BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029J11

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614692.1|  PREDICTED: uncharacterized protein LOC104107561    237   6e-72   Nicotiana tomentosiformis
ref|XP_009780705.1|  PREDICTED: uncharacterized protein LOC104229716    230   2e-69   Nicotiana sylvestris
ref|XP_006363989.1|  PREDICTED: uncharacterized protein LOC102601007    226   9e-68   Solanum tuberosum [potatoes]
ref|XP_004235367.1|  PREDICTED: uncharacterized protein LOC101248757    219   3e-65   Solanum lycopersicum
ref|XP_011073153.1|  PREDICTED: uncharacterized protein LOC105158192    219   5e-65   Sesamum indicum [beniseed]
ref|XP_010069444.1|  PREDICTED: uncharacterized protein LOC104456368    206   3e-60   Eucalyptus grandis [rose gum]
ref|XP_009360040.1|  PREDICTED: uncharacterized protein LOC103950...    206   5e-60   Pyrus x bretschneideri [bai li]
ref|XP_009360039.1|  PREDICTED: uncharacterized protein LOC103950...    205   1e-59   Pyrus x bretschneideri [bai li]
emb|CDO98647.1|  unnamed protein product                                201   5e-58   Coffea canephora [robusta coffee]
ref|XP_006374243.1|  hypothetical protein POPTR_0015s05360g             199   1e-57   
ref|XP_006374246.1|  hypothetical protein POPTR_0015s05360g             199   2e-57   
ref|XP_008240405.1|  PREDICTED: uncharacterized protein LOC103338912    199   3e-57   Prunus mume [ume]
ref|XP_011047792.1|  PREDICTED: uncharacterized protein LOC105142042    196   3e-56   Populus euphratica
ref|XP_002533448.1|  conserved hypothetical protein                     194   8e-56   
ref|XP_007036963.1|  Uncharacterized protein isoform 3                  193   9e-56   
ref|XP_007209930.1|  hypothetical protein PRUPE_ppa004570mg             196   1e-55   
gb|EYU21849.1|  hypothetical protein MIMGU_mgv1a007186mg                193   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_008393457.1|  PREDICTED: uncharacterized protein LOC103455...    193   5e-55   
ref|XP_007036962.1|  Uncharacterized protein isoform 2                  192   6e-55   
ref|XP_007036961.1|  Uncharacterized protein isoform 1                  193   6e-55   
ref|XP_008393456.1|  PREDICTED: uncharacterized protein LOC103455...    192   9e-55   
ref|XP_002317709.1|  hypothetical protein POPTR_0012s03930g             191   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006493269.1|  PREDICTED: uncharacterized protein LOC102611...    191   3e-54   Citrus sinensis [apfelsine]
ref|XP_006441318.1|  hypothetical protein CICLE_v10020337mg             189   9e-54   Citrus clementina [clementine]
ref|XP_009355996.1|  PREDICTED: uncharacterized protein LOC103946...    189   1e-53   Pyrus x bretschneideri [bai li]
gb|KDO47166.1|  hypothetical protein CISIN_1g014467mg                   189   1e-53   Citrus sinensis [apfelsine]
ref|XP_010241168.1|  PREDICTED: uncharacterized protein LOC104585831    189   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009355995.1|  PREDICTED: uncharacterized protein LOC103946...    189   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_011003767.1|  PREDICTED: uncharacterized protein LOC105110429    187   4e-53   Populus euphratica
ref|XP_010091765.1|  hypothetical protein L484_019353                   186   2e-52   Morus notabilis
ref|XP_008466989.1|  PREDICTED: uncharacterized protein LOC103504355    186   2e-52   Cucumis melo [Oriental melon]
ref|XP_004137518.1|  PREDICTED: uncharacterized protein LOC101203627    185   3e-52   Cucumis sativus [cucumbers]
ref|XP_010271178.1|  PREDICTED: uncharacterized protein LOC104607271    184   7e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008356700.1|  PREDICTED: uncharacterized protein LOC103420...    184   8e-52   
ref|XP_008356699.1|  PREDICTED: uncharacterized protein LOC103420...    184   1e-51   
ref|XP_002894114.1|  hypothetical protein ARALYDRAFT_473985             182   4e-51   
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       185   5e-51   Cucumis sativus [cucumbers]
emb|CBI35458.3|  unnamed protein product                                181   1e-50   Vitis vinifera
gb|KDP30111.1|  hypothetical protein JCGZ_18399                         181   2e-50   Jatropha curcas
ref|XP_002267281.3|  PREDICTED: uncharacterized protein LOC100262899    181   3e-50   Vitis vinifera
