BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF030A14

Length=657
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004250110.1|  PREDICTED: ras-related protein Rab11D              326   1e-109   
ref|XP_009798472.1|  PREDICTED: ras-related protein Rab11D-like         325   2e-109   Nicotiana sylvestris
ref|XP_009620681.1|  PREDICTED: ras-related protein Rab11D-like         324   8e-109   Nicotiana tomentosiformis
ref|XP_006353216.1|  PREDICTED: ras-related protein Rab11D-like         322   3e-108   Solanum tuberosum [potatoes]
emb|CDP01498.1|  unnamed protein product                                319   7e-107   Coffea canephora [robusta coffee]
ref|XP_011100043.1|  PREDICTED: ras-related protein Rab11D              318   9e-107   Sesamum indicum [beniseed]
emb|CBI33135.3|  unnamed protein product                                317   9e-107   Vitis vinifera
ref|XP_008440577.1|  PREDICTED: ras-related protein Rab11A              318   1e-106   
ref|XP_004143457.1|  PREDICTED: ras-related protein Rab11A-like         318   2e-106   Cucumis sativus [cucumbers]
ref|XP_002273530.1|  PREDICTED: ras-related protein Rab11D              318   2e-106   Vitis vinifera
ref|XP_011022819.1|  PREDICTED: ras-related protein Rab11D              317   3e-106   Populus euphratica
ref|XP_002310552.1|  GTP-BINDING protein 3                              317   3e-106   Populus trichocarpa [western balsam poplar]
gb|KDP29718.1|  hypothetical protein JCGZ_18653                         317   3e-106   Jatropha curcas
ref|XP_007047879.1|  RAB GTPase A4A                                     317   4e-106   
ref|XP_009591756.1|  PREDICTED: ras-related protein Rab11D              317   4e-106   Nicotiana tomentosiformis
ref|XP_009802845.1|  PREDICTED: ras-related protein Rab11D              317   4e-106   Nicotiana sylvestris
gb|KHN44351.1|  Ras-related protein Rab11A                              317   5e-106   Glycine soja [wild soybean]
ref|XP_008235004.1|  PREDICTED: ras-related protein Rab11A              317   6e-106   Prunus mume [ume]
gb|KHG10894.1|  Ras-related protein Rab11A                              317   7e-106   Gossypium arboreum [tree cotton]
gb|KJB44099.1|  hypothetical protein B456_007G234300                    316   8e-106   Gossypium raimondii
ref|XP_007205846.1|  hypothetical protein PRUPE_ppa011070mg             316   8e-106   Prunus persica
gb|KJB44100.1|  hypothetical protein B456_007G234300                    317   8e-106   Gossypium raimondii
gb|KHG10895.1|  Ras-related protein Rab11A                              317   1e-105   Gossypium arboreum [tree cotton]
sp|Q40522.1|RB11D_TOBAC  RecName: Full=Ras-related protein Rab11D       316   1e-105   Nicotiana tabacum [American tobacco]
gb|EPS65006.1|  hypothetical protein M569_09770                         316   2e-105   Genlisea aurea
ref|XP_002307071.1|  GTP-BINDING protein 3                              315   2e-105   
ref|NP_001237375.1|  uncharacterized protein LOC100527786               315   3e-105   
ref|XP_006426348.1|  hypothetical protein CICLE_v10026427mg             315   3e-105   Citrus clementina [clementine]
ref|XP_002531672.1|  protein with unknown function                      314   5e-105   Ricinus communis
sp|Q40520.1|RB11C_TOBAC  RecName: Full=Ras-related protein Rab11C       314   6e-105   Nicotiana tabacum [American tobacco]
ref|XP_004502410.1|  PREDICTED: ras-related protein Rab11A-like         314   7e-105   Cicer arietinum [garbanzo]
ref|XP_010027921.1|  PREDICTED: ras-related protein Rab11A              313   1e-104   Eucalyptus grandis [rose gum]
ref|XP_007163663.1|  hypothetical protein PHAVU_001G253300g             313   1e-104   Phaseolus vulgaris [French bean]
gb|AFK49375.1|  unknown                                                 313   2e-104   Medicago truncatula
gb|KEH20797.1|  RAB GTPase-like protein A1D                             312   3e-104   Medicago truncatula
ref|XP_006346741.1|  PREDICTED: ras-related protein Rab11D-like         312   3e-104   Solanum tuberosum [potatoes]
gb|KJB40355.1|  hypothetical protein B456_007G060000                    311   6e-104   Gossypium raimondii
ref|XP_003552040.1|  PREDICTED: ras-related protein Rab11A-like         311   6e-104   Glycine max [soybeans]
ref|XP_006394054.1|  hypothetical protein EUTSA_v10004873mg             311   1e-103   Eutrema salsugineum [saltwater cress]
sp|Q40191.1|RB11A_LOTJA  RecName: Full=Ras-related protein Rab11A...    311   1e-103   Lotus japonicus
ref|XP_006466254.1|  PREDICTED: ras-related protein Rab11A-like         311   1e-103   Citrus sinensis [apfelsine]
ref|XP_010267206.1|  PREDICTED: ras-related protein Rab11A              310   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010319241.1|  PREDICTED: ras-related protein Rab11D-like         310   3e-103   Solanum lycopersicum
gb|ACJ84079.1|  unknown                                                 309   4e-103   Medicago truncatula
dbj|BAA02110.1|  GTP-binding protein                                    309   5e-103   Pisum sativum [garden pea]
ref|XP_011097540.1|  PREDICTED: ras-related protein Rab11D-like         309   5e-103   Sesamum indicum [beniseed]
ref|XP_009344449.1|  PREDICTED: ras-related protein Rab11D              308   2e-102   Pyrus x bretschneideri [bai li]
gb|KFK28209.1|  hypothetical protein AALP_AA8G486600                    307   4e-102   Arabis alpina [alpine rockcress]
ref|XP_008381984.1|  PREDICTED: ras-related protein Rab11D              306   4e-102   
ref|XP_004288173.1|  PREDICTED: ras-related protein Rab11D              306   6e-102   Fragaria vesca subsp. vesca
gb|AAB97114.1|  small GTP-binding protein                               305   2e-101   Glycine max [soybeans]
ref|NP_201330.1|  RAB GTPase homolog A4A                                305   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484385.1|  PREDICTED: ras-related protein RABA4a-like         305   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006281052.1|  hypothetical protein CARUB_v10027070mg             305   3e-101   Capsella rubella
gb|KHG08307.1|  Ras-related Rab11A                                      303   8e-101   Gossypium arboreum [tree cotton]
ref|XP_002864949.1|  hypothetical protein ARALYDRAFT_919858             303   9e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_010106271.1|  Ras-related protein Rab11D                         302   2e-100   Morus notabilis
gb|KJB40356.1|  hypothetical protein B456_007G060000                    302   3e-100   Gossypium raimondii
ref|XP_010523299.1|  PREDICTED: ras-related protein RABA4a-like         302   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_010926325.1|  PREDICTED: ras-related protein Rab11D-like i...    301   7e-100   Elaeis guineensis
ref|XP_010680988.1|  PREDICTED: ras-related protein Rab11D              301   9e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010463230.1|  PREDICTED: ras-related protein RABA4a-like         301   9e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010273010.1|  PREDICTED: ras-related protein Rab11A-like         301   9e-100   Nelumbo nucifera [Indian lotus]
ref|XP_007159716.1|  hypothetical protein PHAVU_002G261400g             300   1e-99    Phaseolus vulgaris [French bean]
ref|XP_003601931.1|  GTP-binding protein                                300   1e-99    Medicago truncatula
ref|XP_010519373.1|  PREDICTED: ras-related protein RABA4a              299   6e-99    Tarenaya hassleriana [spider flower]
ref|XP_006404948.1|  hypothetical protein EUTSA_v10000315mg             298   8e-99    Eutrema salsugineum [saltwater cress]
gb|KHN29041.1|  Ras-related protein Rab11A                              298   1e-98    Glycine soja [wild soybean]
ref|XP_003532818.1|  PREDICTED: ras-related protein Rab11A-like         297   1e-98    
gb|KFK25337.1|  hypothetical protein AALP_AA8G099600                    297   2e-98    Arabis alpina [alpine rockcress]
ref|XP_006827843.1|  hypothetical protein AMTR_s00008p00026380          297   2e-98    Amborella trichopoda
ref|XP_004504100.1|  PREDICTED: ras-related protein Rab11A-like         297   2e-98    Cicer arietinum [garbanzo]
ref|XP_010453062.1|  PREDICTED: ras-related protein RABA4a-like         297   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_003525046.1|  PREDICTED: ras-related protein Rab11A              297   4e-98    
ref|XP_010917311.1|  PREDICTED: ras-related protein Rab11D-like         296   5e-98    Elaeis guineensis
ref|XP_010422850.1|  PREDICTED: ras-related protein RABA4a-like i...    296   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009390909.1|  PREDICTED: ras-related protein Rab11D-like         295   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871417.1|  hypothetical protein ARALYDRAFT_325580             295   2e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_010491702.1|  PREDICTED: ras-related protein RABA4a-like         295   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009112174.1|  PREDICTED: ras-related protein RABA4a              294   3e-97    Brassica rapa
emb|CDX81274.1|  BnaC09g06850D                                          294   4e-97    
gb|ABK22282.1|  unknown                                                 293   7e-97    Picea sitchensis
gb|ACU16457.1|  unknown                                                 293   7e-97    Glycine max [soybeans]
ref|XP_008782165.1|  PREDICTED: ras-related protein Rab11D-like         293   8e-97    Phoenix dactylifera
ref|XP_006290108.1|  hypothetical protein CARUB_v10003752mg             293   8e-97    Capsella rubella
ref|XP_006404694.1|  hypothetical protein EUTSA_v10000314mg             293   8e-97    Eutrema salsugineum [saltwater cress]
ref|NP_001064476.1|  Os10g0377400                                       293   1e-96    
ref|XP_009393549.1|  PREDICTED: ras-related protein Rab11D-like         293   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009122063.1|  PREDICTED: ras-related protein RABA4a-like         292   2e-96    Brassica rapa
emb|CDX69843.1|  BnaA10g21920D                                          292   3e-96    
ref|XP_003573862.1|  PREDICTED: ras-related protein Rab11D-like         291   3e-96    
ref|XP_006399529.1|  hypothetical protein EUTSA_v10014596mg             291   5e-96    Eutrema salsugineum [saltwater cress]
ref|NP_001149604.1|  LOC100283230                                       290   8e-96    Zea mays [maize]
ref|XP_009129562.1|  PREDICTED: ras-related protein RABA4b              291   8e-96    Brassica rapa
ref|XP_006662306.1|  PREDICTED: ras-related protein Rab11D-like         290   1e-95    Oryza brachyantha
ref|XP_009413627.1|  PREDICTED: ras-related protein Rab11D-like         290   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07731.1|  unnamed protein product                                290   2e-95    Coffea canephora [robusta coffee]
ref|XP_004985399.1|  PREDICTED: ras-related protein Rab11D-like         290   2e-95    Setaria italica
gb|KFK30576.1|  hypothetical protein AALP_AA7G279800                    289   5e-95    Arabis alpina [alpine rockcress]
ref|NP_001151560.1|  ras-related protein Rab11D                         288   6e-95    Zea mays [maize]
ref|XP_002465727.1|  hypothetical protein SORBIDRAFT_01g044550          288   7e-95    Sorghum bicolor [broomcorn]
ref|NP_001151068.1|  ras-related protein Rab11D                         288   7e-95    
dbj|BAJ93377.1|  predicted protein                                      288   7e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010555372.1|  PREDICTED: ras-related protein RABA4b              288   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_010437126.1|  PREDICTED: ras-related protein RABA4b              288   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010446581.1|  PREDICTED: ras-related protein RABA4b-like         288   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_006284416.1|  hypothetical protein CARUB_v10005586mg             288   2e-94    
ref|XP_003577923.1|  PREDICTED: ras-related protein RGP1                287   2e-94    
gb|AAA87884.1|  ATGB3                                                   287   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431983.1|  PREDICTED: ras-related protein RABA4b-like         287   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002489255.1|  hypothetical protein SORBIDRAFT_0012s021070        286   3e-94    Sorghum bicolor [broomcorn]
gb|ABK25126.1|  unknown                                                 287   3e-94    Picea sitchensis
gb|AAM66946.1|  GTP-binding protein GB3                                 287   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866902.1|  hypothetical protein ARALYDRAFT_490786             286   4e-94    
ref|NP_195709.1|  GTP-binding protein ATGB3                             286   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004983071.1|  PREDICTED: ras-related protein Rab11D-like         286   4e-94    Setaria italica
emb|CDY69836.1|  BnaAnng31680D                                          286   5e-94    Brassica napus [oilseed rape]
emb|CDX69369.1|  BnaC01g00840D                                          292   6e-94    
ref|XP_010422851.1|  PREDICTED: ras-related protein RABA4a-like i...    286   8e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009799541.1|  PREDICTED: ras-related protein RGP1-like           285   2e-93    Nicotiana sylvestris
ref|XP_006660497.1|  PREDICTED: ras-related protein RGP1-like           285   2e-93    Oryza brachyantha
ref|XP_009612391.1|  PREDICTED: ras-related protein RGP1-like           284   3e-93    Nicotiana tomentosiformis
ref|XP_006366509.1|  PREDICTED: ras-related protein RGP1-like           284   3e-93    Solanum tuberosum [potatoes]
gb|KJB18227.1|  hypothetical protein B456_003G040900                    284   3e-93    Gossypium raimondii
gb|KHG00253.1|  Ras-related Rab11A                                      284   5e-93    Gossypium arboreum [tree cotton]
ref|XP_010265793.1|  PREDICTED: ras-related protein RGP1-like           283   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010067891.1|  PREDICTED: ras-related protein RABA4c-like         283   1e-92    Eucalyptus grandis [rose gum]
ref|XP_010102630.1|  Ras-related protein RGP1                           283   1e-92    Morus notabilis
sp|P25766.2|RLGP1_ORYSJ  RecName: Full=Ras-related protein RGP1; ...    283   1e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002298447.1|  GTP-binding family protein                         282   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010928849.1|  PREDICTED: ras-related protein RGP1                282   3e-92    Elaeis guineensis
ref|XP_011025048.1|  PREDICTED: ras-related protein RABA4d              282   3e-92    Populus euphratica
ref|XP_011087327.1|  PREDICTED: ras-related protein RGP1                281   4e-92    Sesamum indicum [beniseed]
ref|XP_008787280.1|  PREDICTED: ras-related protein RGP1                281   4e-92    Phoenix dactylifera
ref|XP_002513185.1|  protein with unknown function                      281   5e-92    Ricinus communis
ref|XP_004229604.1|  PREDICTED: ras-related protein RGP1                280   9e-92    Solanum lycopersicum
gb|EYU27083.1|  hypothetical protein MIMGU_mgv1a013266mg                280   1e-91    Erythranthe guttata [common monkey flower]
ref|XP_002459958.1|  hypothetical protein SORBIDRAFT_02g018890          280   2e-91    Sorghum bicolor [broomcorn]
gb|EMT23732.1|  Ras-related protein RGP1                                279   3e-91    
ref|XP_004956465.1|  PREDICTED: ras-related protein RGP1-like           279   3e-91    Setaria italica
ref|XP_008240816.1|  PREDICTED: ras-related protein RABA4d              278   5e-91    Prunus mume [ume]
ref|XP_006421492.1|  hypothetical protein CICLE_v10005824mg             278   5e-91    Citrus clementina [clementine]
ref|XP_009399667.1|  PREDICTED: ras-related protein RGP1-like           279   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG15141.1|  Ras-related RABA4c -like protein                        279   5e-91    Gossypium arboreum [tree cotton]
ref|XP_007204003.1|  hypothetical protein PRUPE_ppa025526mg             278   5e-91    Prunus persica
ref|XP_010913931.1|  PREDICTED: ras-related protein RGP1-like           278   7e-91    Elaeis guineensis
ref|XP_002863846.1|  small molecular weight G-protein 1                 278   7e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_007028923.1|  RAB GTPase A4D                                     278   7e-91    
ref|XP_002264293.1|  PREDICTED: ras-related protein RGP1                278   1e-90    Vitis vinifera
tpg|DAA39806.1|  TPA: ras protein RGP1                                  278   1e-90    
ref|XP_010257365.1|  PREDICTED: ras-related protein RABA4d              278   1e-90    Nelumbo nucifera [Indian lotus]
gb|EYU39898.1|  hypothetical protein MIMGU_mgv1a020125mg                278   1e-90    Erythranthe guttata [common monkey flower]
ref|XP_010695403.1|  PREDICTED: ras-related protein RABA4d              278   1e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006395225.1|  hypothetical protein EUTSA_v10004881mg             278   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_010057727.1|  PREDICTED: ras-related protein RABA4d              277   1e-90    Eucalyptus grandis [rose gum]
gb|KDP43443.1|  hypothetical protein JCGZ_16730                         278   1e-90    Jatropha curcas
ref|XP_010439146.1|  PREDICTED: ras-related protein RABA4c              277   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010442212.1|  PREDICTED: ras-related protein RABA4c-like         277   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008461787.1|  PREDICTED: ras-related protein RABA4c              276   3e-90    Cucumis melo [Oriental melon]
ref|XP_006438973.1|  hypothetical protein CICLE_v10032676mg             276   3e-90    Citrus clementina [clementine]
ref|XP_006850119.1|  hypothetical protein AMTR_s00022p00227570          276   3e-90    Amborella trichopoda
ref|XP_006281058.1|  hypothetical protein CARUB_v10027077mg             276   4e-90    Capsella rubella
emb|CDX86332.1|  BnaA06g30490D                                          276   5e-90    
ref|XP_009151604.1|  PREDICTED: ras-related protein RABA4c              276   7e-90    Brassica rapa
ref|NP_187823.1|  RAB GTPase-like protein A4D                           275   8e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391884.1|  PREDICTED: ras-related protein RGP1-like           276   8e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY54519.1|  BnaC07g49230D                                          275   8e-90    Brassica napus [oilseed rape]
ref|XP_009120881.1|  PREDICTED: ras-related protein RABA4d              275   9e-90    Brassica rapa
ref|XP_009590361.1|  PREDICTED: ras-related protein RABA4d-like         275   1e-89    Nicotiana tomentosiformis
ref|XP_010557931.1|  PREDICTED: ras-related protein RABA4d-like         275   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_010520062.1|  PREDICTED: ras-related protein RABA4d              275   1e-89    Tarenaya hassleriana [spider flower]
ref|NP_199607.1|  RAB GTPase homolog A4C                                275   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411810.1|  PREDICTED: ras-related protein RGP1-like           275   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078858.1|  PREDICTED: ras-related protein RABA4d              275   1e-89    Sesamum indicum [beniseed]
ref|XP_008373738.1|  PREDICTED: ras-related protein RABA4d              275   2e-89    
ref|XP_004149604.1|  PREDICTED: ras-related protein RABA4c-like         275   2e-89    Cucumis sativus [cucumbers]
ref|NP_001146862.1|  LOC100280470                                       275   2e-89    Zea mays [maize]
ref|XP_004172276.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    275   2e-89    
ref|XP_007052583.1|  RAB GTPase A4C                                     275   2e-89    
ref|XP_010534274.1|  PREDICTED: ras-related protein RABA4c              274   2e-89    Tarenaya hassleriana [spider flower]
emb|CDY42133.1|  BnaC05g40860D                                          274   2e-89    Brassica napus [oilseed rape]
ref|XP_002282798.1|  PREDICTED: ras-related protein RABA4d              274   2e-89    Vitis vinifera
emb|CDY00758.1|  BnaC03g37420D                                          274   3e-89    
ref|XP_009345104.1|  PREDICTED: ras-related protein RABA4d-like         275   3e-89    Pyrus x bretschneideri [bai li]
ref|XP_009135214.1|  PREDICTED: ras-related protein RABA4d-like         274   3e-89    Brassica rapa
ref|XP_006351381.1|  PREDICTED: ras-related protein RABA4d-like         274   4e-89    Solanum tuberosum [potatoes]
ref|XP_004249189.1|  PREDICTED: ras-related protein RABA4d-like         274   4e-89    Solanum lycopersicum
ref|XP_009347482.1|  PREDICTED: ras-related protein RABA4d-like         275   4e-89    Pyrus x bretschneideri [bai li]
ref|XP_008392105.1|  PREDICTED: ras-related protein RABA4d-like         275   5e-89    
ref|XP_008375145.1|  PREDICTED: ras-related protein RABA4c-like         273   5e-89    Malus domestica [apple tree]
ref|XP_010489789.1|  PREDICTED: ras-related protein RABA4d-like         273   5e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009354700.1|  PREDICTED: ras-related protein RABA4c-like         273   6e-89    Pyrus x bretschneideri [bai li]
gb|ABK23331.1|  unknown                                                 273   6e-89    Picea sitchensis
emb|CDP10094.1|  unnamed protein product                                273   6e-89    Coffea canephora [robusta coffee]
ref|XP_008460801.1|  PREDICTED: ras-related protein RABA4d              273   8e-89    Cucumis melo [Oriental melon]
ref|XP_004150166.1|  PREDICTED: ras-related protein RABA4d-like         273   1e-88    Cucumis sativus [cucumbers]
ref|XP_010482045.1|  PREDICTED: ras-related protein RABA4c-like         273   1e-88    Camelina sativa [gold-of-pleasure]
emb|CAA41966.1|  GTP-binding protein                                    273   1e-88    Oryza sativa [red rice]
ref|XP_008344636.1|  PREDICTED: ras-related protein RABA4d              270   1e-88    
ref|XP_009804804.1|  PREDICTED: ras-related protein RABA4d-like         272   2e-88    Nicotiana sylvestris
ref|XP_011075182.1|  PREDICTED: ras-related protein RABA4d-like         272   2e-88    Sesamum indicum [beniseed]
ref|XP_009763158.1|  PREDICTED: ras-related protein RABA4d-like         272   2e-88    Nicotiana sylvestris
ref|XP_004494010.1|  PREDICTED: ras-related protein RABA4d-like         272   2e-88    
ref|XP_007140805.1|  hypothetical protein PHAVU_008G143600g             272   2e-88    Phaseolus vulgaris [French bean]
ref|XP_008350827.1|  PREDICTED: ras-related protein RABA4d              270   2e-88    
ref|XP_009146635.1|  PREDICTED: ras-related protein RABA4d-like         273   3e-88    Brassica rapa
gb|KHG02480.1|  Ras-related RABA4d -like protein                        271   3e-88    Gossypium arboreum [tree cotton]
ref|XP_010672725.1|  PREDICTED: ras-related protein RABA4d              271   3e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008231353.1|  PREDICTED: ras-related protein RABA4c              271   4e-88    Prunus mume [ume]
ref|XP_007218358.1|  hypothetical protein PRUPE_ppa011105mg             271   5e-88    Prunus persica
ref|XP_004309478.1|  PREDICTED: ras-related protein RABA4d isofor...    270   7e-88    Fragaria vesca subsp. vesca
ref|XP_002323298.1|  Ras-related GTP-binding family protein             270   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_002532404.1|  protein with unknown function                      270   1e-87    Ricinus communis
ref|XP_004497938.1|  PREDICTED: ras-related protein RABA4d-like         270   1e-87    Cicer arietinum [garbanzo]
ref|XP_004234844.1|  PREDICTED: ras-related protein RABA4d-like         270   1e-87    Solanum lycopersicum
gb|KJB36087.1|  hypothetical protein B456_006G140300                    270   2e-87    Gossypium raimondii
ref|XP_009591241.1|  PREDICTED: ras-related protein RABA4d-like         270   2e-87    Nicotiana tomentosiformis
ref|XP_007145654.1|  hypothetical protein PHAVU_007G257200g             269   2e-87    Phaseolus vulgaris [French bean]
ref|XP_011016542.1|  PREDICTED: ras-related protein RABA4d-like         269   2e-87    Populus euphratica
gb|KHG20755.1|  Ras-related RABA4d -like protein                        269   2e-87    Gossypium arboreum [tree cotton]
ref|XP_011033268.1|  PREDICTED: ras-related protein RABA4d-like i...    269   2e-87    Populus euphratica
gb|KEH16247.1|  RAB GTPase-like protein A1D                             269   3e-87    Medicago truncatula
gb|EYU20715.1|  hypothetical protein MIMGU_mgv1a013518mg                269   3e-87    Erythranthe guttata [common monkey flower]
ref|XP_009365017.1|  PREDICTED: ras-related protein RABA4c-like         269   4e-87    Pyrus x bretschneideri [bai li]
gb|AFK37481.1|  unknown                                                 268   6e-87    Medicago truncatula
gb|AFK40086.1|  unknown                                                 267   6e-87    Lotus japonicus
