BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029L18

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601118.1|  PREDICTED: zinc finger CCCH domain-containin...  56.2    6e-06   Nicotiana tomentosiformis
ref|XP_009601117.1|  PREDICTED: zinc finger CCCH domain-containin...  56.2    7e-06   Nicotiana tomentosiformis
ref|XP_009782012.1|  PREDICTED: zinc finger CCCH domain-containin...  55.8    9e-06   Nicotiana sylvestris
ref|XP_009782011.1|  PREDICTED: zinc finger CCCH domain-containin...  55.8    1e-05   Nicotiana sylvestris



>ref|XP_009601118.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Nicotiana tomentosiformis]
Length=518

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  509  MLFNRTNNSFSSAGTRIPTAPQLASQSSWSGPPGVDIG-PAVADPFLSGLKRPSSEALYH  685
            MLFN+++ S++ A ++IP     A QSSW+ PPGVD+  P  AD + S LKR SS+ALYH
Sbjct  61   MLFNQSD-SYNPAASKIPGL--AAYQSSWTAPPGVDVAQPPAADSYFSSLKRSSSDALYH  117

Query  686  Q  688
            +
Sbjct  118  R  118



>ref|XP_009601117.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Nicotiana tomentosiformis]
Length=519

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  509  MLFNRTNNSFSSAGTRIPTAPQLASQSSWSGPPGVDIG-PAVADPFLSGLKRPSSEALYH  685
            MLFN+++ S++ A ++IP     A QSSW+ PPGVD+  P  AD + S LKR SS+ALYH
Sbjct  61   MLFNQSD-SYNPAASKIPGL--AAYQSSWTAPPGVDVAQPPAADSYFSSLKRSSSDALYH  117

Query  686  Q  688
            +
Sbjct  118  R  118



>ref|XP_009782012.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Nicotiana sylvestris]
Length=518

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  509  MLFNRTNNSFSSAGTRIPTAPQLASQSSWSGPPGVDIG-PAVADPFLSGLKRPSSEALYH  685
            MLFN+++ S++ A ++IP     A QSSW+ PPGVD+  P  AD + S LKR SS+ALYH
Sbjct  61   MLFNQSD-SYNPAASKIPGL--AAYQSSWTAPPGVDVAQPPAADSYFSSLKRSSSDALYH  117

Query  686  Q  688
            +
Sbjct  118  R  118



>ref|XP_009782011.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Nicotiana sylvestris]
Length=519

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  509  MLFNRTNNSFSSAGTRIPTAPQLASQSSWSGPPGVDIG-PAVADPFLSGLKRPSSEALYH  685
            MLFN+++ S++ A ++IP     A QSSW+ PPGVD+  P  AD + S LKR SS+ALYH
Sbjct  61   MLFNQSD-SYNPAASKIPGL--AAYQSSWTAPPGVDVAQPPAADSYFSSLKRSSSDALYH  117

Query  686  Q  688
            +
Sbjct  118  R  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700