ref|XP_006374245.1|  hypothetical protein POPTR_0015s05360g             178   5e-50   
gb|EYU24493.1|  hypothetical protein MIMGU_mgv1a007418mg                179   7e-50   Erythranthe guttata [common monkey flower]
gb|EPS73872.1|  hypothetical protein M569_00881                         179   8e-50   Genlisea aurea
ref|XP_010936872.1|  PREDICTED: uncharacterized protein LOC105056391    179   1e-49   Elaeis guineensis
ref|XP_008798412.1|  PREDICTED: uncharacterized protein LOC103713309    178   1e-49   Phoenix dactylifera
ref|XP_006306266.1|  hypothetical protein CARUB_v10012116mg             178   2e-49   Capsella rubella
gb|KJB30250.1|  hypothetical protein B456_005G134400                    176   2e-48   Gossypium raimondii
ref|XP_010461662.1|  PREDICTED: uncharacterized protein LOC104742...    175   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006849427.1|  hypothetical protein AMTR_s00024p00021530          174   6e-48   
ref|XP_009414789.1|  PREDICTED: uncharacterized protein LOC103995...    174   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB53076.1|  hypothetical protein B456_008G292100                    174   7e-48   Gossypium raimondii
gb|KHG11329.1|  Alanine--tRNA ligase                                    174   8e-48   Gossypium arboreum [tree cotton]
ref|XP_006393405.1|  hypothetical protein EUTSA_v10011507mg             173   1e-47   Eutrema salsugineum [saltwater cress]
dbj|BAH56904.1|  AT1G48450                                              170   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414790.1|  PREDICTED: uncharacterized protein LOC103995...    172   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001031154.1|  uncharacterized protein                            170   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185170.1|  uncharacterized protein                            169   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513343.1|  PREDICTED: uncharacterized protein LOC101494...    171   6e-47   
emb|CBI40011.3|  unnamed protein product                                167   1e-46   Vitis vinifera
gb|KHN43658.1|  hypothetical protein glysoja_027724                     169   1e-46   Glycine soja [wild soybean]
ref|XP_008375019.1|  PREDICTED: uncharacterized protein LOC103438...    171   1e-46   
ref|XP_008375017.1|  PREDICTED: uncharacterized protein LOC103438...    171   2e-46   
ref|XP_009408539.1|  PREDICTED: uncharacterized protein LOC103990...    170   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939981.1|  PREDICTED: uncharacterized protein LOC105058679    170   2e-46   
ref|NP_175278.1|  uncharacterized protein                               170   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36092.1|  hypothetical protein AALP_AA4G076400                    170   2e-46   Arabis alpina [alpine rockcress]
ref|XP_007160560.1|  hypothetical protein PHAVU_002G331900g             169   3e-46   Phaseolus vulgaris [French bean]
ref|XP_003534126.1|  PREDICTED: uncharacterized protein LOC100802...    169   3e-46   Glycine max [soybeans]
ref|XP_009408547.1|  PREDICTED: uncharacterized protein LOC103990...    169   5e-46   
emb|CDX95820.1|  BnaC05g35710D                                          169   5e-46   
ref|XP_010687245.1|  PREDICTED: uncharacterized protein LOC104901374    168   8e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145975.1|  PREDICTED: uncharacterized protein LOC103869650    168   9e-46   Brassica rapa
ref|XP_002273280.1|  PREDICTED: uncharacterized protein LOC100245...    168   1e-45   Vitis vinifera
emb|CDX92162.1|  BnaA05g22450D                                          167   2e-45   
gb|AGV54799.1|  hypothetical protein                                    166   3e-45   Phaseolus vulgaris [French bean]
ref|XP_003528983.1|  PREDICTED: uncharacterized protein LOC100777...    166   4e-45   Glycine max [soybeans]
gb|ACU24516.1|  unknown                                                 166   4e-45   Glycine max [soybeans]
gb|AFK42768.1|  unknown                                                 166   6e-45   Lotus japonicus
gb|KEH26747.1|  plant/T1N15-5 protein                                   166   6e-45   Medicago truncatula