ref|XP_003516822.1|  PREDICTED: ras-related protein RABA4d-like         268   6e-87    Glycine max [soybeans]
gb|EPS73160.1|  hypothetical protein M569_01593                         268   7e-87    Genlisea aurea
ref|XP_010111429.1|  Ras-related protein RABA4d                         268   7e-87    
ref|XP_001775770.1|  predicted protein                                  268   9e-87    
gb|ACU18500.1|  unknown                                                 267   1e-86    Glycine max [soybeans]
gb|KHN09949.1|  Ras-related protein RABA4d                              267   1e-86    Glycine soja [wild soybean]
ref|XP_003539132.1|  PREDICTED: ras-related protein RABA4d-like         267   1e-86    Glycine max [soybeans]
ref|XP_010422852.1|  PREDICTED: ras-related protein RABA4a-like i...    266   2e-86    
ref|XP_006381042.1|  Ras-related GTP-binding family protein             266   2e-86    Populus trichocarpa [western balsam poplar]
gb|KHN07997.1|  Ras-related protein RABA4d                              268   3e-86    Glycine soja [wild soybean]
gb|AAG51053.1|AC069473_15  ras-related GTP-binding protein, putat...    265   6e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020284.1|  PREDICTED: ras-related protein RABA4d-like         265   1e-85    Populus euphratica
ref|XP_001760654.1|  Rab11/RabA-family small GTPase                     263   4e-85    
ref|XP_004306514.1|  PREDICTED: ras-related protein RABA4c              264   9e-85    Fragaria vesca subsp. vesca
gb|EPS69801.1|  hypothetical protein M569_04963                         262   1e-84    Genlisea aurea
ref|XP_011470829.1|  PREDICTED: ras-related protein RABA4d isofor...    261   4e-84    Fragaria vesca subsp. vesca
ref|XP_001753670.1|  Rab11/RabA-family small GTPase                     260   6e-84    
ref|XP_009375439.1|  PREDICTED: ras-related protein RABA3               261   6e-84    Pyrus x bretschneideri [bai li]
gb|KDO83348.1|  hypothetical protein CISIN_1g040835mg                   259   9e-84    Citrus sinensis [apfelsine]
ref|XP_002972485.1|  rab family GTPase                                  259   2e-83    Selaginella moellendorffii
ref|XP_006339750.1|  PREDICTED: ras-related protein RABA3-like          260   2e-83    Solanum tuberosum [potatoes]
ref|XP_002984315.1|  rab family GTPase                                  259   2e-83    Selaginella moellendorffii
gb|KHN27367.1|  Ras-related protein RABA4d                              259   2e-83    Glycine soja [wild soybean]
ref|XP_011033267.1|  PREDICTED: ras-related protein RABA4d-like i...    259   2e-83    Populus euphratica
ref|XP_004230007.1|  PREDICTED: ras-related protein RABA3               259   5e-83    Solanum lycopersicum
gb|KJB09611.1|  hypothetical protein B456_001G152600                    258   8e-83    Gossypium raimondii
ref|XP_007220411.1|  hypothetical protein PRUPE_ppa010826mg             258   9e-83    
ref|XP_002262618.3|  PREDICTED: ras-related protein RABA3               258   1e-82    Vitis vinifera
ref|XP_008233092.1|  PREDICTED: ras-related protein RABA3               258   1e-82    Prunus mume [ume]
gb|KHF99482.1|  Ras-related RABA3 -like protein                         257   2e-82    Gossypium arboreum [tree cotton]
ref|XP_008376179.1|  PREDICTED: ras-related protein RABA3               257   2e-82    Malus domestica [apple tree]
ref|XP_010252473.1|  PREDICTED: ras-related protein RABA3               257   3e-82    Nelumbo nucifera [Indian lotus]
ref|XP_003548240.1|  PREDICTED: ras-related protein RABA3-like is...    256   4e-82    
ref|XP_003528777.1|  PREDICTED: ras-related protein RABA3-like          256   4e-82    Glycine max [soybeans]
ref|XP_010693617.1|  PREDICTED: ras-related protein RABA3               256   5e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011094230.1|  PREDICTED: ras-related protein RABA3               256   6e-82    Sesamum indicum [beniseed]
ref|XP_007051475.1|  RAB GTPase A3                                      259   6e-82    
gb|EMS64557.1|  Ras-related protein RGP1                                255   7e-82    Triticum urartu
gb|AAM08543.1|AC079935_15  Putative Ras-related protein Rab             254   7e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135286.1|  hypothetical protein PHAVU_010G116500g             256   7e-82    Phaseolus vulgaris [French bean]
gb|KJB41593.1|  hypothetical protein B456_007G110800                    255   9e-82    Gossypium raimondii
ref|XP_002320214.2|  GTP-binding family protein                         255   1e-81    
ref|XP_010100694.1|  Ras-related protein RABA3                          254   2e-81    Morus notabilis
ref|XP_011038764.1|  PREDICTED: ras-related protein RABA3-like          254   3e-81    Populus euphratica
ref|XP_009617959.1|  PREDICTED: ras-related protein RABA3               254   3e-81    Nicotiana tomentosiformis
emb|CDP08641.1|  unnamed protein product                                254   3e-81    Coffea canephora [robusta coffee]
gb|AET02012.2|  Ras-related small GTP-binding family protein            253   5e-81    Medicago truncatula
ref|XP_004306638.1|  PREDICTED: ras-related protein RABA3               253   7e-81    Fragaria vesca subsp. vesca
emb|CAA98178.1|  RAB11B                                                 253   1e-80    Lotus japonicus
ref|XP_009797391.1|  PREDICTED: ras-related protein RABA3               253   2e-80    Nicotiana sylvestris
ref|XP_002533328.1|  protein with unknown function                      251   3e-80    Ricinus communis
ref|XP_002985624.1|  rab family GTPase                                  250   5e-80    Selaginella moellendorffii
ref|XP_004510635.1|  PREDICTED: ras-related protein RABA3-like          251   6e-80    Cicer arietinum [garbanzo]
ref|XP_002974254.1|  rab family GTPase                                  250   7e-80    
gb|AFK45144.1|  unknown                                                 251   8e-80    
dbj|BAA84640.1|  PRA2                                                   249   2e-79    
dbj|BAA02109.1|  GTP-binding protein                                    249   2e-79    
gb|KDP28444.1|  hypothetical protein JCGZ_14215                         249   2e-79    
ref|XP_011023129.1|  PREDICTED: ras-related protein RABA3-like          249   4e-79    
ref|XP_007147338.1|  hypothetical protein PHAVU_006G115500g             248   4e-79    
ref|NP_001239700.1|  uncharacterized protein LOC100787725               248   1e-78    
ref|XP_006598887.1|  PREDICTED: ras-related protein RABA3-like is...    247   2e-78    
gb|ACU22888.1|  unknown                                                 246   3e-78    
ref|XP_003554775.1|  PREDICTED: ras-related protein RABA3-like          246   4e-78    
ref|XP_010934494.1|  PREDICTED: ras-related protein RABA3               246   4e-78    
ref|XP_004494844.1|  PREDICTED: ras-related protein RABA3-like          245   6e-78    
ref|XP_002302656.2|  GTP-binding family protein                         244   1e-77    
gb|KFK32821.1|  hypothetical protein AALP_AA6G292000                    243   2e-77    
ref|XP_010054978.1|  PREDICTED: ras-related protein RABA3               244   5e-77    
ref|XP_002315193.2|  hypothetical protein POPTR_0010s20460g             242   6e-77    
dbj|BAJ96755.1|  predicted protein                                      242   9e-77    
emb|CDM84991.1|  unnamed protein product                                242   9e-77    
ref|XP_007141835.1|  hypothetical protein PHAVU_008G229600g             241   1e-76    
ref|XP_009415825.1|  PREDICTED: ras-related protein RABA3-like          243   2e-76    
ref|XP_004307586.1|  PREDICTED: ras-related protein Rab2BV-like i...    241   2e-76    
ref|XP_003544161.1|  PREDICTED: ras-related protein Rab2BV-like         241   3e-76    
ref|XP_009351264.1|  PREDICTED: ras-related protein Rab2BV-like         240   3e-76    
ref|XP_008806367.1|  PREDICTED: ras-related protein RABA3               241   4e-76    
gb|KHN20893.1|  Ras-related protein Rab2BV                              240   4e-76    
gb|KHN13102.1|  Ras-related protein Rab2BV                              240   4e-76    
ref|XP_006645011.1|  PREDICTED: ras-related protein Rab11C-like         240   4e-76    
ref|XP_004981229.1|  PREDICTED: ras-related protein Rab11C-like         240   4e-76    
ref|XP_010522902.1|  PREDICTED: ras-related protein RABA3               241   4e-76    
ref|XP_009392203.1|  PREDICTED: ras-related protein RABA4d-like         241   4e-76    
dbj|BAK01667.1|  predicted protein                                      240   4e-76    
ref|XP_010905873.1|  PREDICTED: ras-related protein Rab2BV-like         240   5e-76    
ref|XP_006650816.1|  PREDICTED: ras-related protein Rab11C-like         240   5e-76    
ref|XP_003519369.1|  PREDICTED: ras-related protein Rab11C-like         240   5e-76    
ref|NP_001130075.1|  uncharacterized protein LOC100191168               240   5e-76    
ref|XP_010557233.1|  PREDICTED: ras-related protein RABA2b              240   5e-76    
gb|EEC76436.1|  hypothetical protein OsI_14124                          240   6e-76    
ref|XP_010262670.1|  PREDICTED: ras-related protein Rab2BV              240   6e-76    
gb|ACN27780.1|  unknown                                                 239   8e-76    
ref|XP_004490850.1|  PREDICTED: ras-related protein Rab11C-like         239   8e-76    
ref|XP_010521896.1|  PREDICTED: ras-related protein RABA2b-like         239   9e-76    
ref|XP_003564610.1|  PREDICTED: ras-related protein Rab11C-like         239   9e-76    
ref|XP_007218372.1|  hypothetical protein PRUPE_ppa011294mg             239   1e-75    
ref|XP_008233507.1|  PREDICTED: ras-related protein Rab2BV-like         239   1e-75    
ref|XP_002312127.2|  GTP-binding family protein                         239   1e-75    
ref|NP_001044805.1|  Os01g0848700                                       239   1e-75    
ref|XP_007148577.1|  hypothetical protein PHAVU_006G220200g             239   1e-75    
ref|XP_010030204.1|  PREDICTED: ras-related protein RABA2a              239   1e-75    
ref|NP_001051744.1|  Os03g0823700                                       238   2e-75    
gb|EMT13645.1|  Ras-related protein Rab11C                              238   2e-75    
gb|EMS46168.1|  Ras-related protein Rab11C                              238   2e-75    
ref|XP_011036041.1|  PREDICTED: ras-related protein Rab2BV-like         238   3e-75    
ref|XP_010681762.1|  PREDICTED: ras-related protein RABA2a              238   3e-75    
ref|XP_004516148.1|  PREDICTED: ras-related protein RABA4c-like         238   3e-75    
ref|XP_010256763.1|  PREDICTED: ras-related protein Rab11C              238   3e-75    
ref|XP_007163484.1|  hypothetical protein PHAVU_001G238000g             238   3e-75    
ref|XP_006486541.1|  PREDICTED: ras-related protein Rab11C-like         238   3e-75    
emb|CDO97631.1|  unnamed protein product                                238   3e-75    
ref|XP_002524247.1|  protein with unknown function                      238   4e-75    
emb|CDP00152.1|  unnamed protein product                                238   4e-75    
ref|XP_003592898.1|  Ras-related protein RABA2a                         238   4e-75    
gb|KDO69222.1|  hypothetical protein CISIN_1g042687mg                   238   4e-75    
ref|XP_008452243.1|  PREDICTED: ras-related protein RABA2a              238   4e-75    
ref|XP_004133721.1|  PREDICTED: ras-related protein RABA2a-like         238   5e-75    
ref|XP_010926662.1|  PREDICTED: ras-related protein RABA4d-like         237   5e-75    
ref|XP_009774455.1|  PREDICTED: ras-related protein RABA2b-like         237   5e-75    
gb|KJB60697.1|  hypothetical protein B456_009G320100                    237   6e-75    
ref|XP_008372177.1|  PREDICTED: ras-related protein Rab2BV-like         237   6e-75    
ref|XP_007009171.1|  RAB GTPase A2B                                     237   7e-75    
gb|ABR18090.1|  unknown                                                 237   7e-75    
ref|XP_006305568.1|  hypothetical protein CARUB_v10010167mg             238   7e-75    
ref|XP_002889376.1|  hypothetical protein ARALYDRAFT_470156             238   7e-75    
ref|XP_009622621.1|  PREDICTED: ras-related protein RABA2b-like         237   8e-75    
ref|XP_004155229.1|  PREDICTED: ras-related protein RABA2a-like         237   8e-75    
gb|EYU35014.1|  hypothetical protein MIMGU_mgv1a013570mg                237   8e-75    
ref|XP_006444779.1|  hypothetical protein CICLE_v10021994mg             238   9e-75    
ref|XP_009629737.1|  PREDICTED: ras-related protein Rab2BV-like         237   9e-75    
emb|CDX93495.1|  BnaA06g05530D                                          237   9e-75    
ref|XP_006858606.1|  hypothetical protein AMTR_s00071p00201210          237   9e-75    
ref|NP_001146923.1|  LOC100280532                                       237   9e-75    
ref|XP_009797654.1|  PREDICTED: ras-related protein Rab2BV-like         237   1e-74    
ref|NP_001290016.1|  ras-related protein Rab2BV                         236   1e-74    
emb|CDY50888.1|  BnaCnng19800D                                          237   1e-74    
ref|XP_004230439.1|  PREDICTED: ras-related protein RABA2a              236   1e-74    
ref|XP_011087655.1|  PREDICTED: ras-related protein RABA2a-like         236   1e-74    
ref|XP_006417553.1|  hypothetical protein EUTSA_v10008742mg             236   1e-74    
ref|XP_004138445.1|  PREDICTED: ras-related protein Rab2BV-like         236   1e-74    
ref|XP_002892514.1|  hypothetical protein ARALYDRAFT_888208             236   1e-74    
ref|XP_008441408.1|  PREDICTED: ras-related protein Rab2BV              236   1e-74    
ref|XP_011011334.1|  PREDICTED: ras-related protein RABA2a              236   1e-74    
ref|XP_006349310.1|  PREDICTED: ras-related protein RABA2a-like         236   1e-74    
ref|XP_007676651.1|  hypothetical protein BAUCODRAFT_487092             236   1e-74    
ref|XP_009148263.1|  PREDICTED: ras-related protein RABA2a              236   1e-74    
gb|KEH19056.1|  RAB GTPase-like protein A1D                             237   1e-74    
ref|XP_010227523.1|  PREDICTED: ras-related protein Rab11C              236   1e-74    
ref|XP_006355682.1|  PREDICTED: ras-related protein RABA2b-like         236   1e-74    
ref|XP_011047877.1|  PREDICTED: ras-related protein RABA2a-like         236   1e-74    
ref|XP_006389492.1|  hypothetical protein POPTR_0022s00350g             236   1e-74    
ref|NP_172434.1|  RAB GTPase 11C                                        236   1e-74    
ref|XP_004239919.1|  PREDICTED: ras-related protein RABA2b-like         236   1e-74    
ref|XP_010245424.1|  PREDICTED: ras-related protein RABA2a              236   1e-74    
ref|XP_010490210.1|  PREDICTED: ras-related protein RABA2a isofor...    236   1e-74    
ref|XP_006305601.1|  hypothetical protein CARUB_v10010267mg             236   2e-74    
gb|KHG15679.1|  Ras-related Rab11C                                      236   2e-74    
ref|XP_010458259.1|  PREDICTED: ras-related protein RABA2a-like         236   2e-74    
ref|XP_008781983.1|  PREDICTED: ras-related protein RABA2a-like         236   2e-74    
gb|EMF15948.1|  ras GTPase Rab11                                        236   2e-74    
ref|XP_011028371.1|  PREDICTED: ras-related protein RABA2a-like         236   2e-74    
ref|XP_003540537.1|  PREDICTED: ras-related protein RABA4c-like         236   2e-74    
ref|XP_009118440.1|  PREDICTED: ras-related protein RABA2b              236   2e-74    
ref|XP_010503299.1|  PREDICTED: ras-related protein RABA2c              236   2e-74    
ref|NP_190267.1|  Ras-related protein RABA2c                            236   2e-74    
ref|XP_011089516.1|  PREDICTED: ras-related protein Rab11C              236   2e-74    
ref|XP_010544112.1|  PREDICTED: ras-related protein RABA2a              236   2e-74    
ref|XP_006361966.1|  PREDICTED: ras-related protein RABA2b-like         236   2e-74    
ref|XP_006418853.1|  hypothetical protein EUTSA_v10002662mg             236   2e-74    
ref|XP_007133843.1|  hypothetical protein PHAVU_011G213600g             236   2e-74    
gb|KFK43256.1|  hypothetical protein AALP_AA1G100200                    236   3e-74    
ref|NP_001147252.1|  ras-related protein Rab11C                         236   3e-74    
ref|XP_010908030.1|  PREDICTED: ras-related protein RABA2a-like         236   3e-74    
gb|ABK94045.1|  unknown                                                 236   3e-74    
gb|KFK42506.1|  hypothetical protein AALP_AA1G002500                    236   3e-74    
ref|XP_006488403.1|  PREDICTED: ras-related protein Rab11C-like i...    236   3e-74    
ref|XP_009769694.1|  PREDICTED: ras-related protein RABA2a              236   3e-74    
ref|XP_004235050.1|  PREDICTED: ras-related protein RABA2b-like         235   3e-74    
emb|CDY06703.1|  BnaA10g04820D                                          236   3e-74    
ref|XP_009404938.1|  PREDICTED: ras-related protein RABA2a-like         236   3e-74    
ref|XP_010043481.1|  PREDICTED: ras-related protein Rab2BV              235   3e-74    
ref|NP_001136551.1|  uncharacterized protein LOC100216670               235   3e-74    
ref|XP_006400995.1|  hypothetical protein EUTSA_v10014634mg             235   3e-74    
ref|NP_172221.1|  RAB GTPase homolog A2B                                235   3e-74    
ref|XP_010535441.1|  PREDICTED: ras-related protein RABA2d-like         235   3e-74    
ref|XP_010923201.1|  PREDICTED: ras-related protein Rab2BV              235   4e-74    
ref|XP_002146308.1|  Ras GTPase Rab11, putative                         235   4e-74    
ref|XP_010480581.1|  PREDICTED: ras-related protein RABA3               236   4e-74    
ref|XP_008811352.1|  PREDICTED: ras-related protein Rab11C-like         235   4e-74    
ref|XP_002264444.1|  PREDICTED: ras-related protein RABA2a              235   4e-74    
ref|XP_009161793.1|  Ras-like protein Rab-11B                           235   4e-74    
ref|XP_008785489.1|  PREDICTED: ras-related protein Rab11C              235   4e-74    
ref|NP_001240030.1|  uncharacterized protein LOC100797258               235   4e-74    
ref|XP_010108378.1|  Ras-related protein Rab2BV                         235   4e-74    
ref|XP_010474709.1|  PREDICTED: ras-related protein RABA3-like          236   4e-74    
gb|KJB74090.1|  hypothetical protein B456_011G271400                    235   5e-74    
gb|AFK33953.1|  unknown                                                 235   5e-74    
ref|XP_006304197.1|  hypothetical protein CARUB_v10010276mg             235   5e-74    
gb|AFW84585.1|  ras protein Rab11C                                      239   5e-74    
gb|KDP44862.1|  hypothetical protein JCGZ_01362                         235   5e-74    
ref|XP_006417807.1|  hypothetical protein EUTSA_v10008748mg             235   5e-74    
ref|XP_010520249.1|  PREDICTED: ras-related protein RABA2d              235   6e-74    
gb|ACU17691.1|  unknown                                                 235   6e-74    
ref|XP_003600801.1|  Ras-related protein Rab11A                         235   6e-74    
ref|XP_009588584.1|  PREDICTED: ras-related protein Rab2BV              235   6e-74    
gb|KHN39681.1|  Ras-related protein RABA2a                              234   6e-74    
gb|KIV99926.1|  hypothetical protein PV09_08449                         234   6e-74    
ref|XP_007736612.1|  Ras-like protein Rab-11B                           235   7e-74    
ref|XP_010475498.1|  PREDICTED: ras-related protein RABA2b              234   7e-74    
gb|ACJ83834.1|  unknown                                                 235   7e-74    
ref|XP_005843019.1|  hypothetical protein CHLNCDRAFT_33302              234   7e-74    
gb|ADE77295.1|  unknown                                                 234   7e-74    
ref|XP_004507156.1|  PREDICTED: ras-related protein Rab11C-like         234   7e-74    
ref|XP_010930425.1|  PREDICTED: ras-related protein RABA2a-like         234   7e-74    
gb|EYU19954.1|  hypothetical protein MIMGU_mgv1a013564mg                234   8e-74    
gb|ADE76069.1|  unknown                                                 234   8e-74    
ref|XP_010912701.1|  PREDICTED: ras-related protein RABA2a-like         234   8e-74    
ref|XP_003552713.1|  PREDICTED: ras-related protein Rab11C-like         234   8e-74    
ref|XP_010487428.1|  PREDICTED: ras-related protein RABA2b-like         234   8e-74    
emb|CDP09116.1|  unnamed protein product                                234   8e-74    
ref|XP_010905396.1|  PREDICTED: ras-related protein Rab2BV              234   8e-74    
ref|XP_011040076.1|  PREDICTED: ras-related protein Rab11C              234   9e-74    
gb|KJB21647.1|  hypothetical protein B456_004G006300                    234   9e-74    
ref|XP_010033213.1|  PREDICTED: ras-related protein Rab2BV-like         234   9e-74    
ref|XP_010457157.1|  PREDICTED: ras-related protein RABA3-like          235   9e-74    
ref|XP_010457916.1|  PREDICTED: ras-related protein RABA2b-like         234   1e-73    
ref|NP_001131943.1|  Ras protein Rab11A                                 234   1e-73    
emb|CDY02867.1|  BnaC02g10220D                                          234   1e-73    
ref|XP_008811507.1|  PREDICTED: ras-related protein Rab11C isofor...    234   1e-73    
ref|XP_008788335.1|  PREDICTED: ras-related protein RABA2a-like         234   1e-73    
ref|XP_010454720.1|  PREDICTED: ras-related protein RABA2d              234   1e-73    
gb|KJB19978.1|  hypothetical protein B456_003G128100                    234   1e-73    
emb|CDY33014.1|  BnaA10g12200D                                          234   1e-73    
ref|XP_009120428.1|  PREDICTED: ras-related protein RABA2d-like         234   1e-73    
ref|XP_002866318.1|  hypothetical protein ARALYDRAFT_919138             234   1e-73    
ref|XP_004485429.1|  PREDICTED: ras-related protein RABA2a-like         234   1e-73    
ref|XP_007225803.1|  hypothetical protein PRUPE_ppa011290mg             234   1e-73    
ref|XP_011092284.1|  PREDICTED: ras-related protein RABA2a              234   1e-73    
gb|KJB32873.1|  hypothetical protein B456_005G265900                    234   1e-73    
ref|XP_006418398.1|  hypothetical protein EUTSA_v10009311mg             234   1e-73    
gb|EYU33282.1|  hypothetical protein MIMGU_mgv1a012628mg                234   1e-73    
ref|XP_007016291.1|  RAB GTPase A2B                                     234   2e-73    
gb|KHN40888.1|  Ras-related protein RABA4d                              234   2e-73    
ref|XP_004984239.1|  PREDICTED: ras-related protein RABA2a-like         234   2e-73    
gb|KHF99560.1|  Ras-related RABA2a -like protein                        234   2e-73    
ref|XP_009126715.1|  PREDICTED: ras-related protein RABA2d              234   2e-73    
ref|XP_009353794.1|  PREDICTED: ras-related protein RABA2a              234   2e-73    
ref|XP_006470954.1|  PREDICTED: ras-related protein RABA2a-like         233   2e-73    
ref|XP_006281080.1|  hypothetical protein CARUB_v10027110mg             234   2e-73    
ref|NP_001235133.1|  uncharacterized protein LOC100499980               233   2e-73    
ref|XP_006373543.1|  hypothetical protein POPTR_0016s00240g             233   2e-73    
gb|KDP42194.1|  hypothetical protein JCGZ_02924                         233   2e-73    
ref|XP_010541416.1|  PREDICTED: ras-related protein RABA2c-like         233   2e-73    
ref|XP_009149960.1|  PREDICTED: ras-related protein RABA2c              233   2e-73    
ref|XP_009402312.1|  PREDICTED: ras-related protein Rab11C-like         233   2e-73    
ref|XP_007041174.1|  RAB GTPase 11C                                     233   2e-73    
gb|KHG06460.1|  Ras-related Rab11C                                      233   2e-73    
ref|XP_009795757.1|  PREDICTED: ras-related protein Rab11A              233   2e-73    
gb|ELR08819.1|  Ras-like protein Rab-11A                                233   2e-73    
ref|XP_008726025.1|  hypothetical protein G647_03458                    233   2e-73    
ref|XP_007757423.1|  Ras-like protein Rab-11B                           233   2e-73    
gb|KIV92614.1|  hypothetical protein PV10_03888                         233   2e-73    
ref|XP_007800300.1|  Ras-related protein Rab-11B                        234   2e-73    
ref|XP_002373044.1|  Ras GTPase Rab11, putative                         233   2e-73    
gb|EPS29596.1|  hypothetical protein PDE_04546                          233   2e-73    
ref|XP_003537971.1|  PREDICTED: ras-related protein Rab11C-like         233   2e-73    
gb|KHG18297.1|  Ras-related RABA2a -like protein                        233   2e-73    
gb|KFY07926.1|  hypothetical protein V492_06704                         233   2e-73    
ref|XP_002307838.2|  hypothetical protein POPTR_0006s00240g             233   2e-73    
ref|XP_001389030.1|  Ras-related protein Rab-11A                        233   2e-73    
ref|XP_009118963.1|  PREDICTED: ras-related protein RABA2b-like         233   2e-73    
gb|KDP42462.1|  hypothetical protein JCGZ_00259                         233   2e-73    
ref|XP_006859000.1|  hypothetical protein AMTR_s00068p00145200          233   2e-73    



