunit 2, variant 
[Loa loa]
Length=664

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L GV ++ PL YL+ VD   FL+DCGW++ FD + ++ + R    ++AVLL
Sbjct  1    MTSIIKLEALSGVQDDGPLCYLLQVDQVYFLLDCGWDERFDMAYIEAVKRRVPLINAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EJW84982.1| cleavage and polyadenylation specificity factor subunit 2 [Wuchereria 
bancrofti]
Length=809

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L GV ++ PL YL+ VD   FL+DCGW++ FD + ++ + R    ++AVLL
Sbjct  1    MTSIIKLEALSGVQDDGPLCYLLQVDQVYFLLDCGWDERFDMAYIEAVKRRVPLINAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|EFO19846.2| cleavage and polyadenylation specificity factor subunit 2 [Loa 
loa]
Length=828

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L GV ++ PL YL+ VD   FL+DCGW++ FD + ++ + R    ++AVLL
Sbjct  1    MTSIIKLEALSGVQDDGPLCYLLQVDQVYFLLDCGWDERFDMAYIEAVKRRVPLINAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001895540.1| cleavage and polyadenylation specificity factor [Brugia malayi]
 emb|CDQ03156.1| Protein BM-CPSF-2 [Brugia malayi]
Length=831

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L GV ++ PL YL+ VD   FL+DCGW++ FD + ++ + R    ++AVLL
Sbjct  1    MTSIIKLEALSGVQDDGPLCYLLQVDQVYFLLDCGWDERFDMAYIEAVKRRVPLINAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_003144223.1| cleavage and polyadenylation specificity factor subunit 2 [Loa 
loa]
Length=837

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + ++++ L GV ++ PL YL+ VD   FL+DCGW++ FD + ++ + R    ++AVLL
Sbjct  1    MTSIIKLEALSGVQDDGPLCYLLQVDQVYFLLDCGWDERFDMAYIEAVKRRVPLINAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_001321376.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY09153.1| hypothetical protein TVAG_363680 [Trichomonas vaginalis G3]
Length=700

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  456  TSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLLS  632
            TS+  +PL G  +  P +YL+ VD F FL+DCGW + F    +Q    + S V+AVLLS
Sbjct  6    TSISFQPLSGAQSTTPFAYLLHVDEFTFLLDCGWTEDFRLEDIQTQIEICSHVNAVLLS  64



>gb|KFP78636.1| Cleavage and polyadenylation specificity factor subunit 2, partial 
[Apaloderma vittatum]
Length=708

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009873251.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Apaloderma vittatum]
Length=710

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_006632745.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Lepisosteus oculatus]
Length=788

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  + GV  E+ L YL+ VD F FL+DCGW+++F   ++  + R    VDAVLL
Sbjct  1    MTSIIKLTAISGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDAMKRHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010071317.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2, partial [Pterocles gutturalis]
 gb|KFU97714.1| Cleavage and polyadenylation specificity factor subunit 2, partial 
[Pterocles gutturalis]
Length=752

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009688070.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Struthio camelus australis]
Length=756

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>gb|KFW90886.1| Cleavage and polyadenylation specificity factor subunit 2 [Phalacrocorax 
carbo]
Length=765

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009502755.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Phalacrocorax carbo]
Length=778

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009893658.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Charadrius vociferus]
 gb|KGL86049.1| Cleavage and polyadenylation specificity factor subunit 2 [Charadrius 
vociferus]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010165764.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Caprimulgus carolinensis]
 gb|KFZ57698.1| Cleavage and polyadenylation specificity factor subunit 2 [Caprimulgus 
carolinensis]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009584324.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Fulmarus glacialis]
 gb|KFW12378.1| Cleavage and polyadenylation specificity factor subunit 2 [Fulmarus 
glacialis]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009688069.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Struthio camelus australis]
 gb|KFV74874.1| Cleavage and polyadenylation specificity factor subunit 2 [Struthio 
camelus australis]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009967915.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tyto alba]
 gb|KFV54913.1| Cleavage and polyadenylation specificity factor subunit 2 [Tyto 
alba]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009981300.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Tauraco erythrolophus]
 gb|KFV01045.1| Cleavage and polyadenylation specificity factor subunit 2 [Tauraco 
erythrolophus]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010002024.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Chaetura pelagica]
 gb|KFU94231.1| Cleavage and polyadenylation specificity factor subunit 2 [Chaetura 
pelagica]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009935105.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Opisthocomus hoazin]
 gb|KFR12501.1| Cleavage and polyadenylation specificity factor subunit 2 [Opisthocomus 
hoazin]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010184704.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Mesitornis unicolor]
 gb|KFQ23510.1| Cleavage and polyadenylation specificity factor subunit 2 [Mesitornis 
unicolor]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009951887.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Leptosomus discolor]
 gb|KFQ13103.1| Cleavage and polyadenylation specificity factor subunit 2 [Leptosomus 
discolor]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009481667.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Pelecanus crispus]
 ref|XP_009474165.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nipponia nippon]
 ref|XP_009805676.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Gavia stellata]
 gb|KFP97663.1| Cleavage and polyadenylation specificity factor subunit 2 [Haliaeetus 
albicilla]
 gb|KFQ61512.1| Cleavage and polyadenylation specificity factor subunit 2 [Pelecanus 
crispus]
 gb|KFQ92135.1| Cleavage and polyadenylation specificity factor subunit 2 [Nipponia 
nippon]
 gb|KFV50016.1| Cleavage and polyadenylation specificity factor subunit 2 [Gavia 
stellata]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009076241.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Acanthisitta chloris]
 gb|KFP83502.1| Cleavage and polyadenylation specificity factor subunit 2 [Acanthisitta 
chloris]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_009694023.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Cariama cristata]
 gb|KFP62835.1| Cleavage and polyadenylation specificity factor subunit 2 [Cariama 
cristata]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010118956.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Chlamydotis macqueenii]
 gb|KFP42066.1| Cleavage and polyadenylation specificity factor subunit 2 [Chlamydotis 
macqueenii]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



>ref|XP_010207574.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Colius striatus]
 gb|KFP28295.1| Cleavage and polyadenylation specificity factor subunit 2 [Colius 
striatus]
Length=782

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  450  MGTSVQVKPLCGVYNENPLSYLVSVDGFNFLIDCGWNDHFDTSLLQPLSRVASTVDAVLL  629
            M + +++  L GV  E+ L YL+ VD F FL+DCGW+++F   ++  L +    VDAVLL
Sbjct  1    MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDENFSMDIIDSLRKHVHQVDAVLL  60

Query  630  S  632
            S
Sbjct  61   S  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500