ref|XP_011464472.1|  PREDICTED: uncharacterized protein LOC101299...    166   6e-45   Fragaria vesca subsp. vesca
ref|XP_010465837.1|  PREDICTED: uncharacterized protein LOC104746127    166   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009135549.1|  PREDICTED: uncharacterized protein LOC103859727    166   7e-45   Brassica rapa
ref|XP_006297794.1|  hypothetical protein CARUB_v10013829mg             166   7e-45   Capsella rubella
ref|XP_009145005.1|  PREDICTED: uncharacterized protein LOC103868678    166   8e-45   Brassica rapa
dbj|BAJ34170.1|  unnamed protein product                                165   1e-44   Eutrema halophilum
ref|XP_010479269.1|  PREDICTED: uncharacterized protein LOC104758146    165   2e-44   Camelina sativa [gold-of-pleasure]
gb|KFK39108.1|  hypothetical protein AALP_AA3G202000                    165   2e-44   Arabis alpina [alpine rockcress]
ref|XP_006406690.1|  hypothetical protein EUTSA_v10020677mg             166   2e-44   
ref|XP_010549033.1|  PREDICTED: uncharacterized protein LOC104820...    164   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_010549034.1|  PREDICTED: uncharacterized protein LOC104820...    164   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_010500371.1|  PREDICTED: uncharacterized protein LOC104777762    164   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004299503.1|  PREDICTED: uncharacterized protein LOC101299...    163   5e-44   Fragaria vesca subsp. vesca
emb|CDY58279.1|  BnaCnng32840D                                          163   6e-44   Brassica napus [oilseed rape]
emb|CAN79123.1|  hypothetical protein VITISV_030635                     163   8e-44   Vitis vinifera
ref|XP_010661178.1|  PREDICTED: uncharacterized protein LOC100245...    162   9e-44   
emb|CDX82345.1|  BnaA03g34760D                                          162   1e-43   
emb|CDX75937.1|  BnaC03g40200D                                          162   1e-43   
ref|XP_007152648.1|  hypothetical protein PHAVU_004G147200g             157   8e-42   Phaseolus vulgaris [French bean]
ref|XP_003525180.1|  PREDICTED: uncharacterized protein LOC100817...    156   2e-41   Glycine max [soybeans]
ref|XP_006580389.1|  PREDICTED: uncharacterized protein LOC100817...    156   2e-41   Glycine max [soybeans]
ref|XP_004503251.1|  PREDICTED: uncharacterized protein LOC101489103    155   4e-41   Cicer arietinum [garbanzo]
gb|AFK36208.1|  unknown                                                 152   1e-39   Medicago truncatula
gb|ACJ84884.1|  unknown                                                 152   1e-39   Medicago truncatula
gb|ABR17692.1|  unknown                                                 148   4e-38   Picea sitchensis
gb|ADE77481.1|  unknown                                                 147   5e-38   Picea sitchensis
gb|EAY91660.1|  hypothetical protein OsI_13299                          147   6e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_010487675.1|  PREDICTED: uncharacterized protein LOC104765624    147   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010505920.1|  PREDICTED: uncharacterized protein LOC104782624    146   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002885230.1|  predicted protein                                  147   1e-37   
gb|AAL32564.1|  Unknown protein                                         146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566588.1|  uncharacterized protein                               146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530975.1|  PREDICTED: uncharacterized protein LOC100793300    146   1e-37   Glycine max [soybeans]
dbj|BAF01343.1|  hypothetical protein                                   146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078173.1|  uncharacterized protein                            146   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001051084.1|  Os03g0717900                                       146   2e-37   
ref|XP_010919980.1|  PREDICTED: uncharacterized protein LOC105043949    145   4e-37   
gb|ACF87802.1|  unknown                                                 142   4e-36   Zea mays [maize]
ref|XP_006650499.1|  PREDICTED: uncharacterized protein LOC102715191    140   5e-36   
ref|NP_001143815.1|  uncharacterized protein LOC100276591               140   2e-35   Zea mays [maize]