>ref|XP_004250110.1| PREDICTED: ras-related protein Rab11D [Solanum lycopersicum]
Length=224

 Score =   326 bits (835),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 163/165 (99%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  120  DKNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  164



>ref|XP_009798472.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana sylvestris]
Length=224

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 163/165 (99%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  120  DKNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  164



>ref|XP_009620681.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana tomentosiformis]
Length=224

 Score =   324 bits (830),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/165 (95%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  120  DKNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  164



>ref|XP_006353216.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=224

 Score =   322 bits (826),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/165 (95%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQ KSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQRKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  120  DKNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  164



>emb|CDP01498.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   319 bits (817),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIV++LIGNKTDLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  120  DKNIVVILIGNKTDLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_011100043.1| PREDICTED: ras-related protein Rab11D [Sesamum indicum]
Length=225

 Score =   318 bits (816),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MAS GGYGDA+ QK+DYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRTM
Sbjct  1    MASSGGYGDAS-QKVDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTM  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWL+ELRAHA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLDELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNKTDLED+R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKTDLEDQRAVPTEDAKEFAEKEGLFFLETSALEA  164



>emb|CBI33135.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   317 bits (813),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNKTDLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKTDLEEQRAVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_008440577.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440578.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440579.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
Length=227

 Score =   318 bits (815),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTEDAKEFA+KEGLFFLETSA+E+
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDAKEFAEKEGLFFLETSALES  164



>ref|XP_004143457.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 ref|XP_004160129.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 gb|KGN48734.1| hypothetical protein Csa_6G499780 [Cucumis sativus]
Length=226

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTEDAKEFA+KEGLFFLETSA+E+
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDAKEFAEKEGLFFLETSALES  164



>ref|XP_002273530.1| PREDICTED: ras-related protein Rab11D [Vitis vinifera]
 emb|CAN70163.1| hypothetical protein VITISV_039255 [Vitis vinifera]
Length=226

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNKTDLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKTDLEEQRAVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_011022819.1| PREDICTED: ras-related protein Rab11D [Populus euphratica]
Length=223

 Score =   317 bits (813),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTEDAKEFAQKEGLFFLETSA++A
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDAKEFAQKEGLFFLETSALQA  164



>ref|XP_002310552.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|EEE91002.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   317 bits (813),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTEDAKEFAQKEGLFFLETSA++A
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDAKEFAQKEGLFFLETSALQA  164



>gb|KDP29718.1| hypothetical protein JCGZ_18653 [Jatropha curcas]
Length=225

 Score =   317 bits (813),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK DLE +R VPTEDAKEFAQKEGLFFLETSA+E+
Sbjct  120  DKNIVIILIGNKCDLESQRVVPTEDAKEFAQKEGLFFLETSALES  164



>ref|XP_007047879.1| RAB GTPase A4A [Theobroma cacao]
 gb|EOX92036.1| RAB GTPase A4A [Theobroma cacao]
Length=225

 Score =   317 bits (812),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRAVPTEDAKEFAQKEGLFFLETSALEA  164



>ref|XP_009591756.1| PREDICTED: ras-related protein Rab11D [Nicotiana tomentosiformis]
 dbj|BAH37015.1| NtRab11D [Nicotiana tabacum]
Length=222

 Score =   317 bits (812),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 161/165 (98%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  118  DRNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  162



>ref|XP_009802845.1| PREDICTED: ras-related protein Rab11D [Nicotiana sylvestris]
Length=222

 Score =   317 bits (812),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 161/165 (98%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  118  DRNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  162



>gb|KHN44351.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   317 bits (811),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRQVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_008235004.1| PREDICTED: ras-related protein Rab11A [Prunus mume]
Length=225

 Score =   317 bits (811),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD+  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDS-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HA
Sbjct  60   IIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R +PTEDAKEFAQKEGLFFLETSA+E+
Sbjct  120  DKNIVIILIGNKSDLENQRAIPTEDAKEFAQKEGLFFLETSALES  164



>gb|KHG10894.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=225

 Score =   317 bits (811),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++R+VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILLGNKSDLENQREVPTEDAKEFAQKEGLFFLETSALEA  164



>gb|KJB44099.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=225

 Score =   316 bits (810),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++R+VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILLGNKSDLENQREVPTEDAKEFAQKEGLFFLETSALEA  164



>ref|XP_007205846.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
 gb|EMJ07045.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
Length=225

 Score =   316 bits (810),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD+  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDS-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HA
Sbjct  60   IIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R +PTEDAKEFAQKEGLFFLETSA+E+
Sbjct  120  DKNIVIILIGNKSDLENQRVIPTEDAKEFAQKEGLFFLETSALES  164



>gb|KJB44100.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=233

 Score =   317 bits (811),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++R+VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILLGNKSDLENQREVPTEDAKEFAQKEGLFFLETSALEA  164



>gb|KHG10895.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=238

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++R+VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILLGNKSDLENQREVPTEDAKEFAQKEGLFFLETSALEA  164



>sp|Q40522.1|RB11D_TOBAC RecName: Full=Ras-related protein Rab11D [Nicotiana tabacum]
 gb|AAA74114.1| putative [Nicotiana tabacum]
Length=222

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 160/165 (97%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   AIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIMLIGNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  118  DRNIVIMLIGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  162



>gb|EPS65006.1| hypothetical protein M569_09770 [Genlisea aurea]
Length=228

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 162/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QK+DYVFKVVLIGDSAVGKSQIL+RFARNEF+LDSKATIGVEFQTRTM
Sbjct  1    MASGGGYGDAS-QKVDYVFKVVLIGDSAVGKSQILSRFARNEFTLDSKATIGVEFQTRTM  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIQHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTEDAKEFAQ+EGLFFLETSA++A
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDAKEFAQQEGLFFLETSALQA  164



>ref|XP_002307071.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|ABK93073.1| unknown [Populus trichocarpa]
 gb|EEE94067.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VPTED  EFAQKEGLFFLETSA++A
Sbjct  120  DKNIVIILIGNKSDLEDQRAVPTEDVNEFAQKEGLFFLETSALQA  164



>ref|NP_001237375.1| uncharacterized protein LOC100527786 [Glycine max]
 gb|ACU16959.1| unknown [Glycine max]
Length=223

 Score =   315 bits (806),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGSYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRQVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_006426348.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|ESR39588.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|KDO60714.1| hypothetical protein CISIN_1g027292mg [Citrus sinensis]
Length=225

 Score =   315 bits (806),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLEEQRAVPTEDAKEFAQKEGLFFLETSALEA  164



>ref|XP_002531672.1| protein with unknown function [Ricinus communis]
 gb|EEF30716.1| protein with unknown function [Ricinus communis]
Length=225

 Score =   314 bits (805),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDQS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAILVYDITKRQTFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK DLE +R VPTEDAKEFAQKEGLFFLETSA+E+
Sbjct  120  DKNIVIILVGNKCDLESQRVVPTEDAKEFAQKEGLFFLETSALES  164



>sp|Q40520.1|RB11C_TOBAC RecName: Full=Ras-related protein Rab11C [Nicotiana tabacum]
 gb|AAA74112.1| putative [Nicotiana tabacum]
Length=222

 Score =   314 bits (804),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 160/165 (97%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGDA+ QKIDYVFKVVLIGDSAVGK+QILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDAS-QKIDYVFKVVLIGDSAVGKTQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIML GNKTDLED+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  118  DRNIVIMLTGNKTDLEDQRAVPTEDAKEFAQKEGLFFLETSAMEA  162



>ref|XP_004502410.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=223

 Score =   314 bits (804),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARN+FSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNDFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRAVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_010027921.1| PREDICTED: ras-related protein Rab11A [Eucalyptus grandis]
 gb|KCW54570.1| hypothetical protein EUGRSUZ_I00531 [Eucalyptus grandis]
Length=225

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDG-NQKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQ+FDHIPRWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQSFDHIPRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNKTDLE++R VPTEDAKEFAQKEGLFFLETSA+++
Sbjct  120  DKNIVIILVGNKTDLENQRAVPTEDAKEFAQKEGLFFLETSALDS  164



>ref|XP_007163663.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
 gb|ESW35657.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
Length=223

 Score =   313 bits (802),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MAS GGYGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASAGGYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+F+HIPRWLEELR HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFNHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRQVPTEDAKEFAEKEGLFFLETSALEA  164



>gb|AFK49375.1| unknown [Medicago truncatula]
Length=225

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++RDVPTEDAKEFA+KEGLFFLETSA++A
Sbjct  120  DKNIVIILVGNKSDLENQRDVPTEDAKEFAEKEGLFFLETSALQA  164



>gb|KEH20797.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=225

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 161/165 (98%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++RDVPTEDAKEFA+KEGLFFLETSA++A
Sbjct  120  DKNIVIILVGNKSDLENQRDVPTEDAKEFAEKEGLFFLETSALQA  164



>ref|XP_006346741.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=222

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGD++ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDSS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVI+LIGNKTDL+D+R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  118  DRNIVIILIGNKTDLKDQRAVPTEDAKEFAQKEGLFFLETSAMEA  162



>gb|KJB40355.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=225

 Score =   311 bits (798),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/165 (91%), Positives = 159/165 (96%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R V TEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRAVSTEDAKEFAQKEGLFFLETSALEA  164



>ref|XP_003552040.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
 gb|KHN31388.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   311 bits (798),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 159/165 (96%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGDA  QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGRSYGDA-NQKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKS+KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HA
Sbjct  60   VIQHKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLENQRQVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_006394054.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
 gb|ESQ31340.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
Length=226

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 159/165 (96%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAM+VYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMMVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLEDQRAIPTEDAKEFAEKEGLFFLETSAFNA  164



>sp|Q40191.1|RB11A_LOTJA RecName: Full=Ras-related protein Rab11A; Flags: Precursor [Lotus 
japonicus]
 emb|CAA98177.1| RAB11A [Lotus japonicus]
Length=226

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 158/165 (96%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA   KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NAKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK DL ++RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKCDLVNQRDVPTEDAKEFAEKEGLFFLETSALEA  164



>ref|XP_006466254.1| PREDICTED: ras-related protein Rab11A-like [Citrus sinensis]
Length=225

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHI RWLEELR+HA
Sbjct  60   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHITRWLEELRSHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  120  DKNIVIILIGNKSDLEEQRAVPTEDAKEFAQKEGLFFLETSALEA  164



>ref|XP_010267206.1| PREDICTED: ras-related protein Rab11A [Nelumbo nucifera]
Length=225

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 159/165 (96%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGDA  QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDA-NQKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK DLE +R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  119  DKNIVIILIGNKCDLESQRAVPTEDAKEFAEKEGLFFLETSALEA  163



>ref|XP_010319241.1| PREDICTED: ras-related protein Rab11D-like [Solanum lycopersicum]
Length=222

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 161/165 (98%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASG  YGD++ QKIDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASG--YGDSS-QKIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKATIGVEFQTRTL  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA
Sbjct  58   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVI+LIGNKTDL+D+R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  118  DRNIVIILIGNKTDLKDQRAVPTEDAKEFAQKEGLFFLETSALEA  162



>gb|ACJ84079.1| unknown [Medicago truncatula]
Length=225

 Score =   309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+ NEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSGNEFSLDSKSTIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++RDVPTEDAKEFA+KEGLFFLETSA++A
Sbjct  120  DKNIVIILVGNKSDLENQRDVPTEDAKEFAEKEGLFFLETSALQA  164



>dbj|BAA02110.1| GTP-binding protein [Pisum sativum]
 prf||2001457C GTP-binding protein
Length=225

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 160/165 (97%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MA+ GGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MANSGGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HA
Sbjct  60   VIDHKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLE++RDVPTEDAKEFA+KEGLFFLETSA++A
Sbjct  120  DKNIVIILVGNKSDLENQRDVPTEDAKEFAEKEGLFFLETSALQA  164



>ref|XP_011097540.1| PREDICTED: ras-related protein Rab11D-like [Sesamum indicum]
Length=225

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 160/165 (97%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGDA+ QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDAS-QKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR TFDHIPRWL+ELRAHA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRTTFDHIPRWLDELRAHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNKTDL D+R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  119  DKNIVIILIGNKTDLGDQRAVPTEDAKEFAQKEGLFFLETSALEA  163



>ref|XP_009344449.1| PREDICTED: ras-related protein Rab11D [Pyrus x bretschneideri]
Length=222

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 157/161 (98%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
              YGDA+ QK+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI+H
Sbjct  2    ASYGDAS-QKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIEH  60

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  121  VIILIGNKSDLENQRAVPTEDAKEFAEKEGLFFLETSALEA  161



>gb|KFK28209.1| hypothetical protein AALP_AA8G486600 [Arabis alpina]
Length=226

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DL D+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLVDQRAIPTEDAKEFAEKEGLFFLETSAFNA  164



>ref|XP_008381984.1| PREDICTED: ras-related protein Rab11D [Malus domestica]
Length=222

 Score =   306 bits (785),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 156/161 (97%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
              YGDA+ QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI+ 
Sbjct  2    ASYGDAS-QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIEX  60

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VI+LIGNK+DLE++R VPTEDAKEFAQKEGLFFLETSA+EA
Sbjct  121  VIILIGNKSDLENQRAVPTEDAKEFAQKEGLFFLETSALEA  161



>ref|XP_004288173.1| PREDICTED: ras-related protein Rab11D [Fragaria vesca subsp. 
vesca]
Length=222

 Score =   306 bits (784),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 157/161 (98%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
              YGD++ QKIDYVFK+VLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I+H
Sbjct  2    ASYGDSS-QKIDYVFKIVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIEH  60

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNI
Sbjct  61   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNI  120

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VI+LIGNK+DLE++R VPTEDAKEFAQKEGLFFLETSA+E+
Sbjct  121  VIILIGNKSDLENQRAVPTEDAKEFAQKEGLFFLETSALES  161



>gb|AAB97114.1| small GTP-binding protein, partial [Glycine max]
Length=222

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
            GGYGDA  Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I H
Sbjct  1    GGYGDA-NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDH  59

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            K+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNI
Sbjct  60   KTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNI  119

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VI+L GNK DLE++RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  120  VIILTGNKCDLENQRDVPTEDAKEFAEKEGLFFLETSALEA  160



>ref|NP_201330.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
 sp|Q9FJN8.1|RAA4A_ARATH RecName: Full=Ras-related protein RABA4a; Short=AtRABA4a [Arabidopsis 
thaliana]
 dbj|BAB11663.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAK76621.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL85040.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAM64565.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AED98031.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
Length=226

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DL D+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLVDQRAIPTEDAKEFAEKEGLFFLETSAFNA  164



>ref|XP_010484385.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=226

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DL D+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLVDQRAIPTEDAKEFAEKEGLFFLETSAFNA  164



>ref|XP_006281052.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
 ref|XP_010444544.1| PREDICTED: ras-related protein RABA4a [Camelina sativa]
 gb|EOA13950.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
Length=226

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DL D+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLVDQRAIPTEDAKEFAEKEGLFFLETSAFNA  164



>gb|KHG08307.1| Ras-related Rab11A [Gossypium arboreum]
Length=224

 Score =   303 bits (777),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGY D   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYCDP-NQKIDYVFKVVLIGDSAVGKSQVLARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIV++LIGNK+DLE++R V TEDAK+FAQKE LFFLETSA+EA
Sbjct  120  DKNIVVILIGNKSDLENQRAVSTEDAKDFAQKEELFFLETSALEA  164



>ref|XP_002864949.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41208.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHA
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DL D+R +PTEDA+EFA+KEGLFFLETSA  A
Sbjct  120  DKNIVIILIGNKSDLVDQRAIPTEDAREFAEKEGLFFLETSAFNA  164



>ref|XP_010106271.1| Ras-related protein Rab11D [Morus notabilis]
 gb|EXC09688.1| Ras-related protein Rab11D [Morus notabilis]
Length=227

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            A QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHKSVKAQ
Sbjct  12   ASQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKAQ  71

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIG
Sbjct  72   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIG  131

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NKTDLED+R VPTEDAKEFAQKE LFFLETSA+++
Sbjct  132  NKTDLEDQRAVPTEDAKEFAQKEELFFLETSALQS  166



>gb|KJB40356.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=223

 Score =   302 bits (773),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 157/165 (95%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD   QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDP-NQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQER  AVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HA
Sbjct  60   VIEHKSVKAQIWDTAGQER--AVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R V TEDAKEFAQKEGLFFLETSA+EA
Sbjct  118  DKNIVIILIGNKSDLENQRAVSTEDAKEFAQKEGLFFLETSALEA  162



>ref|XP_010523299.1| PREDICTED: ras-related protein RABA4a-like [Tarenaya hassleriana]
Length=227

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 159/165 (96%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGD +  KIDYVFK+VLIGDSAVGKSQILAR+ARNEFSLDSK+TIGVEFQTRT+
Sbjct  1    MASGG-YGDPSA-KIDYVFKMVLIGDSAVGKSQILARYARNEFSLDSKSTIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTF+HIPRWLEELRAHA
Sbjct  59   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFEHIPRWLEELRAHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVI+LIGNK+DLED+RDVPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  119  DENIVIILIGNKSDLEDQRDVPTEDAKEFAEKEGLFFLETSALNA  163



>ref|XP_010926325.1| PREDICTED: ras-related protein Rab11D-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926326.1| PREDICTED: ras-related protein Rab11D-like isoform X2 [Elaeis 
guineensis]
Length=218

 Score =   301 bits (770),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  188  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  367
            A G+KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AGGEKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKA  62

Query  368  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  547
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRSHADKNIVIMLV  122

Query  548  GNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            GNKTDLED+R V TEDA EFAQKE LFFLETSA+EA
Sbjct  123  GNKTDLEDQRAVTTEDASEFAQKENLFFLETSALEA  158



>ref|XP_010680988.1| PREDICTED: ras-related protein Rab11D [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   301 bits (770),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 156/160 (98%), Gaps = 1/160 (1%)
 Frame = +2

Query  176  GYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHK  355
            GYGDA+ QK+DYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT++IQHK
Sbjct  3    GYGDAS-QKVDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTLVIQHK  61

Query  356  SVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIV  535
            S+KAQIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQTF+HIPRWLEELR HADKNI+
Sbjct  62   SIKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQTFEHIPRWLEELRGHADKNII  121

Query  536  IMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            IMLIGNK+DLED+R V TEDAKEFA+KEGLFFLETSA+EA
Sbjct  122  IMLIGNKSDLEDQRAVATEDAKEFAEKEGLFFLETSALEA  161



>ref|XP_010463230.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   301 bits (771),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 1/164 (1%)
 Frame = +2

Query  164  ASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTML  343
            + GGGYGD + QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++
Sbjct  3    SGGGGYGDPS-QKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLV  61

Query  344  IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD  523
            I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHAD
Sbjct  62   IDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHAD  121

Query  524  KNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            KNIVI+LIGNK+DL D+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  122  KNIVIILIGNKSDLVDQRAIPTEDAKEFAEKEGLFFLETSAFNA  165



>ref|XP_010273010.1| PREDICTED: ras-related protein Rab11A-like [Nelumbo nucifera]
Length=225

 Score =   301 bits (770),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGD + QKIDYVFKVVLIGDSAVGKSQIL+RFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDTS-QKIDYVFKVVLIGDSAVGKSQILSRFARNEFSLDSKATIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAML YDITKRQ+FDHIPRWLEELR HA
Sbjct  59   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLAYDITKRQSFDHIPRWLEELRGHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK DLE++R V TEDA+EFA+KEGLFFLETSA+EA
Sbjct  119  DKNIVIILIGNKCDLENQRAVSTEDAREFAEKEGLFFLETSALEA  163



>ref|XP_007159716.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
 gb|ESW31710.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
Length=229

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT+LI HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLLIDHKTVKAQI  73

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  133

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DLE++RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  134  KCDLENQRDVPTEDAKEFAEKEGLFFLETSALEA  167



>ref|XP_003601931.1| GTP-binding protein [Medicago truncatula]
 gb|AES72182.1| RAB GTPase-like protein A1D [Medicago truncatula]
 gb|AFK47317.1| unknown [Medicago truncatula]
Length=222

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 158/165 (96%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MAS G YGDA  QKIDYVFKVVLIGDSAVGKSQILARFARN+FS+DSKATIGVEFQTRT+
Sbjct  1    MASAG-YGDA-NQKIDYVFKVVLIGDSAVGKSQILARFARNDFSMDSKATIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I+HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR +FDHIPRWLEELR HA
Sbjct  59   VIEHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHIPRWLEELRNHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLE++R VPTEDAKEFA+KEGLFFLETSA++A
Sbjct  119  DKNIVIILIGNKSDLEEQRAVPTEDAKEFAEKEGLFFLETSALQA  163



>ref|XP_010519373.1| PREDICTED: ras-related protein RABA4a [Tarenaya hassleriana]
Length=225

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 1/163 (1%)
 Frame = +2

Query  167  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  346
            + GGYGD++  KIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I
Sbjct  2    TSGGYGDSSA-KIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVI  60

Query  347  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  526
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADK  120

Query  527  NIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NIVI+LIGNK+DLED+R V TEDAKEFA+KEGLFFLETSA+ A
Sbjct  121  NIVIILIGNKSDLEDQRAVSTEDAKEFAEKEGLFFLETSALNA  163



>ref|XP_006404948.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
 gb|ESQ46401.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
Length=225

 Score =   298 bits (764),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 155/161 (96%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
            GGYG A G K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ 
Sbjct  3    GGYGGATG-KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEE  61

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNI
Sbjct  62   KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNI  121

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VI+LIGNK+DLED+R +PTEDAKEFA+KEGLFFLETSA+ A
Sbjct  122  VIILIGNKSDLEDQRAIPTEDAKEFAEKEGLFFLETSALNA  162