gb|ABF98565.1|  expressed protein                                       139   2e-35   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85118.1|  predicted protein                                      138   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011028101.1|  PREDICTED: uncharacterized protein LOC105128231    138   1e-34   Populus euphratica
ref|XP_006854071.1|  hypothetical protein AMTR_s00048p00111750          137   1e-34   Amborella trichopoda
ref|NP_001169730.1|  hypothetical protein                               136   6e-34   Zea mays [maize]
gb|EMT10781.1|  hypothetical protein F775_30852                         136   9e-34   
ref|XP_008800077.1|  PREDICTED: uncharacterized protein LOC103714...    135   1e-33   Phoenix dactylifera
ref|XP_009413223.1|  PREDICTED: uncharacterized protein LOC103994...    134   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010261560.1|  PREDICTED: uncharacterized protein LOC104600354    133   6e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004981973.1|  PREDICTED: uncharacterized protein LOC101781...    133   7e-33   Setaria italica
ref|XP_002276652.1|  PREDICTED: uncharacterized protein LOC100260823    132   1e-32   Vitis vinifera
emb|CBI33818.3|  unnamed protein product                                132   1e-32   Vitis vinifera
ref|XP_003560595.1|  PREDICTED: uncharacterized protein LOC100829350    131   4e-32   Brachypodium distachyon [annual false brome]
ref|XP_004981974.1|  PREDICTED: uncharacterized protein LOC101781...    130   7e-32   Setaria italica
emb|CDP11681.1|  unnamed protein product                                130   1e-31   Coffea canephora [robusta coffee]
ref|XP_009413222.1|  PREDICTED: uncharacterized protein LOC103994...    128   4e-31   
ref|XP_011081424.1|  PREDICTED: uncharacterized protein LOC105164476    127   9e-31   Sesamum indicum [beniseed]
ref|XP_007209264.1|  hypothetical protein PRUPE_ppa007392mg             126   2e-30   
gb|KHG08376.1|  Beta-casein                                             125   6e-30   Gossypium arboreum [tree cotton]
gb|KJB21160.1|  hypothetical protein B456_003G185600                    125   6e-30   Gossypium raimondii
ref|XP_006471483.1|  PREDICTED: uncharacterized protein LOC102623998    125   7e-30   Citrus sinensis [apfelsine]
gb|KDP30713.1|  hypothetical protein JCGZ_15541                         125   8e-30   Jatropha curcas
ref|XP_008238169.1|  PREDICTED: uncharacterized protein LOC103336834    123   3e-29   Prunus mume [ume]
ref|XP_004300191.1|  PREDICTED: uncharacterized protein LOC101292798    121   2e-28   Fragaria vesca subsp. vesca
ref|XP_002518989.1|  conserved hypothetical protein                     121   2e-28   Ricinus communis
ref|XP_008466019.1|  PREDICTED: uncharacterized protein LOC103503...    120   2e-28   Cucumis melo [Oriental melon]
ref|XP_007040722.1|  Uncharacterized protein TCM_016604                 120   3e-28   
ref|XP_006352932.1|  PREDICTED: uncharacterized protein LOC102595128    119   5e-28   Solanum tuberosum [potatoes]
ref|XP_009804854.1|  PREDICTED: uncharacterized protein LOC104250017    119   5e-28   Nicotiana sylvestris
ref|XP_004136206.1|  PREDICTED: uncharacterized protein LOC101213975    119   7e-28   Cucumis sativus [cucumbers]
ref|XP_010677383.1|  PREDICTED: uncharacterized protein LOC104893042    119   8e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008373529.1|  PREDICTED: uncharacterized protein LOC103436859    117   2e-27   
ref|XP_009373461.1|  PREDICTED: uncharacterized protein LOC103962488    117   3e-27   Pyrus x bretschneideri [bai li]
gb|KCW71713.1|  hypothetical protein EUGRSUZ_E00224                     117   3e-27   Eucalyptus grandis [rose gum]
ref|XP_010055250.1|  PREDICTED: uncharacterized protein LOC104443499    117   3e-27   
ref|XP_004245960.1|  PREDICTED: uncharacterized protein LOC101262445    117   4e-27   
ref|XP_009607216.1|  PREDICTED: uncharacterized protein LOC104101473    117   4e-27   Nicotiana tomentosiformis
ref|XP_008800078.1|  PREDICTED: uncharacterized protein LOC103714...    116   6e-27   
gb|EPS63452.1|  hypothetical protein M569_11331                         112   1e-25   Genlisea aurea
ref|XP_003612708.1|  hypothetical protein MTR_5g028020                  111   6e-25   Medicago truncatula