>gb|KHN29041.1| Ras-related protein Rab11A [Glycine soja]
Length=227

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  12   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  71

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  72   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  131

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DLE +RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  132  KCDLESQRDVPTEDAKEFAEKEGLFFLETSALEA  165



>ref|XP_003532818.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
Length=209

 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  12   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  71

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGN
Sbjct  72   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGN  131

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DLE +RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  132  KCDLESQRDVPTEDAKEFAEKEGLFFLETSALEA  165



>gb|KFK25337.1| hypothetical protein AALP_AA8G099600 [Arabis alpina]
Length=222

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HA
Sbjct  60   VLDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R +  EDAKEFA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISIEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_006827843.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
 gb|ERM95259.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
Length=221

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
              QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHK+VKAQ
Sbjct  5    PSQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKTVKAQ  64

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+PRWLEELR HADKNIVI+LIG
Sbjct  65   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVPRWLEELRGHADKNIVIILIG  124

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLED+R VP EDA+EFAQKEGLFFLETSA+E+
Sbjct  125  NKSDLEDQRVVPAEDAREFAQKEGLFFLETSALES  159



>ref|XP_004504100.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=227

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            A Q+IDYVFKVVLIGDSAVGKSQILARF+RNEFSLDSK+TIGVEFQTRT++I HK+VKAQ
Sbjct  11   ANQRIDYVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQ  70

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L G
Sbjct  71   IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILAG  130

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLE++RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  131  NKSDLENQRDVPTEDAKEFAEKEGLFFLETSALEA  165



>ref|XP_010453062.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=229

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 157/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R + TEDA+EFA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISTEDAQEFAEKEGLFFLETSALNA  164



>ref|XP_003525046.1| PREDICTED: ras-related protein Rab11A [Glycine max]
 gb|KHN06562.1| Ras-related protein Rab11A [Glycine soja]
Length=229

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  73

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGN  133

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DLE++RDVPTEDAKEFA+KEGLFFLETSA+EA
Sbjct  134  KCDLENQRDVPTEDAKEFAEKEGLFFLETSALEA  167



>ref|XP_010917311.1| PREDICTED: ras-related protein Rab11D-like [Elaeis guineensis]
Length=218

 Score =   296 bits (758),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  188  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  367
            A G+KIDYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AVGEKIDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTLVIQHKSVKA  62

Query  368  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  547
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKRQ+FDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRQSFDHIPRWLEELRSHADKNIVIMLV  122

Query  548  GNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            GNK+DLED+R V TEDA EFAQKE LFFLETSA+EA
Sbjct  123  GNKSDLEDQRAVSTEDASEFAQKENLFFLETSALEA  158



>ref|XP_010422850.1| PREDICTED: ras-related protein RABA4a-like isoform X1 [Camelina 
sativa]
Length=228

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R + TEDAK FA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISTEDAKGFAEKEGLFFLETSALNA  164



>ref|XP_009390909.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 6/165 (4%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MA GG       +KIDYVFKVVLIGDSAVGKSQILARFAR+EFSLDSKATIGVEFQTRT+
Sbjct  1    MAGGGS------EKIDYVFKVVLIGDSAVGKSQILARFARDEFSLDSKATIGVEFQTRTL  54

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDHIPRWLEELR+HA
Sbjct  55   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDVTKRQSFDHIPRWLEELRSHA  114

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIML+GNKTDLED+R V TEDA+EFAQKE LFFLETSA+EA
Sbjct  115  DRNIVIMLVGNKTDLEDQRAVTTEDAREFAQKENLFFLETSALEA  159



>ref|XP_002871417.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47676.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR +A
Sbjct  60   VIDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRNNA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R +  EDAK+FA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISMEDAKDFAEKEGLFFLETSALNA  164



>ref|XP_010491702.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   295 bits (754),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M SGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MTSGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R +  EDAKEFA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISMEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_009112174.1| PREDICTED: ras-related protein RABA4a [Brassica rapa]
 emb|CDY18682.1| BnaA09g07130D [Brassica napus]
Length=225

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I HKSVKAQI
Sbjct  13   SQKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQI  72

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGN
Sbjct  73   WDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGN  132

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLED+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  133  KSDLEDQRAIPTEDAKEFAEKEGLFFLETSAFNA  166



>emb|CDX81274.1| BnaC09g06850D [Brassica napus]
Length=227

 Score =   294 bits (753),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQILAR+AR+EFSLDSKATIGVEFQTRT++I HKSVKAQI
Sbjct  15   SQKIDYVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQI  74

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGN
Sbjct  75   WDTAGQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGN  134

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLED+R +PTEDAKEFA+KEGLFFLETSA  A
Sbjct  135  KSDLEDQRAIPTEDAKEFAEKEGLFFLETSAFNA  168



>gb|ABK22282.1| unknown [Picea sitchensis]
Length=219

 Score =   293 bits (751),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            KIDYVFKVVLIGDSAVGKSQIL+RFAR+EFSLDSKATIGVEFQTRT++I+HKSVKAQIWD
Sbjct  6    KIDYVFKVVLIGDSAVGKSQILSRFARDEFSLDSKATIGVEFQTRTVVIEHKSVKAQIWD  65

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+PRWLEELR HAD NIVIML+GNK 
Sbjct  66   TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVPRWLEELRNHADNNIVIMLVGNKC  125

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DL++ R VPTEDAKEFAQKEGLFFLETSAMEA
Sbjct  126  DLDNLRAVPTEDAKEFAQKEGLFFLETSAMEA  157



>gb|ACU16457.1| unknown [Glycine max]
Length=229

 Score =   293 bits (751),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q+IDYVFKVVLIGDSAVGKSQILARFARNEFSLDSK+TIGVEFQTRT++I HK+VKAQI
Sbjct  14   NQRIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQI  73

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GN
Sbjct  74   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGN  133

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DLE++RDVPT DAKEFA+KEGLFFLETSA+EA
Sbjct  134  KCDLENQRDVPTGDAKEFAEKEGLFFLETSALEA  167



>ref|XP_008782165.1| PREDICTED: ras-related protein Rab11D-like [Phoenix dactylifera]
Length=218

 Score =   293 bits (750),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  188  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  367
            A G+KIDYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT++IQHKSVKA
Sbjct  3    AGGEKIDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLVIQHKSVKA  62

Query  368  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  547
            QIWDTAGQERYRAVTSAYYRGAVGA+LVYDITKR +FDHIPRWLEELR+HADKNIVIML+
Sbjct  63   QIWDTAGQERYRAVTSAYYRGAVGALLVYDITKRPSFDHIPRWLEELRSHADKNIVIMLV  122

Query  548  GNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            GNK+DLED+R V TEDA EFA+KE LFFLETSA+EA
Sbjct  123  GNKSDLEDQRAVSTEDATEFAEKENLFFLETSALEA  158



>ref|XP_006290108.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
 gb|EOA23006.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
Length=226

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 156/165 (95%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T++QTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRQQTFDHIPRWLEELRNHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R +  +DAKEFA+KEGLFFLETSA+ A
Sbjct  120  DKNIVIILVGNKSDLEDQRAISMDDAKEFAEKEGLFFLETSALNA  164



>ref|XP_006404694.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
 gb|ESQ46147.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
Length=227

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MA GGGY  A+  K+DYVFKVVLIGDSAVGKSQ+LARF R+EFS+DSKATIGVEFQTRT+
Sbjct  1    MAGGGGYNGASPGKVDYVFKVVLIGDSAVGKSQLLARFTRDEFSMDSKATIGVEFQTRTL  60

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +I  KS+KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR++FDHIPRWLEELRAHA
Sbjct  61   VIDEKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRESFDHIPRWLEELRAHA  120

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R VP EDAKEFA+KE LFFLETSA+ +
Sbjct  121  DKNIVIILIGNKSDLEDQRSVPMEDAKEFAEKEELFFLETSALNS  165



>ref|NP_001064476.1| Os10g0377400 [Oryza sativa Japonica Group]
 gb|ABB47387.1| Ras-related protein Rab11D, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26390.1| Os10g0377400 [Oryza sativa Japonica Group]
 dbj|BAG99455.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC66844.1| hypothetical protein OsI_33317 [Oryza sativa Indica Group]
 gb|EEE50861.1| hypothetical protein OsJ_31310 [Oryza sativa Japonica Group]
Length=216

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  188  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  367
            A G+K+DYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT+LI HKSVKA
Sbjct  2    AGGEKVDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLLIDHKSVKA  61

Query  368  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  547
            QIWDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+
Sbjct  62   QIWDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLV  121

Query  548  GNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            GNK+DLED R V TEDAKEFA+KE LFFLETSA++A
Sbjct  122  GNKSDLEDERAVSTEDAKEFAEKENLFFLETSALQA  157



>ref|XP_009393549.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 151/165 (92%), Gaps = 6/165 (4%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MA GG        KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MAGGGS------DKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTL  54

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            +IQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGA++VYDIT+RQ FDHIPRWLEELR+HA
Sbjct  55   VIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGALIVYDITRRQCFDHIPRWLEELRSHA  114

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIML+GNKTDLE +R VP EDA+EFAQKE LFFLETSA++A
Sbjct  115  DKNIVIMLVGNKTDLEGQRAVPMEDAREFAQKENLFFLETSALDA  159



>ref|XP_009122063.1| PREDICTED: ras-related protein RABA4a-like [Brassica rapa]
 gb|AAZ67615.1| 80A08_30 [Brassica rapa subsp. pekinensis]
 emb|CDX96994.1| BnaC09g46310D [Brassica napus]
Length=223

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 1/163 (1%)
 Frame = +2

Query  167  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  346
            S GGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+++
Sbjct  2    SSGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTLVM  60

Query  347  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  526
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADK  120

Query  527  NIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NIVI+L+GNK+DLED+R + TEDAKEFA+ EGLFFLETSA+ A
Sbjct  121  NIVIILVGNKSDLEDQRAISTEDAKEFAETEGLFFLETSALNA  163



>emb|CDX69843.1| BnaA10g21920D [Brassica napus]
Length=223

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 1/163 (1%)
 Frame = +2

Query  167  SGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLI  346
            S GGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+++
Sbjct  2    SSGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTLVM  60

Query  347  QHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADK  526
             HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADK
Sbjct  61   DHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADK  120

Query  527  NIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NIVI+L+GNK+DLED+R + TEDAKEFA+ EGLFFLETSA+ A
Sbjct  121  NIVIILVGNKSDLEDQRAISTEDAKEFAETEGLFFLETSALNA  163



>ref|XP_003573862.1| PREDICTED: ras-related protein Rab11D-like [Brachypodium distachyon]
Length=216

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  188  AAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKA  367
            A G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT+LI HKSVKA
Sbjct  2    AGGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLLIDHKSVKA  61

Query  368  QIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLI  547
            QIWDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+
Sbjct  62   QIWDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLV  121

Query  548  GNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            GNK+DLED R V TEDAKEFA+KE +FFLETSA++A
Sbjct  122  GNKSDLEDERAVSTEDAKEFAEKENVFFLETSALQA  157



>ref|XP_006399529.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
 gb|ESQ40982.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
Length=225

 Score =   291 bits (745),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGG YGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFS+DSKATIGVEFQTRT+
Sbjct  1    MASGG-YGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSMDSKATIGVEFQTRTL  58

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HA
Sbjct  59   VMDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHA  118

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+LIGNK+DLED+R +  EDAKEFA+KEGLFFLETSA+ A
Sbjct  119  DKNIVIILIGNKSDLEDQRAISMEDAKEFAEKEGLFFLETSALNA  163



>ref|NP_001149604.1| LOC100283230 [Zea mays]
 ref|XP_008643733.1| PREDICTED: LOC100283230 isoform X1 [Zea mays]
 gb|ACG36036.1| ras-related protein Rab11D [Zea mays]
 gb|ACN35232.1| unknown [Zea mays]
 gb|AFW68869.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I+HKSVKAQI
Sbjct  5    GDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIEHKSVKAQI  64

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  65   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  124

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLED R V TEDAKEFA+KE LFFLETSA++A
Sbjct  125  KSDLEDERAVSTEDAKEFAEKENLFFLETSALQA  158



>ref|XP_009129562.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
 ref|XP_009129608.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
Length=223

 Score =   291 bits (744),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R +PTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAIPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_006662306.1| PREDICTED: ras-related protein Rab11D-like [Oryza brachyantha]
Length=214

 Score =   290 bits (742),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            G+K+DYVFKVVLIGDSAVGKSQILARFARNEFS+DSKATIGVEFQTRT++I HKSVKAQI
Sbjct  2    GKKVDYVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLIIDHKSVKAQI  61

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  62   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  121

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLED R V TEDAKEFA+KE LFFLETSA++A
Sbjct  122  KSDLEDERAVSTEDAKEFAEKENLFFLETSALQA  155



>ref|XP_009413627.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++IQHKSVKAQIWD
Sbjct  7    KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKAQIWD  66

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGA++VYDIT+RQ+FDHI RWLEELR+HAD+NIVIML+GNKT
Sbjct  67   TAGQERYRAVTSAYYRGAVGALMVYDITRRQSFDHISRWLEELRSHADRNIVIMLVGNKT  126

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R V TEDA+EFAQKE LFFLETSA+EA
Sbjct  127  DLEDQRAVTTEDAREFAQKENLFFLETSALEA  158



>emb|CDP07731.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  170  GGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQ  349
            GGG G    QKIDYVFK+VLIGDS+VGKSQ+LARF+RNEFSLDSKATIGVEFQTRT++I 
Sbjct  6    GGGGGANLNQKIDYVFKIVLIGDSSVGKSQLLARFSRNEFSLDSKATIGVEFQTRTVVID  65

Query  350  HKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKN  529
            HK+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKN
Sbjct  66   HKTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKN  125

Query  530  IVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            IVIML+GNKTDLE  RDV T+DAKEFAQKE L+F+ETSA+EA
Sbjct  126  IVIMLVGNKTDLESLRDVSTDDAKEFAQKENLYFMETSALEA  167



>ref|XP_004985399.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            AG+K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGEKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLE++R V TEDAKEFA+KE LFFLETSA++A
Sbjct  124  NKSDLEEQRAVSTEDAKEFAEKENLFFLETSALQA  158



>gb|KFK30576.1| hypothetical protein AALP_AA7G279800 [Arabis alpina]
Length=223

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIESKSVKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R +P EDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAIPIEDAKEFAEKEGLFFLETSALNA  164



>ref|NP_001151560.1| ras-related protein Rab11D [Zea mays]
 gb|ACF88435.1| unknown [Zea mays]
 gb|ACG43327.1| ras-related protein Rab11D [Zea mays]
 tpg|DAA43812.1| TPA: Ras protein Rab11D [Zea mays]
Length=217

 Score =   288 bits (738),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLE++R V TEDAKEFA+KE LFFLETSA++A
Sbjct  124  NKSDLEEQRAVSTEDAKEFAEKENLFFLETSALQA  158



>ref|XP_002465727.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
 gb|EER92725.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
Length=217

 Score =   288 bits (737),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLE++R V TEDAKEFA+KE LFFLETSA++A
Sbjct  124  NKSDLEEQRAVSTEDAKEFAEKENLFFLETSALQA  158



>ref|NP_001151068.1| ras-related protein Rab11D [Zea mays]
 ref|NP_001152898.1| uncharacterized protein LOC100272235 [Zea mays]
 gb|ACF82205.1| unknown [Zea mays]
 gb|ACG41502.1| ras-related protein Rab11D [Zea mays]
 gb|AFW89417.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   288 bits (737),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  191  AGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQ  370
            AG K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I H+SVKAQ
Sbjct  4    AGDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHRSVKAQ  63

Query  371  IWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIG  550
            IWDTAGQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+G
Sbjct  64   IWDTAGQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVG  123

Query  551  NKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            NK+DLE++R V TEDAKEFA+KE LFFLETSA++A
Sbjct  124  NKSDLEEQRAVSTEDAKEFAEKENLFFLETSALQA  158



>dbj|BAJ93377.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   288 bits (737),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            +K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQIW
Sbjct  5    EKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQIW  64

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNI+IML+GNK
Sbjct  65   DTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIIIMLVGNK  124

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DLED R V TEDAKEFA+KE LFFLETSA++A
Sbjct  125  SDLEDERAVSTEDAKEFAEKENLFFLETSALQA  157



>ref|XP_010555372.1| PREDICTED: ras-related protein RABA4b [Tarenaya hassleriana]
Length=224

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I HKSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIDHKSVKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TF+HIPRWLEELRAHADKNIVI+L+GNKT
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFEHIPRWLEELRAHADKNIVIILVGNKT  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDA+EFA+KE LFFLETSA+ A
Sbjct  133  DLEDQRSVPTEDAREFAEKERLFFLETSALNA  164



>ref|XP_010437126.1| PREDICTED: ras-related protein RABA4b [Camelina sativa]
Length=227

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_010446581.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_006284416.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
 gb|EOA17314.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
Length=250

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  36   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  95

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  96   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  155

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  156  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  187



>ref|XP_003577923.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
 ref|XP_010238009.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
Length=226

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GGGYG+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MSRGGGYGEV-GQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             +  +++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELRAHA
Sbjct  60   QVDQRTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMARWLEELRAHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKN+VIMLIGNK+DL   R VPTEDAKEFA +E LFF+ETSA+EA
Sbjct  120  DKNLVIMLIGNKSDLGTLRVVPTEDAKEFAARESLFFMETSALEA  164



>gb|AAA87884.1| ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_010431983.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDS+VGKSQ+LARFAR+EFS+DSKATIGVEFQTRT++I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSSVGKSQLLARFARDEFSMDSKATIGVEFQTRTLVIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_002489255.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
 gb|EES20260.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
Length=217

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            G K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQI
Sbjct  5    GDKVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQI  64

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GN
Sbjct  65   WDTAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGN  124

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLE+ R V +EDAKEFA+KE LFFLETSA++A
Sbjct  125  KSDLEEERAVSSEDAKEFAEKENLFFLETSALQA  158



>gb|ABK25126.1| unknown [Picea sitchensis]
Length=224

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
            G YGD  G +IDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT++I H
Sbjct  3    GSYGDY-GPRIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLVIDH  61

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            K+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HAD NI
Sbjct  62   KTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADNNI  121

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            VIMLIGNK DL + R VP EDA+EFAQ+EGLFFLETSA+EA
Sbjct  122  VIMLIGNKCDLGNLRAVPIEDAREFAQREGLFFLETSALEA  162



>gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis thaliana]
Length=224

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_002866902.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43161.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|NP_195709.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
 sp|Q9SMQ6.1|RAA4B_ARATH RecName: Full=Ras-related protein RABA4b; Short=AtRABA4b; AltName: 
Full=Ras-related protein GB3; Short=AtGB3; AltName: Full=Ras-related 
protein Rab11G; Short=AtRab11G [Arabidopsis thaliana]
 emb|CAB38912.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 emb|CAB80662.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAL62440.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAM91314.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AEE87150.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFS+DSKATIGVEFQTRT+ I+ KS+KAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R VPTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAVPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_004983071.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   286 bits (732),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT++I HKSVKAQIWD
Sbjct  7    KVDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWD  66

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+
Sbjct  67   TAGQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKS  126

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLE+ R V TEDAKEFA+KE LFFLETSA++A
Sbjct  127  DLEEERAVSTEDAKEFAEKENLFFLETSALQA  158



>emb|CDY69836.1| BnaAnng31680D [Brassica napus]
Length=224

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 148/153 (97%), Gaps = 1/153 (1%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  380  TAGQE-RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            TAGQE RYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK
Sbjct  73   TAGQESRYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNK  132

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DLED+R +PTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  SDLEDQRAIPTEDAKEFAEKEGLFFLETSALNA  165



>emb|CDX69369.1| BnaC01g00840D [Brassica napus]
Length=408

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            K+DYVFKVVLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQTRT+ I+ KSVKAQIWD
Sbjct  13   KVDYVFKVVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTRTLTIEEKSVKAQIWD  72

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+
Sbjct  73   TAGQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKS  132

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DLED+R +PTEDAKEFA+KEGLFFLETSA+ A
Sbjct  133  DLEDQRAIPTEDAKEFAEKEGLFFLETSALNA  164



>ref|XP_010422851.1| PREDICTED: ras-related protein RABA4a-like isoform X2 [Camelina 
sativa]
Length=226

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 154/165 (93%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQER  AVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQER--AVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R + TEDAK FA+KEGLFFLETSA+ A
Sbjct  118  DKNIVIILVGNKSDLEDQRAISTEDAKGFAEKEGLFFLETSALNA  162



>ref|XP_009799541.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
 ref|XP_009799542.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
Length=225

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLDIDHKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNKTDL   R VPTEDAKEFA+KE LFF+ETSA+EA
Sbjct  125  MLVGNKTDLGSLRAVPTEDAKEFAEKENLFFIETSALEA  163



>ref|XP_006660497.1| PREDICTED: ras-related protein RGP1-like [Oryza brachyantha]
Length=226

 Score =   285 bits (728),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GG YG+  GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSYGEV-GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   QIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVTRWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNK+DL   R VPTEDAKEFA++E LFF+ETSA+E+
Sbjct  120  DKNIVIMLIGNKSDLGTLRVVPTEDAKEFAERESLFFMETSALES  164



>ref|XP_009612391.1| PREDICTED: ras-related protein RGP1-like [Nicotiana tomentosiformis]
Length=225

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+LDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFNLDSKATIGVEFQTRTLDIDHKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNKTDL   R VPTEDAKEFA+KE LFF+ETSA+EA
Sbjct  125  MLVGNKTDLVSLRAVPTEDAKEFAEKENLFFIETSALEA  163



>ref|XP_006366509.1| PREDICTED: ras-related protein RGP1-like [Solanum tuberosum]
Length=226

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFK VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGGDFNQKIDYVFKAVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLEIDHKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNKTDL   R VPTEDAKEFA+KE LFF+ETSA+EA
Sbjct  125  MLVGNKTDLGSLRAVPTEDAKEFAEKENLFFIETSALEA  163



>gb|KJB18227.1| hypothetical protein B456_003G040900 [Gossypium raimondii]
Length=223

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QK+DYVFKVVLIGDS VGKSQILARFARN+FSLDSK+TIGVEFQTRT+LI+HKSVKAQIW
Sbjct  8    QKVDYVFKVVLIGDSGVGKSQILARFARNDFSLDSKSTIGVEFQTRTLLIEHKSVKAQIW  67

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK
Sbjct  68   DTAGQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNK  127

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DLE +R+V TEDA EFAQKEGLFFLETSA+ A
Sbjct  128  SDLEKQREVSTEDATEFAQKEGLFFLETSALAA  160



>gb|KHG00253.1| Ras-related Rab11A [Gossypium arboreum]
Length=223

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QK+DYVFKVVLIGDS VGKSQILARFARN+FSLDSK+TIGVEFQTRT+LI+HKSVKAQIW
Sbjct  8    QKVDYVFKVVLIGDSGVGKSQILARFARNDFSLDSKSTIGVEFQTRTLLIEHKSVKAQIW  67

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK
Sbjct  68   DTAGQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNK  127

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DLE +R+V TEDA EFAQKEGLFFLETSA+ A
Sbjct  128  SDLEKQREVSTEDATEFAQKEGLFFLETSALAA  160



>ref|XP_010265793.1| PREDICTED: ras-related protein RGP1-like [Nelumbo nucifera]
Length=223

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LAR+ARNEFSLDSKATIGVEFQTRT++I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARYARNEFSLDSKATIGVEFQTRTLVIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVTRWLDELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VPTEDAKEFAQ E LFF+ETSA+EA
Sbjct  124  MLIGNKSDLSTLRTVPTEDAKEFAQSENLFFMETSALEA  162



>ref|XP_010067891.1| PREDICTED: ras-related protein RABA4c-like [Eucalyptus grandis]
 gb|KCW66128.1| hypothetical protein EUGRSUZ_G03398 [Eucalyptus grandis]
Length=224

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             Q IDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+LI HK++KAQI
Sbjct  9    NQNIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQ+E LFF+ETSA+EA
Sbjct  129  KSDLGTLRAVPTEDAKEFAQRENLFFMETSALEA  162



>ref|XP_010102630.1| Ras-related protein RGP1 [Morus notabilis]
 gb|EXB93780.1| Ras-related protein RGP1 [Morus notabilis]
Length=224

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+LI HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLLIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQ+E LFF+ETSA+E+
Sbjct  129  KSDLGTLRAVPTEDAKEFAQRENLFFMETSALES  162



>sp|P25766.2|RLGP1_ORYSJ RecName: Full=Ras-related protein RGP1; AltName: Full=GTP-binding 
regulatory protein RGP1 [Oryza sativa Japonica Group]
 dbj|BAD29646.1| putative ras-related GTP-binding protein [Oryza sativa Japonica 
Group]
 gb|EEE69346.1| hypothetical protein OsJ_28668 [Oryza sativa Japonica Group]
Length=226

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GGG     GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGGSYGEVGQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  60

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  61   HIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  120

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNK+DL   R VPTEDAKEFA++E LFF+ETSA+E+
Sbjct  121  DKNIVIMLIGNKSDLGTLRVVPTEDAKEFAERENLFFMETSALES  165



>ref|XP_002298447.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE83252.1| GTP-binding family protein [Populus trichocarpa]
Length=225

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+VKAQI
Sbjct  10   NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLVIDHKTVKAQI  69

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGN  129

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQKE LFF+ETSA+EA
Sbjct  130  KSDLGTLRAVPTEDAKEFAQKENLFFMETSALEA  163



>ref|XP_010928849.1| PREDICTED: ras-related protein RGP1 [Elaeis guineensis]
Length=225

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLTIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHVTRWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VPTEDAKEFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKSDLGTLRAVPTEDAKEFAQRENLFFMETSALEA  162



>ref|XP_011025048.1| PREDICTED: ras-related protein RABA4d [Populus euphratica]
Length=225

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+VKAQI
Sbjct  10   NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLVIDHKTVKAQI  69

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGN  129

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQKE LFF+ETSA+EA
Sbjct  130  KSDLGTLRAVPTEDAKEFAQKENLFFMETSALEA  163



>ref|XP_011087327.1| PREDICTED: ras-related protein RGP1 [Sesamum indicum]
Length=224

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            +G     KIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDS++TIGVEFQTRT++I HKS
Sbjct  5    HGGDFSNKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSRSTIGVEFQTRTLMIDHKS  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK+DLE  R V TEDAK+FAQ+E LFF+ETSA+EA
Sbjct  125  MLVGNKSDLESHRSVTTEDAKDFAQRENLFFMETSALEA  163



>ref|XP_008787280.1| PREDICTED: ras-related protein RGP1 [Phoenix dactylifera]
Length=224

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLTIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R +PTEDAKEFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKSDLGTLRAIPTEDAKEFAQRENLFFMETSALEA  162



>ref|XP_002513185.1| protein with unknown function [Ricinus communis]
 gb|EEF49176.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+++ HK+VKAQI
Sbjct  9    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTIVVDHKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELREHADNNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DLE  R VP EDAKEFAQKE LFF+ETSA+EA
Sbjct  129  KSDLESLRAVPIEDAKEFAQKENLFFMETSALEA  162



>ref|XP_004229604.1| PREDICTED: ras-related protein RGP1 [Solanum lycopersicum]
Length=225

 Score =   280 bits (717),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFK VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT+ I +K+
Sbjct  5    YGGDFNQKIDYVFKAVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTLEIDNKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNKTDL   R VPTEDAKEFA+KE LFF+ETSA+E+
Sbjct  125  MLVGNKTDLGSLRAVPTEDAKEFAEKENLFFIETSALES  163



>gb|EYU27083.1| hypothetical protein MIMGU_mgv1a013266mg [Erythranthe guttata]
Length=225

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG   G KIDYVFK+VLIGDSAVGKSQ+LARF+RNEFSLDSKATIGVEFQTRT  I HK+
Sbjct  5    YGGDFGNKIDYVFKIVLIGDSAVGKSQLLARFSRNEFSLDSKATIGVEFQTRTTTIDHKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR+HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRSHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK+DL   R V TEDAK+FAQ+E LFF+ETSA+EA
Sbjct  125  MLVGNKSDLGTLRAVSTEDAKDFAQRENLFFMETSALEA  163



>ref|XP_002459958.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
 gb|EER96479.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
Length=226

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GG +G+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNK+DL   R V TEDAKEFA++E LFF+ETSA+EA
Sbjct  120  DKNIVIMLIGNKSDLGTLRSVATEDAKEFAERENLFFMETSALEA  164



>gb|EMT23732.1| Ras-related protein RGP1 [Aegilops tauschii]
Length=217

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+ I +++VKAQI
Sbjct  2    GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLQIDNRTVKAQI  61

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVIMLIGN
Sbjct  62   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVIMLIGN  121

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFA++E LFF+ETSA+EA
Sbjct  122  KSDLGTLRAVPTEDAKEFAERESLFFMETSALEA  155



>ref|XP_004956465.1| PREDICTED: ras-related protein RGP1-like [Setaria italica]
Length=222

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            GQKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQTRT+ I  ++VKAQI
Sbjct  7    GQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLTIDKRTVKAQI  66

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  67   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVVRWLEELRGHADKNIVIMLIGN  126

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFA++E LFF+ETSA+EA
Sbjct  127  KSDLGTLRAVPTEDAKEFAERENLFFMETSALEA  160



>ref|XP_008240816.1| PREDICTED: ras-related protein RABA4d [Prunus mume]
Length=222

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_006421492.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 ref|XP_006490035.1| PREDICTED: ras-related protein RABA4d-like [Citrus sinensis]
 gb|ESR34732.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 gb|KDO57267.1| hypothetical protein CISIN_1g027382mg [Citrus sinensis]
Length=224

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T+ I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLSIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLDELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_009399667.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  161  MASGG-GYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRT  337
            M+SG   Y     QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT
Sbjct  1    MSSGSRNYYGEFNQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSVDSKATIGVEFQTRT  60

Query  338  MLIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAH  517
            + I  K++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR H
Sbjct  61   LTIDSKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGH  120

Query  518  ADKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            AD+NIVIMLIGNK+DL   R VPTEDAKEFAQ+E LFF+ETSA+E+
Sbjct  121  ADRNIVIMLIGNKSDLGSLRAVPTEDAKEFAQRESLFFMETSALES  166



>gb|KHG15141.1| Ras-related RABA4c -like protein [Gossypium arboreum]
 gb|KJB25042.1| hypothetical protein B456_004G174200 [Gossypium raimondii]
Length=229

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+L+RF RNEF++DSKATIGVEFQT+T+LI HKSVKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLSRFTRNEFNIDSKATIGVEFQTKTLLIDHKSVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRGHADKNIVIMLVGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  130  SDLASLRAVPIEDAKEFAQRESLFFMETSALEA  162



>ref|XP_007204003.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
 gb|EMJ05202.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
Length=222

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_010913931.1| PREDICTED: ras-related protein RGP1-like [Elaeis guineensis]
Length=224

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQTRT+ I HK+
Sbjct  5    YGEF-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTRTLAIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VPTEDAKEFAQ+E L F+ETSA+EA
Sbjct  124  MLIGNKSDLGTLRAVPTEDAKEFAQRENLCFMETSALEA  162



>ref|XP_002863846.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40105.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=223

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_007028923.1| RAB GTPase A4D [Theobroma cacao]
 gb|EOY09425.1| RAB GTPase A4D [Theobroma cacao]
Length=222

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T+ I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLAIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_002264293.1| PREDICTED: ras-related protein RGP1 [Vitis vinifera]
 emb|CBI24856.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T++I HK+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLVIDHKTVKAQIW  70

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWL+ELR HADKNIVIML+GNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLQELRGHADKNIVIMLVGNK  130

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL   + VPTEDAKEFA++E LFF+ETSA+EA
Sbjct  131  SDLGTLQAVPTEDAKEFAERENLFFMETSALEA  163



>tpg|DAA39806.1| TPA: ras protein RGP1 [Zea mays]
Length=226

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GG +G+  GQ+IDYVFKVVLIGDSAVGKSQ+LARFARN+F+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAVGKSQLLARFARNQFNLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARNVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIML+GNK+DL   R VP EDAKEFA++E LFF+ETSA+EA
Sbjct  120  DKNIVIMLMGNKSDLGTLRAVPIEDAKEFAERENLFFMETSALEA  164



>ref|XP_010257365.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257366.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257367.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
Length=223

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LAR+ARNEFSLDSKATIGVEFQTRT++I HK+VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARYARNEFSLDSKATIGVEFQTRTLVIDHKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WL+ELR+HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVAKWLDELRSHADKNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP EDAK+FAQ E LFF+ETSA+EA
Sbjct  129  KSDLSTLRTVPIEDAKDFAQSESLFFMETSALEA  162



>gb|EYU39898.1| hypothetical protein MIMGU_mgv1a020125mg [Erythranthe guttata]
Length=225

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T+LI HK+
Sbjct  5    YGGDFNQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLLIDHKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VPTEDA+EFA++E L+F+ETSA++A
Sbjct  125  MLIGNKSDLGTLRAVPTEDAQEFAERENLYFMETSALQA  163



>ref|XP_010695403.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=229

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT++I +K+VK+QIW
Sbjct  14   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIDSKATIGVEFQTRTLVIDNKTVKSQIW  73

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVI+LIGNK
Sbjct  74   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVSRWLEELRGHADKNIVIILIGNK  133

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R V  EDAKEFA++EGLFFLETSA+EA
Sbjct  134  TDLGSLRAVSLEDAKEFAEREGLFFLETSALEA  166



>ref|XP_006395225.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
 gb|ESQ32511.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
Length=223

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDKKTVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_010057727.1| PREDICTED: ras-related protein RABA4d [Eucalyptus grandis]
 gb|KCW90273.1| hypothetical protein EUGRSUZ_A02418 [Eucalyptus grandis]
Length=221

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 148/159 (93%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFS++SKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSVESKATIGVEFQTKTLVIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK+DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLVGNKSDLGSLRAVPTEDAQEFAQRESLFFMETSALEA  162



>gb|KDP43443.1| hypothetical protein JCGZ_16730 [Jatropha curcas]
Length=226

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            Q+IDYVFKVVLIGDSAVGKSQ+LARF RNEFSL+SKATIGVEFQT+T++I HK+VKAQIW
Sbjct  10   QQIDYVFKVVLIGDSAVGKSQLLARFTRNEFSLESKATIGVEFQTKTIVIDHKTVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HAD NIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELREHADSNIVIMLVGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL   R VPTEDAKEFAQKE LFF+ETSA+EA
Sbjct  130  SDLGTLRAVPTEDAKEFAQKESLFFMETSALEA  162



>ref|XP_010439146.1| PREDICTED: ras-related protein RABA4c [Camelina sativa]
Length=223

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGSLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_010442212.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGSLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_008461787.1| PREDICTED: ras-related protein RABA4c [Cucumis melo]
Length=222

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLEELRGHADKNIVIMLIGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQ E LFF+ETSA+EA
Sbjct  129  KSDLGSLRVVPTEDAKEFAQMENLFFMETSALEA  162



>ref|XP_006438973.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
 ref|XP_006482913.1| PREDICTED: ras-related protein RABA4c-like [Citrus sinensis]
 gb|ESR52213.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
Length=226

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 148/161 (92%), Gaps = 4/161 (2%)
 Frame = +2

Query  173  GGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQH  352
            G Y +    KIDYVFK+VLIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQT+T++I H
Sbjct  7    GNYNN----KIDYVFKIVLIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTKTVVIHH  62

Query  353  KSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNI  532
            K+VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FD++ RWLEELR HADKNI
Sbjct  63   KNVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDNVARWLEELRGHADKNI  122

Query  533  VIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +IML+GNK+DLE  R VPTEDAKEFA+KEGL F+ETSA+E+
Sbjct  123  IIMLVGNKSDLETLRAVPTEDAKEFAEKEGLCFMETSALES  163



>ref|XP_006850119.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
 gb|ERN11700.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
Length=223

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 148/159 (93%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+
Sbjct  5    YGDF-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTIVIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIV+
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVV  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK+DL   R VPT+DAKEFA++E LFF+ETSA+EA
Sbjct  124  MLVGNKSDLGTLRAVPTDDAKEFAERENLFFMETSALEA  162