gb|EYU43718.1|  hypothetical protein MIMGU_mgv1a007450mg                110   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_004500125.1|  PREDICTED: uncharacterized protein LOC101505...    104   3e-24   
ref|XP_004976664.1|  PREDICTED: uncharacterized protein LOC101761297    107   9e-24   Setaria italica
ref|XP_007158234.1|  hypothetical protein PHAVU_002G135300g             106   2e-23   Phaseolus vulgaris [French bean]
ref|XP_002977160.1|  hypothetical protein SELMODRAFT_106276             105   3e-23   
gb|AFW59314.1|  hypothetical protein ZEAMMB73_007794                    106   3e-23   
gb|EEC77902.1|  hypothetical protein OsI_17223                          105   5e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004512464.1|  PREDICTED: uncharacterized protein LOC101507671    105   5e-23   Cicer arietinum [garbanzo]
ref|XP_010540738.1|  PREDICTED: uncharacterized protein LOC104814412    105   7e-23   Tarenaya hassleriana [spider flower]
ref|XP_003534296.1|  PREDICTED: uncharacterized protein LOC100802337    104   1e-22   Glycine max [soybeans]
ref|XP_002448446.1|  hypothetical protein SORBIDRAFT_06g027240          103   2e-22   Sorghum bicolor [broomcorn]
emb|CDY35549.1|  BnaA05g16370D                                          103   3e-22   Brassica napus [oilseed rape]
ref|XP_009145204.1|  PREDICTED: uncharacterized protein LOC103868901    103   3e-22   Brassica rapa
ref|XP_002890970.1|  hypothetical protein ARALYDRAFT_473397             103   4e-22   Arabidopsis lyrata subsp. lyrata
ref|NP_001145533.1|  uncharacterized protein LOC100278968               102   4e-22   Zea mays [maize]
ref|NP_001053731.1|  Os04g0595100                                       102   5e-22   
ref|XP_006415245.1|  hypothetical protein EUTSA_v10007794mg             102   6e-22   Eutrema salsugineum [saltwater cress]
gb|KHN40428.1|  hypothetical protein glysoja_000926                     102   1e-21   Glycine soja [wild soybean]
ref|NP_001242537.1|  uncharacterized protein LOC100810147               101   1e-21   
ref|XP_002965311.1|  hypothetical protein SELMODRAFT_82738              101   1e-21   
ref|XP_010240349.1|  PREDICTED: uncharacterized protein LOC104585415    100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006653725.1|  PREDICTED: uncharacterized protein LOC102702753    100   2e-21   Oryza brachyantha
ref|XP_006307539.1|  hypothetical protein CARUB_v10009166mg           99.0    2e-20   
ref|NP_564389.1|  uncharacterized protein                             98.2    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04061.1|  hypothetical protein F775_32804                       97.8    2e-20   
gb|EMS68345.1|  hypothetical protein TRIUR3_07699                     96.7    5e-20   Triticum urartu
emb|CDY29940.1|  BnaC05g28960D                                        96.3    8e-20   Brassica napus [oilseed rape]
dbj|BAJ87444.1|  predicted protein                                    96.3    9e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010478637.1|  PREDICTED: uncharacterized protein LOC104757587  94.7    3e-19   Camelina sativa [gold-of-pleasure]
gb|KFK44959.1|  hypothetical protein AALP_AA1G325800                  94.4    4e-19   Arabis alpina [alpine rockcress]
ref|XP_010461033.1|  PREDICTED: uncharacterized protein LOC104741810  93.6    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010499760.1|  PREDICTED: uncharacterized protein LOC104777247  92.8    2e-18   Camelina sativa [gold-of-pleasure]
gb|ABR16101.1|  unknown                                               91.7    4e-18   Picea sitchensis
ref|XP_008800079.1|  PREDICTED: uncharacterized protein LOC103714...  88.2    5e-17   Phoenix dactylifera
ref|XP_006385682.1|  hypothetical protein POPTR_0003s09620g           84.3    9e-17   
emb|CAN81624.1|  hypothetical protein VITISV_014254                   83.6    2e-16   Vitis vinifera
gb|KHG07714.1|  Ribosomal L11 methyltransferase                       83.6    1e-15   Gossypium arboreum [tree cotton]
gb|KDO57187.1|  hypothetical protein CISIN_1g035864mg                 78.2    1e-14   Citrus sinensis [apfelsine]
ref|XP_002981973.1|  hypothetical protein SELMODRAFT_233832           80.5    1e-14   
ref|XP_002982952.1|  hypothetical protein SELMODRAFT_234120           80.5    2e-14   