>ref|XP_006281058.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
 gb|EOA13956.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
Length=224

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  70

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEEL+ HADKNIVIMLIGNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELKGHADKNIVIMLIGNK  130

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  131  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  163



>emb|CDX86332.1| BnaA06g30490D [Brassica napus]
Length=223

 Score =   276 bits (705),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_009151604.1| PREDICTED: ras-related protein RABA4c [Brassica rapa]
Length=223

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K+VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            KTDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  129  KTDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|NP_187823.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 ref|XP_002884891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006298501.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 ref|XP_006407359.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 ref|XP_010498677.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 ref|XP_010464965.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 sp|Q9LH50.1|RAA4D_ARATH RecName: Full=Ras-related protein RABA4d; Short=AtRABA4d [Arabidopsis 
thaliana]
 gb|AAG51065.1|AC069472_5 ras-related GTP-binding protein; 5118-4176 [Arabidopsis thaliana]
 dbj|BAB01966.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAY78738.1| Ras-related GTP-binding family protein [Arabidopsis thaliana]
 gb|EFH61150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE75160.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 gb|EOA31399.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 gb|ESQ48812.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 gb|KFK38580.1| hypothetical protein AALP_AA3G132100 [Arabis alpina]
Length=222

 Score =   275 bits (704),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_009391884.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   276 bits (705),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+SG        Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQTRT+
Sbjct  1    MSSGNSRYGEFNQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTRTL  60

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  K++KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWL+ELR HA
Sbjct  61   NIDDKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLDELRGHA  120

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D+NIVIMLIGNK+DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  121  DRNIVIMLIGNKSDLGSLRAVPIEDAKEFAQRENLFFMETSALEA  165



>emb|CDY54519.1| BnaC07g49230D [Brassica napus]
Length=223

 Score =   275 bits (704),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I +K++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDNKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_009120881.1| PREDICTED: ras-related protein RABA4d [Brassica rapa]
 emb|CDY52622.1| BnaCnng23010D [Brassica napus]
 emb|CDY50568.1| BnaA01g30820D [Brassica napus]
Length=222

 Score =   275 bits (704),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_009590361.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLI NK DL   R VP EDA+EFA++E LFF+ETSA+E+
Sbjct  124  MLIANKCDLGSLRAVPIEDAQEFAERENLFFMETSALES  162



>ref|XP_010557931.1| PREDICTED: ras-related protein RABA4d-like [Tarenaya hassleriana]
Length=224

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSIDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_010520062.1| PREDICTED: ras-related protein RABA4d [Tarenaya hassleriana]
Length=223

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|NP_199607.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
 sp|Q9FE79.1|RAA4C_ARATH RecName: Full=Ras-related protein RABA4c; Short=AtRABA4c; AltName: 
Full=Ras-related protein SMG1 [Arabidopsis thaliana]
 gb|AAG44121.1|AF218121_1 small molecular weight g-protein [Arabidopsis thaliana]
 dbj|BAB09048.1| RAS superfamily GTP-binding protein-like [Arabidopsis thaliana]
 gb|ABD60725.1| At5g47960 [Arabidopsis thaliana]
 gb|AED95599.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
Length=223

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGTLRAVPTEDAKEFAQRENLFFMETSALDS  162



>ref|XP_009411810.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=231

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS+DSKATIGVEFQTRT+ I HK++KAQIW
Sbjct  17   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIDSKATIGVEFQTRTITIDHKTIKAQIW  76

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR H D+NIVIMLIGNK
Sbjct  77   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMTRWLEELRGHTDRNIVIMLIGNK  136

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL   R VP +DAKEFAQ+E LFF+ETSA+EA
Sbjct  137  SDLGTLRAVPIDDAKEFAQRENLFFMETSALEA  169



>ref|XP_011078858.1| PREDICTED: ras-related protein RABA4d [Sesamum indicum]
Length=220

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG    QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+L+SKATIGVEFQT+T++I  K+
Sbjct  5    YGGDFSQKIDYVFKVVLIGDSAVGKSQLLARFARNEFTLESKATIGVEFQTKTLIIDQKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDHI RWLEELR HADKNIVI
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHIARWLEELRGHADKNIVI  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E L+F+ETSA+EA
Sbjct  125  MLIGNKCDLGTLRAVPTEDAQEFAERENLYFMETSALEA  163



>ref|XP_008373738.1| PREDICTED: ras-related protein RABA4d [Malus domestica]
Length=223

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDQKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_004149604.1| PREDICTED: ras-related protein RABA4c-like [Cucumis sativus]
 gb|KGN58606.1| hypothetical protein Csa_3G698470 [Cucumis sativus]
Length=222

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQ E L F+ETSA+EA
Sbjct  129  KSDLGSLRVVPTEDAKEFAQMENLSFMETSALEA  162



>ref|NP_001146862.1| LOC100280470 [Zea mays]
 gb|ACG24025.1| ras-related protein RGP1 [Zea mays]
Length=226

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GG +G+  GQ+IDYVFKVVLIGDSA GKSQ+LARFARN+F+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGSHGEL-GQRIDYVFKVVLIGDSAGGKSQLLARFARNQFNLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  60   NIDARNVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  119

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIML+GNK+DL   R VP EDAKEFA++E LFF+ETSA+EA
Sbjct  120  DKNIVIMLMGNKSDLGTLRAVPIEDAKEFAERENLFFMETSALEA  164



>ref|XP_004172276.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA4c-like 
[Cucumis sativus]
Length=222

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+L+RFARNEFSLDSKATIGVEFQT+T+ I  K++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLSRFARNEFSLDSKATIGVEFQTKTLNIDQKAIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VPTEDAKEFAQ E L F+ETSA+EA
Sbjct  129  KSDLGSLRVVPTEDAKEFAQMENLSFMETSALEA  162



>ref|XP_007052583.1| RAB GTPase A4C [Theobroma cacao]
 gb|EOX96740.1| RAB GTPase A4C [Theobroma cacao]
Length=225

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQTRT LI HK+VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNIDSKATIGVEFQTRTQLIDHKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYDITKR +FDH+ +WLEELR HADKNIVIML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHVAKWLEELRGHADKNIVIMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP EDAKEFA +E LFF+ETSA+EA
Sbjct  129  KSDLGSLRAVPVEDAKEFALRESLFFMETSALEA  162



>ref|XP_010534274.1| PREDICTED: ras-related protein RABA4c [Tarenaya hassleriana]
Length=223

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I  K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLTIDSKTVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R VPTEDAKE+AQ+E LFF+ETSA++A
Sbjct  130  TDLGTLRAVPTEDAKEYAQRESLFFMETSALDA  162



>emb|CDY42133.1| BnaC05g40860D [Brassica napus]
 emb|CDY08447.1| BnaA05g26830D [Brassica napus]
Length=222

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+VKAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
             DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  130  CDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_002282798.1| PREDICTED: ras-related protein RABA4d [Vitis vinifera]
 emb|CAN62934.1| hypothetical protein VITISV_008844 [Vitis vinifera]
 emb|CBI29902.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ I  K+
Sbjct  5    YGDF-NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNVDSKATIGVEFQTKTLAIDQKA  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VPTEDA+EFA++E LFF+ETSA+EA
Sbjct  124  MLIGNKSDLGSLRAVPTEDAQEFAERENLFFMETSALEA  162



>emb|CDY00758.1| BnaC03g37420D [Brassica napus]
Length=221

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAERENLFFMETSALEA  162



>ref|XP_009345104.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   275 bits (704),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+EFAQ+E LFF+ETSA+EA
Sbjct  160  MLIGNKCDLGSLRAVPIEDAQEFAQRENLFFMETSALEA  198



>ref|XP_009135214.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 ref|XP_009135215.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 emb|CDX73833.1| BnaA03g32140D [Brassica napus]
Length=221

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAERENLFFMETSALEA  162



>ref|XP_006351381.1| PREDICTED: ras-related protein RABA4d-like [Solanum tuberosum]
Length=226

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            Y D   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +K+
Sbjct  6    YADHYNQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNKT  65

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  66   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  125

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLI NK DL   R VP EDA+EFA++E LFF+ETSA+++
Sbjct  126  MLIANKCDLGSLRAVPVEDAQEFAERENLFFMETSALQS  164



>ref|XP_004249189.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=226

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            Y D   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +K+
Sbjct  6    YADHYNQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNKT  65

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  66   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  125

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLI NK DL   R VP EDA+EFA++E LFF+ETSA+++
Sbjct  126  MLIANKCDLGSLRAVPVEDAQEFAERENLFFMETSALQS  164



>ref|XP_009347482.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+EFAQ+E LFF+ETSA+EA
Sbjct  160  MLIGNKCDLGSLRAVPIEDAQEFAQRENLFFMETSALEA  198



>ref|XP_008392105.1| PREDICTED: ras-related protein RABA4d-like [Malus domestica]
Length=259

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T+++ HK+
Sbjct  41   YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVLDHKT  99

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  100  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  159

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+EFAQ+E LFF+ETSA+EA
Sbjct  160  MLIGNKCDLGSLRAVPIEDAQEFAQRENLFFMETSALEA  198



>ref|XP_008375145.1| PREDICTED: ras-related protein RABA4c-like [Malus domestica]
Length=222

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>ref|XP_010489789.1| PREDICTED: ras-related protein RABA4d-like [Camelina sativa]
Length=222

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++  +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVTDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  162



>ref|XP_009354700.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>gb|ABK23331.1| unknown [Picea sitchensis]
Length=222

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   Q+IDY+FKVV+IGDSAVGKSQIL+RFA+NEFSLDSK+TIGVEFQTRT+ I +K+
Sbjct  5    YGDY-DQRIDYMFKVVVIGDSAVGKSQILSRFAKNEFSLDSKSTIGVEFQTRTIAIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +K QIWDTAGQERYRAVTSAYYRGA+GAMLVYDITKRQ+FDH+ RWLEELR HAD NIVI
Sbjct  64   IKTQIWDTAGQERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWLEELRGHADNNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL D R VP EDAKEFAQ+EGLFF ETSA+EA
Sbjct  124  MLIGNKCDLRDMRAVPEEDAKEFAQREGLFFFETSALEA  162



>emb|CDP10094.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+++  K+
Sbjct  5    YGDF-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIVDQKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E L F+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAERENLCFMETSALES  162



>ref|XP_008460801.1| PREDICTED: ras-related protein RABA4d [Cucumis melo]
Length=223

 Score =   273 bits (698),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RNEFS+DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNEFSVDSKATIGVEFQTKTLVIDQKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAERENLFFMETSALES  162



>ref|XP_004150166.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 ref|XP_004154754.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 gb|KGN53823.1| hypothetical protein Csa_4G152280 [Cucumis sativus]
Length=223

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RNEFS+DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNEFSVDSKATIGVEFQTKTLVIDQKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFA++E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPTEDAQEFAERENLFFMETSALES  162



>ref|XP_010482045.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
 ref|XP_010482047.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEFS++SKATIGVEFQTRT+ I HK++KAQIW
Sbjct  10   QKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI +MLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIALMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            TDL   R V TEDAKEFAQ+E LFF+ETSA+++
Sbjct  130  TDLGSLRAVTTEDAKEFAQRENLFFMETSALDS  162



>emb|CAA41966.1| GTP-binding protein [Oryza sativa]
 prf||1718315A GTP-binding protein
Length=226

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            M+ GGG     GQKIDYVFKVVLIGDSAVGKSQ+LA FARNEF+LDSKATIGVEFQTRT+
Sbjct  1    MSRGGGSYGEVGQKIDYVFKVVLIGDSAVGKSQLLAGFARNEFNLDSKATIGVEFQTRTL  60

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
             I  ++VKAQ  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HA
Sbjct  61   HIDARTVKAQTRDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHA  120

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVIMLIGNK+DL   R VPTEDAKEFA++E LFF+ETSA+E+
Sbjct  121  DKNIVIMLIGNKSDLGTLRVVPTEDAKEFAERENLFFMETSALES  165



>ref|XP_008344636.1| PREDICTED: ras-related protein RABA4d, partial [Malus domestica]
Length=175

 Score =   270 bits (691),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRXHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>ref|XP_009804804.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   272 bits (696),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T+L+ +++
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLLVDNRT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            M+IGNK DL   R VP EDA+EFA++E LFF+ETSA+++
Sbjct  124  MIIGNKCDLGSLRAVPVEDAQEFAERENLFFMETSALQS  162



>ref|XP_011075182.1| PREDICTED: ras-related protein RABA4d-like [Sesamum indicum]
Length=224

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I  K+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLIIDQKTVKAQIW  70

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDH+ RWLEELR HADKNIVIMLIGNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHMARWLEELRGHADKNIVIMLIGNK  130

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
             DL   R VPTEDA+EFA++E L+F+ETSA+EA
Sbjct  131  CDLGTLRAVPTEDAQEFAERENLYFMETSALEA  163



>ref|XP_009763158.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VLIGDSAVGKSQ+LARFARNEFSLDSKATIGVEFQT+T++I  K+
Sbjct  5    YGDY-NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFSLDSKATIGVEFQTKTLIIDQKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLI NK DL   R VP EDA+EFA++E LFF+ETSA+E+
Sbjct  124  MLIANKCDLGSLRAVPIEDAQEFAERENLFFMETSALES  162



>ref|XP_004494010.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=225

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD    KIDYVFKVVLIGDSAVGK+Q+LARFARNEF++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NLKIDYVFKVVLIGDSAVGKTQLLARFARNEFNVDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLASLRAVPTEDAEEFAQRENLFFMETSALES  162



>ref|XP_007140805.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
 gb|ESW12799.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
Length=223

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 148/159 (93%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD + QKIDYVFKVVLIGDSAVGK+Q+LARFARN+FSLDSKATIGVEFQT+T++I +K+
Sbjct  5    YGDYS-QKIDYVFKVVLIGDSAVGKTQLLARFARNQFSLDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK+DL   R VP EDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKSDLASLRAVPMEDAEEFAQRENLFFMETSALES  162



>ref|XP_008350827.1| PREDICTED: ras-related protein RABA4d, partial [Malus domestica]
Length=179

 Score =   270 bits (691),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRXHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>ref|XP_009146635.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
Length=263

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+VKAQIW
Sbjct  51   QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIW  110

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK
Sbjct  111  DTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNK  170

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
             DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  171  CDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  203



>gb|KHG02480.1| Ras-related RABA4d -like protein [Gossypium arboreum]
 gb|KJB15040.1| hypothetical protein B456_002G157000 [Gossypium raimondii]
Length=225

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            QKIDYVFKVVLIGDSAVGKSQ+LARF+RN+FSLDSKATIGVEFQT+T++I +K+VKAQIW
Sbjct  11   QKIDYVFKVVLIGDSAVGKSQLLARFSRNQFSLDSKATIGVEFQTKTLVIDNKTVKAQIW  70

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HADKNIV+MLIGNK
Sbjct  71   DTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADKNIVVMLIGNK  130

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
             DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  131  CDLGSLRAVPTEDAQEFAQRENLFFMETSALES  163



>ref|XP_010672725.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I  K VKAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDKKIVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWL+ELR HADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLDELRGHADKNIVIMLIGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDAKEFA++E LFF+ETSA+E+
Sbjct  129  KCDLASLRAVPIEDAKEFAERENLFFMETSALES  162



>ref|XP_008231353.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231354.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231355.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
Length=223

 Score =   271 bits (693),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>ref|XP_007218358.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
 gb|EMJ19557.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
Length=223

 Score =   271 bits (692),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADSNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>ref|XP_004309478.1| PREDICTED: ras-related protein RABA4d isoform X1 [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSL+SKATIGVEFQT+T+++  K+VKAQI
Sbjct  9    SQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLESKATIGVEFQTKTLVLDQKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR +ADKNIVIMLIGN
Sbjct  69   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGYADKNIVIMLIGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  129  KCDLGSLRAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_002323298.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|EEF05059.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKSIIIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  128  KCDLGSLRAVPAEDAKEFAQRENLFFMETSALEA  161



>ref|XP_002532404.1| protein with unknown function [Ricinus communis]
 gb|EEF29989.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF +DSKATIGVEFQT+T+ I +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFCVDSKATIGVEFQTKTLSIDNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDA+EFAQ+E LFF+ETSA+E+
Sbjct  128  KCDLGSLRAVPIEDAQEFAQRENLFFMETSALES  161



>ref|XP_004497938.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=223

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADANIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGTLRAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_004234844.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=224

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFK+VL GDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T++I +++
Sbjct  5    YGDY-NQKIDYVFKIVLTGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLIIDNRT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R +P EDA+EFA++E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAIPIEDAQEFAERENLFFMETSALES  162



>gb|KJB36087.1| hypothetical protein B456_006G140300 [Gossypium raimondii]
Length=222

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLVGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_009591241.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   +KIDYVFK+VLIGDSAVGKSQ+LARFARNEF+LDSKATIGVEFQT+T+L+ +++
Sbjct  5    YGDY-NRKIDYVFKIVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTKTLLVDNRT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMVRWLEELRGHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+EFA++E LFF+ETSA+++
Sbjct  124  MLIGNKCDLGSLRAVPVEDAQEFAERENLFFMETSALQS  162



>ref|XP_007145654.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
 gb|ESW17648.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
Length=222

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 148/159 (93%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD + QKIDYVFKVVLIGDSAVGK+Q+LARFARN+FS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDFS-QKIDYVFKVVLIGDSAVGKTQLLARFARNQFSVDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   + VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGTLKAVPTEDAEEFAQRENLFFMETSALES  162



>ref|XP_011016542.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKRIIIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  128  KCDLGSLRAVPAEDAKEFAQRENLFFMETSALEA  161



>gb|KHG20755.1| Ras-related RABA4d -like protein [Gossypium arboreum]
Length=222

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   Q+IDYVFKVVLIGDSAVGKSQ+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQRIDYVFKVVLIGDSAVGKSQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VK+QIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VI
Sbjct  64   VKSQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            ML+GNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLVGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_011033268.1| PREDICTED: ras-related protein RABA4d-like isoform X2 [Populus 
euphratica]
Length=218

 Score =   269 bits (687),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKRIIIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  128  KCDLGSLRAVPAEDAKEFAQRENLFFMETSALEA  161