ref|XP_010908554.1|  PREDICTED: uncharacterized protein LOC105034...  79.7    7e-14   Elaeis guineensis
ref|XP_010908555.1|  PREDICTED: uncharacterized protein LOC105034...  78.6    1e-13   
gb|KDO36404.1|  hypothetical protein CISIN_1g034247mg                 73.9    2e-13   Citrus sinensis [apfelsine]
ref|XP_010088656.1|  hypothetical protein L484_007878                 76.6    2e-13   
emb|CAL07981.1|  hypothetical protein                                 76.3    3e-13   Platanus x hispanica [London plane tree]
ref|XP_008776305.1|  PREDICTED: uncharacterized protein LOC103696450  76.6    8e-13   Phoenix dactylifera
ref|XP_006848511.1|  hypothetical protein AMTR_s00013p00260550        76.6    8e-13   Amborella trichopoda
ref|XP_003081567.1|  unnamed protein product                          73.9    1e-12   
ref|XP_010271747.1|  PREDICTED: uncharacterized protein LOC104607751  70.9    5e-12   
gb|EYU24492.1|  hypothetical protein MIMGU_mgv1a012902mg              72.0    6e-12   Erythranthe guttata [common monkey flower]
emb|CEF99337.1|  Protein of unknown function DUF760                   73.6    1e-11   Ostreococcus tauri
gb|AFK33975.1|  unknown                                               70.5    1e-11   Lotus japonicus
ref|XP_001420115.1|  predicted protein                                72.8    2e-11   Ostreococcus lucimarinus CCE9901
ref|NP_001143759.1|  uncharacterized protein LOC100276521             72.4    2e-11   Zea mays [maize]
ref|XP_001691046.1|  predicted protein                                72.0    3e-11   Chlamydomonas reinhardtii
gb|AAQ14307.1|  ABRH7                                                 69.3    3e-11   Marsilea quadrifolia
gb|ACF84114.1|  unknown                                               70.1    1e-10   Zea mays [maize]
gb|AGT16908.1|  hypothetical protein SHCRBa_217_A17_F_90              70.1    1e-10   Saccharum hybrid cultivar R570
ref|XP_004979240.1|  PREDICTED: uncharacterized protein LOC101761319  69.7    2e-10   Setaria italica
ref|XP_003520988.1|  PREDICTED: uncharacterized protein LOC100793365  68.9    3e-10   Glycine max [soybeans]
ref|XP_008676966.1|  PREDICTED: uncharacterized protein LOC100276...  68.6    3e-10   Zea mays [maize]
ref|XP_010247844.1|  PREDICTED: uncharacterized protein LOC104590798  68.9    4e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006599165.1|  PREDICTED: uncharacterized protein LOC100804253  67.8    6e-10   Glycine max [soybeans]
gb|AGT15907.1|  hypothetical protein SHCRBa_013_F04_R_50              67.8    7e-10   Saccharum hybrid cultivar R570
gb|AGT16639.1|  Protein of unknown function DUF760                    67.8    8e-10   Saccharum hybrid cultivar R570
dbj|BAK05587.1|  predicted protein                                    67.4    8e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT16547.1|  hypothetical protein SHCRBa_093_N12_F_10              67.4    9e-10   Saccharum hybrid cultivar R570
ref|XP_003577586.1|  PREDICTED: uncharacterized protein LOC100826589  67.0    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_007134152.1|  hypothetical protein PHAVU_010G023700g           66.2    2e-09   Phaseolus vulgaris [French bean]
gb|AFW59313.1|  hypothetical protein ZEAMMB73_007794                  62.8    3e-09   
ref|XP_003055064.1|  predicted protein                                65.5    4e-09   Micromonas pusilla CCMP1545
ref|XP_011399310.1|  WD repeat-containing protein 89-like protein     65.9    5e-09   Auxenochlorella protothecoides
ref|XP_002503881.1|  predicted protein                                65.1    7e-09   Micromonas commoda
ref|XP_004510240.1|  PREDICTED: uncharacterized protein LOC101489146  64.3    1e-08   Cicer arietinum [garbanzo]
ref|XP_010100787.1|  hypothetical protein L484_015816                 64.3    1e-08   Morus notabilis
ref|XP_004290164.1|  PREDICTED: uncharacterized protein LOC101305809  63.9    1e-08   Fragaria vesca subsp. vesca
gb|ABA93505.2|  expressed protein                                     63.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067848.2|  Os11g0456100                                     63.5    2e-08   
emb|CDP03929.1|  unnamed protein product                              63.5    2e-08   Coffea canephora [robusta coffee]
ref|XP_010685095.1|  PREDICTED: uncharacterized protein LOC104899578  63.2    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006662927.1|  PREDICTED: uncharacterized protein LOC102711023  63.2    2e-08   Oryza brachyantha
ref|XP_011024597.1|  PREDICTED: uncharacterized protein LOC105125729  62.8    4e-08   Populus euphratica
ref|XP_010274079.1|  PREDICTED: uncharacterized protein LOC104609452  62.8    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010069618.1|  PREDICTED: uncharacterized protein LOC104456510  62.4    4e-08   Eucalyptus grandis [rose gum]
ref|XP_002303068.2|  hypothetical protein POPTR_0002s24910g           62.4    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008341108.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...  62.4    5e-08   
ref|XP_002948306.1|  hypothetical protein VOLCADRAFT_88515            62.0    5e-08   Volvox carteri f. nagariensis
ref|XP_006280743.1|  hypothetical protein CARUB_v10026712mg           60.8    1e-07   Capsella rubella
ref|XP_010552027.1|  PREDICTED: uncharacterized protein LOC104822482  60.1    2e-07   Tarenaya hassleriana [spider flower]
ref|NP_199670.1|  uncharacterized protein                             60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42555.1|  hypothetical protein B456_007G157400                  60.1    3e-07   Gossypium raimondii
gb|KHG02769.1|  Phosphoserine aminotransferase                        60.1    3e-07   Gossypium arboreum [tree cotton]
gb|KHN10952.1|  hypothetical protein glysoja_026687                   59.3    4e-07   Glycine soja [wild soybean]
ref|XP_008382586.1|  PREDICTED: uncharacterized protein LOC103445364  59.3    6e-07   
gb|KHN40722.1|  hypothetical protein glysoja_049851                   58.9    6e-07   Glycine soja [wild soybean]
ref|XP_009372204.1|  PREDICTED: uncharacterized protein LOC103961392  58.9    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_006602471.1|  PREDICTED: uncharacterized protein LOC100794...  58.9    8e-07   Glycine max [soybeans]
ref|XP_005649890.1|  DUF760-domain-containing protein                 58.5    8e-07   Coccomyxa subellipsoidea C-169
ref|XP_008244677.1|  PREDICTED: uncharacterized protein LOC103342802  58.2    1e-06   Prunus mume [ume]
ref|XP_007201792.1|  hypothetical protein PRUPE_ppa007244mg           58.2    1e-06   Prunus persica
ref|XP_003626951.1|  hypothetical protein MTR_8g012420                58.2    1e-06   Medicago truncatula
ref|XP_008466020.1|  PREDICTED: uncharacterized protein LOC103503...  58.2    1e-06   
ref|XP_007049654.1|  F21O3.2 protein                                  58.2    1e-06   
ref|XP_007510107.1|  predicted protein                                58.2    1e-06   Bathycoccus prasinos
ref|XP_002863907.1|  hypothetical protein ARALYDRAFT_917767           57.8    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_002863048.1|  hypothetical protein ARALYDRAFT_920669           57.8    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_009349111.1|  PREDICTED: uncharacterized protein LOC103940675  57.8    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_011089045.1|  PREDICTED: uncharacterized protein LOC105170122  57.8    2e-06   Sesamum indicum [beniseed]
ref|XP_006586216.1|  PREDICTED: uncharacterized protein LOC102662413  57.8    2e-06   Glycine max [soybeans]
ref|XP_009763079.1|  PREDICTED: uncharacterized protein LOC104215037  57.4    2e-06   Nicotiana sylvestris
ref|XP_004247039.1|  PREDICTED: uncharacterized protein LOC101262953  57.0    3e-06   Solanum lycopersicum
ref|XP_009587865.1|  PREDICTED: uncharacterized protein LOC104085515  56.6    4e-06   Nicotiana tomentosiformis
ref|XP_008372537.1|  PREDICTED: uncharacterized protein LOC103435886  56.6    4e-06   
gb|KDP45280.1|  hypothetical protein JCGZ_15145                       56.6    5e-06   Jatropha curcas
ref|XP_006437252.1|  hypothetical protein CICLE_v10031774mg           56.6    5e-06   Citrus clementina [clementine]
gb|KDO46601.1|  hypothetical protein CISIN_1g015579mg                 56.2    5e-06   Citrus sinensis [apfelsine]
ref|XP_006484801.1|  PREDICTED: uncharacterized protein LOC102613099  56.2    5e-06   Citrus sinensis [apfelsine]
ref|XP_006395162.1|  hypothetical protein EUTSA_v10004513mg           56.2    6e-06   Eutrema salsugineum [saltwater cress]