>gb|KEH16247.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=222

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD    KIDYVFKVVLIGDSAVGK+Q+L RFARNEF +DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NTKIDYVFKVVLIGDSAVGKTQLLGRFARNEFKVDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+EFAQ+E LFF+ETSA+EA
Sbjct  124  MLIGNKCDLSYLRAVPMEDAEEFAQRENLFFMETSALEA  162



>gb|EYU20715.1| hypothetical protein MIMGU_mgv1a013518mg [Erythranthe guttata]
Length=218

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEF+L+SKATIGVEFQT+T++I HKSVK+QI
Sbjct  10   NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFNLESKATIGVEFQTKTLVIDHKSVKSQI  69

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIML+GN
Sbjct  70   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLVGN  129

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL     VP+EDA+EFA++E L+F+ETSA+E+
Sbjct  130  KCDLGTICAVPSEDAREFAERENLYFMETSALES  163



>ref|XP_009365017.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SK+TIGVEFQT+T++I HK++KAQI
Sbjct  9    NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKSTIGVEFQTKTLVIDHKTIKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+F+H+ +WLEELR HAD NIV+ML+GN
Sbjct  69   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFEHVTKWLEELRGHADNNIVVMLVGN  128

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP+EDAKEFAQ+E LFF+E SA+EA
Sbjct  129  KSDLGTLRAVPSEDAKEFAQRENLFFMEASALEA  162



>gb|AFK37481.1| unknown [Medicago truncatula]
 gb|KEH41577.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=223

 Score =   268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADTNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   + VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGTLKAVPTEDAQEFAQRENLFFMETSALES  162



>gb|AFK40086.1| unknown [Lotus japonicus]
Length=199

 Score =   267 bits (683),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARF+RN+F++DSKATIGVEFQT+T++I  K+
Sbjct  5    YGDF-NQKIDYVFKVVLIGDSAVGKTQLLARFSRNQFNVDSKATIGVEFQTKTLVIDSKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HAD NIVI
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMAKWLEELRGHADTNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   + VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLATLKAVPTEDAQEFAQRENLFFMETSALES  162



>ref|XP_003516822.1| PREDICTED: ras-related protein RABA4d-like [Glycine max]
Length=223

 Score =   268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K+
Sbjct  5    YGDYH-QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+E AQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPMEDAEEVAQRENLFFMETSALES  162



>gb|EPS73160.1| hypothetical protein M569_01593, partial [Genlisea aurea]
Length=220

 Score =   268 bits (685),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
            G +IDYVFKVVLIGDSAVGKSQIL+RFARNEF+L+SKATIGVEFQTRT++I  K+VKAQI
Sbjct  6    GGQIDYVFKVVLIGDSAVGKSQILSRFARNEFNLESKATIGVEFQTRTLIIDQKTVKAQI  65

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYR+VTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGN
Sbjct  66   WDTAGQERYRSVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGN  125

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDA+EFA++E L+F+ETSA+EA
Sbjct  126  KCDLGTLRAVPVEDAQEFAERENLYFMETSALEA  159



>ref|XP_010111429.1| Ras-related protein RABA4d [Morus notabilis]
 gb|EXC30907.1| Ras-related protein RABA4d [Morus notabilis]
Length=224

 Score =   268 bits (685),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 3/159 (2%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I HK+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLIIDHKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQER  AVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVI  121

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E +FF+ETSA+E+
Sbjct  122  MLIGNKCDLGSLRAVPTEDAQEFAQRENIFFMETSALES  160



>ref|XP_001775770.1| predicted protein [Physcomitrella patens]
 gb|EDQ59453.1| predicted protein [Physcomitrella patens]
Length=221

 Score =   268 bits (684),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
             KIDYVFKVVLIGDSAVGKSQ+LARF+RNEFSL+SKATIGVEFQTRT+++ HK++KAQIW
Sbjct  10   NKIDYVFKVVLIGDSAVGKSQLLARFSRNEFSLESKATIGVEFQTRTVVVDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL + R V T+ A+EFA+KE L FLETSAME+
Sbjct  130  SDLSNLRQVETDTAREFAEKESLSFLETSAMES  162



>gb|ACU18500.1| unknown [Glycine max]
Length=209

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   QKIDYVFKVVLIGDSAVGK+Q+LARFA+N+FS+DSKATIGVEFQT+T++I +K+
Sbjct  6    YGEY-NQKIDYVFKVVLIGDSAVGKTQLLARFAKNQFSVDSKATIGVEFQTKTLIIDNKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  125  MLIGNKCDLGTLRAVPTEDAEEFAQRENLFFMETSALES  163



>gb|KHN09949.1| Ras-related protein RABA4d [Glycine soja]
Length=224

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+   QKIDYVFKVVLIGDSAVGK+Q+LARFA+N+FS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGEY-NQKIDYVFKVVLIGDSAVGKTQLLARFAKNQFSVDSKATIGVEFQTKTLIIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+
Sbjct  64   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVV  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGTLRAVPTEDAEEFAQRENLFFMETSALES  162



>ref|XP_003539132.1| PREDICTED: ras-related protein RABA4d-like [Glycine max]
 gb|KHN46958.1| Ras-related protein RABA4d [Glycine soja]
Length=223

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K 
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKI  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HAD+NIVI
Sbjct  64   IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVKWLEELRGHADQNIVI  123

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+E AQ+E LFF+ETSA+E+
Sbjct  124  MLIGNKCDLGSLRAVPMEDAEELAQRENLFFMETSALES  162



>ref|XP_010422852.1| PREDICTED: ras-related protein RABA4a-like isoform X3 [Camelina 
sativa]
Length=218

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 146/165 (88%), Gaps = 11/165 (7%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MASGGGYGD + QKIDYVFK+VLIGDS VGKSQIL+R+ARNEFSLDSKATIGVEFQTRT+
Sbjct  1    MASGGGYGDPS-QKIDYVFKLVLIGDSGVGKSQILSRYARNEFSLDSKATIGVEFQTRTL  59

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HKSVKAQIWDTAGQER          GAVGAMLVYD+++RQTFDHIPRWLEELR HA
Sbjct  60   VMDHKSVKAQIWDTAGQER----------GAVGAMLVYDVSRRQTFDHIPRWLEELRNHA  109

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            DKNIVI+L+GNK+DLED+R + TEDAK FA+KEGLFFLETSA+ A
Sbjct  110  DKNIVIILVGNKSDLEDQRAISTEDAKGFAEKEGLFFLETSALNA  154



>ref|XP_006381042.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|ERP58839.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   266 bits (681),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ LARFARNEF+ DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQFLARFARNEFNADSKATIGVEFQTKTLAMDNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  128  KCDLGSLRAVPTEDAEEFAQRENLFFMETSALEA  161



>gb|KHN07997.1| Ras-related protein RABA4d [Glycine soja]
Length=279

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSLDSKATIGVEFQT+T++I +K+
Sbjct  61   YGDYH-QKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLDSKATIGVEFQTKTLIIDNKT  119

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            +KAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVI
Sbjct  120  IKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVI  179

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VP EDA+E AQ+E LFF+ETSA+E+
Sbjct  180  MLIGNKCDLGSLRAVPMEDAEEVAQRENLFFMETSALES  218



>gb|AAG51053.1|AC069473_15 ras-related GTP-binding protein, putative; 1694-2636 [Arabidopsis 
thaliana]
Length=220

 Score =   265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 3/159 (2%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YGD   QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFS+DSKATIGVEFQT+T++I +K+
Sbjct  5    YGDY-NQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKT  63

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQER  AVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVI
Sbjct  64   VKAQIWDTAGQER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVI  121

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+EA
Sbjct  122  MLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSALEA  160



>ref|XP_011020284.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ LARFARNEF+ DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQFLARFARNEFNADSKATIGVEFQTKTLAMDNKTVKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQE YRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGN
Sbjct  68   WDTAGQESYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  128  KCDLGSLRAVPAEDAKEFAQRENLFFMETSALEA  161



>ref|XP_001760654.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ74393.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 3/165 (2%)
 Frame = +2

Query  161  MASGGGYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTM  340
            MA+G    D    KIDYVFKVVLIGDSAVGKSQ+L+RF+RNEFSL+SKATIGVEFQTRT+
Sbjct  1    MANGYNEYD---NKIDYVFKVVLIGDSAVGKSQLLSRFSRNEFSLESKATIGVEFQTRTI  57

Query  341  LIQHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHA  520
            ++ HK++KAQIWDTAGQERYRAVTSAYYRGAVGAM+VYDITK Q+FDH+ RWLEELRAHA
Sbjct  58   VVDHKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMVVYDITKEQSFDHVLRWLEELRAHA  117

Query  521  DKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            D NIVIMLIGNK+DL + R V T+ A+E+A+K+GL FLETSAME+
Sbjct  118  DANIVIMLIGNKSDLSNLRQVETDTAREYAEKQGLSFLETSAMES  162



>ref|XP_004306514.1| PREDICTED: ras-related protein RABA4c [Fragaria vesca subsp. 
vesca]
Length=252

 Score =   264 bits (674),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARFARNEFSL+SKATIGVEFQT+T+ I  K++KAQI
Sbjct  37   NQKIDYVFKVVLIGDSAVGKSQLLARFARNEFSLESKATIGVEFQTKTLSIDQKTIKAQI  96

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ RWLEELR HAD NIV+ML+GN
Sbjct  97   WDTAGQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTRWLEELRGHADSNIVVMLVGN  156

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL   R VP EDAK+FAQ+E LFF+E SA+E+
Sbjct  157  KSDLGTLRAVPAEDAKDFAQRENLFFMEASALES  190



>gb|EPS69801.1| hypothetical protein M569_04963, partial [Genlisea aurea]
Length=208

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  176  GYGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHK  355
             Y      K+DYVFK+VLIGDSAVGKSQ+L+R+ +NEF LDS+ATIGVEFQTRT+ I HK
Sbjct  2    NYAGDFSSKVDYVFKIVLIGDSAVGKSQLLSRYTKNEFLLDSRATIGVEFQTRTLSIDHK  61

Query  356  SVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIV  535
            +VKAQIWDTAGQERYRAVT+AYYRGA+GAMLVYDITKRQ+FDH+PRWLEELR+ ADK+I 
Sbjct  62   TVKAQIWDTAGQERYRAVTTAYYRGALGAMLVYDITKRQSFDHVPRWLEELRSSADKHIA  121

Query  536  IMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +MLIGNK+DLE+ R V  EDAK+FAQ+E LFF+ETSA++A
Sbjct  122  VMLIGNKSDLENLRQVSLEDAKDFAQRENLFFMETSALDA  161



>ref|XP_011470829.1| PREDICTED: ras-related protein RABA4d isoform X2 [Fragaria vesca 
subsp. vesca]
Length=221

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGK+Q+LARFARNEFSL+SKATIGVEFQT+T+++  K+VKAQI
Sbjct  9    SQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSLESKATIGVEFQTKTLVLDQKTVKAQI  68

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQER  AVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR +ADKNIVIMLIGN
Sbjct  69   WDTAGQER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGYADKNIVIMLIGN  126

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  127  KCDLGSLRAVPTEDAQEFAQRENLFFMETSALES  160



>ref|XP_001753670.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ81422.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
             KIDYVFKVVLIGDSAVGKSQ+L+RF+RNEFSL+SKATIGVEFQTRT+++ HK++KAQIW
Sbjct  10   NKIDYVFKVVLIGDSAVGKSQLLSRFSRNEFSLESKATIGVEFQTRTIVVDHKTIKAQIW  69

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK
Sbjct  70   DTAGQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNK  129

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            +DL + R V T+ A+ +A+KE L FLETSAME+
Sbjct  130  SDLSNLRQVDTDVARVYAEKEKLSFLETSAMES  162



>ref|XP_009375439.1| PREDICTED: ras-related protein RABA3 [Pyrus x bretschneideri]
Length=248

 Score =   261 bits (668),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  197  QKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIW  376
            +KIDYVFKVV+IGDSAVGK+QIL+RF +NEF LDSK+TIGVEFQTRT+ IQ K +KAQIW
Sbjct  34   EKIDYVFKVVVIGDSAVGKTQILSRFTKNEFCLDSKSTIGVEFQTRTLTIQGKLIKAQIW  93

Query  377  DTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNK  556
            DTAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDH+ RW+EELRAHAD +IVIMLIGNK
Sbjct  94   DTAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRAHADSSIVIMLIGNK  153

Query  557  TDLEDRRDVPTEDAKEFAQKEGLFFLETSA  646
             DL D+R VPTEDA EFA+++GLFF ETSA
Sbjct  154  ADLGDQRAVPTEDAVEFAEEQGLFFSETSA  183



>gb|KDO83348.1| hypothetical protein CISIN_1g040835mg, partial [Citrus sinensis]
Length=206

 Score =   259 bits (663),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  227  LIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWDTAGQERYRA  406
            LIGDSAVGKSQ+LARFAR+EFSLDSKATIGVEFQT+T++I HK+VKAQIWDTAGQERYRA
Sbjct  1    LIGDSAVGKSQLLARFARDEFSLDSKATIGVEFQTKTLVIHHKNVKAQIWDTAGQERYRA  60

Query  407  VTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRRDVP  586
            VTSAYYRGAVGAMLVYDITKRQ+FD++ RWLEELR HADKNI+IML+GNK+DLE  R VP
Sbjct  61   VTSAYYRGAVGAMLVYDITKRQSFDNVARWLEELRGHADKNIIIMLVGNKSDLETLRAVP  120

Query  587  TEDAKEFAQKEGLFFLETSAMEA  655
            TEDAKEFA+KEGL F+ETSA+E+
Sbjct  121  TEDAKEFAEKEGLCFMETSALES  143



>ref|XP_002972485.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ26571.1| rab family GTPase [Selaginella moellendorffii]
Length=214

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+L+SKATIGVEFQTRTM++ HK++KAQI
Sbjct  8    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFTLESKATIGVEFQTRTMVVDHKTIKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRA+TSAYYRGAVGA++VYDITKR TF+H+ RWLEEL+ HAD NIV+ML+GN
Sbjct  68   WDTAGQERYRAITSAYYRGAVGALVVYDITKRPTFEHVTRWLEELKVHADNNIVVMLVGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL + R V  E+AK+ A++E LFF+ETSA+EA
Sbjct  128  KSDLGNLRAVSVEEAKDLAEREELFFMETSALEA  161



>ref|XP_006339750.1| PREDICTED: ras-related protein RABA3-like [Solanum tuberosum]
Length=245

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  200  KIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQIWD  379
            KIDYVFKVV+IGDSAVGK+Q+L+RFA+NEF  DSK+TIGVEFQTRT+ IQ K +KAQIWD
Sbjct  29   KIDYVFKVVVIGDSAVGKTQVLSRFAKNEFCFDSKSTIGVEFQTRTVSIQSKVIKAQIWD  88

Query  380  TAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKT  559
            TAGQERYRAVTSAYYRGA+GAMLVYDITKRQTFDH+ RW+EELRAHAD +IVIMLIGNK 
Sbjct  89   TAGQERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRAHADSSIVIMLIGNKA  148

Query  560  DLEDRRDVPTEDAKEFAQKEGLFFLETSAM  649
            DL D R VPTEDA EFA+++GLFF ETSA+
Sbjct  149  DLVDSRAVPTEDAVEFAERQGLFFSETSAL  178



>ref|XP_002984315.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ14825.1| rab family GTPase [Selaginella moellendorffii]
Length=214

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFKVVLIGDSAVGKSQ+LARF+RNEF+L+SKATIGVEFQTRTM++ HK++KAQI
Sbjct  8    NQKIDYVFKVVLIGDSAVGKSQLLARFSRNEFTLESKATIGVEFQTRTMVVDHKTIKAQI  67

Query  374  WDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGN  553
            WDTAGQERYRA+TSAYYRGAVGA++VYDITKR TF+H+ RWLEEL+ HAD NIV+ML+GN
Sbjct  68   WDTAGQERYRAITSAYYRGAVGALVVYDITKRPTFEHVTRWLEELKVHADNNIVVMLVGN  127

Query  554  KTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            K+DL + R V  E+AK+ A++E LFF+ETSA+EA
Sbjct  128  KSDLGNLRAVSVEEAKDLAEREELFFMETSALEA  161



>gb|KHN27367.1| Ras-related protein RABA4d [Glycine soja]
Length=223

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +2

Query  179  YGDAAGQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKS  358
            YG+    KIDYVFKVVL+GDSAVGK+Q+LARFA+N+F++DSKATIGVEFQT+T++I  K+
Sbjct  6    YGEY-NHKIDYVFKVVLVGDSAVGKTQLLARFAKNQFNVDSKATIGVEFQTKTLIIDKKT  64

Query  359  VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI  538
            VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYD+T+R +FD++ +WLEELR HADKNIV+
Sbjct  65   VKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDVTRRPSFDNMAKWLEELRGHADKNIVV  124

Query  539  MLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            MLIGNK DL   R VPTEDA+EFAQ+E LFF+ETSA+E+
Sbjct  125  MLIGNKCDLGTLRAVPTEDAEEFAQRENLFFMETSALES  163



>ref|XP_011033267.1| PREDICTED: ras-related protein RABA4d-like isoform X1 [Populus 
euphratica]
Length=234

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 141/170 (83%), Gaps = 16/170 (9%)
 Frame = +2

Query  194  GQKIDYVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTMLIQHKSVKAQI  373
             QKIDYVFK+VLIGDSAVGKSQ+LARFARNEF++DSKATIGVEFQT+T+ + +K+VKAQI
Sbjct  8    NQKIDYVFKIVLIGDSAVGKSQLLARFARNEFTVDSKATIGVEFQTKTLAMHNKTVKAQI  67

Query  374  WDTAGQE----------------RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEE  505
            WDTAGQE                RYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEE
Sbjct  68   WDTAGQESTFCVCSFLGCFFSSLRYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEE  127

Query  506  LRAHADKNIVIMLIGNKTDLEDRRDVPTEDAKEFAQKEGLFFLETSAMEA  655
            LR HADK I+IMLIGNK DL   R VP EDAKEFAQ+E LFF+ETSA+EA
Sbjct  128  LRGHADKRIIIMLIGNKCDLGSLRAVPAEDAKEFAQRENLFFMETSALEA  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500