gb|AAK30572.1|AF346660_1  unknown                                     55.5    6e-06   Brassica napus [oilseed rape]
ref|NP_566302.1|  uncharacterized protein                             55.8    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367000.1|  PREDICTED: uncharacterized protein LOC102582294  55.8    6e-06   
ref|XP_008458049.1|  PREDICTED: uncharacterized protein LOC103497590  55.8    8e-06   
ref|XP_010547130.1|  PREDICTED: uncharacterized protein LOC104818981  55.8    8e-06   
ref|XP_010445948.1|  PREDICTED: uncharacterized protein LOC104728696  55.5    8e-06   
ref|XP_007140787.1|  hypothetical protein PHAVU_008G142100g           55.5    9e-06   
gb|EPS72664.1|  hypothetical protein M569_02093                       55.1    1e-05   
emb|CAN68920.1|  hypothetical protein VITISV_039448                   55.1    1e-05   
ref|XP_006407850.1|  hypothetical protein EUTSA_v10020977mg           54.7    2e-05   
ref|XP_009793974.1|  PREDICTED: uncharacterized protein LOC104240787  54.7    2e-05   
ref|XP_009596731.1|  PREDICTED: uncharacterized protein LOC104092768  54.7    2e-05   
ref|XP_002884641.1|  hypothetical protein ARALYDRAFT_896892           54.3    2e-05   
ref|XP_005849975.1|  hypothetical protein CHLNCDRAFT_141875           54.7    3e-05   
ref|XP_009147087.1|  PREDICTED: uncharacterized protein LOC103870681  53.9    3e-05   
ref|XP_004149773.1|  PREDICTED: uncharacterized protein LOC101209314  53.9    3e-05   
emb|CDY24630.1|  BnaA05g30290D                                        53.5    4e-05   
emb|CDY28064.1|  BnaC05g44660D                                        53.5    4e-05   
gb|KFK38188.1|  hypothetical protein AALP_AA3G080700                  53.1    5e-05   
ref|XP_009151658.1|  PREDICTED: uncharacterized protein LOC103874970  53.1    6e-05   
ref|XP_002272171.1|  PREDICTED: uncharacterized protein LOC100251038  52.8    7e-05   
ref|XP_002531072.1|  conserved hypothetical protein                   52.0    1e-04   
ref|XP_010464350.1|  PREDICTED: uncharacterized protein LOC104744916  51.6    2e-04   
ref|XP_010486277.1|  PREDICTED: uncharacterized protein LOC104764444  51.6    2e-04   
ref|XP_010451051.1|  PREDICTED: uncharacterized protein LOC104733110  51.6    2e-04   
ref|XP_006297949.1|  hypothetical protein CARUB_v10013990mg           50.4    4e-04   
emb|CDX85350.1|  BnaC07g26610D                                        50.4    5e-04   



>ref|XP_009614692.1| PREDICTED: uncharacterized protein LOC104107561 [Nicotiana tomentosiformis]
Length=421

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 148/201 (74%), Gaps = 15/201 (7%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  267
            ME  T+  S+ ++   P K+    +     FV+FGS+  +S   IK       VKL NR+
Sbjct  1    METATAFGSAFSICYRPTKA----SLGGSDFVRFGSQFRISPSGIKLYPSVSHVKLSNRK  56

Query  268  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  447
             AFGS KC SIRASL  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   AAFGSRKCTSIRASLSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  448  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            QLQT+R+ E+Q E    EPSA+GTDIVLYRRIAEVKAN+R+KALEEILYALVVQKFMDA+
Sbjct  117  QLQTERDSEQQKE----EPSATGTDIVLYRRIAEVKANDRKKALEEILYALVVQKFMDAN  172

Query  628  VPLVPAITSPSQNSSGSIDTL  690
            V LVPAI+ PS   SG IDT 
Sbjct  173  VSLVPAISPPSSEPSGRIDTW  193



>ref|XP_009780705.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
 ref|XP_009780706.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
Length=421

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 146/201 (73%), Gaps = 15/201 (7%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  267
            ME  T+  SS ++   P K+    +     FV+FGS+   S   IK       VKL N++
Sbjct  1    METATAFGSSFSICYRPTKA----SLGGSDFVRFGSQFRNSPSGIKLYPSISHVKLSNKK  56

Query  268  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  447
             AFGS KC SIRASL  S SG SA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   AAFGSRKCTSIRASLSPSESGRSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  448  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            QLQT+R+ E+Q E    EPSA+GTDIVLYRRIAEVKAN+R+KALEEILYALVVQKFMDA+
Sbjct  117  QLQTERDSEQQKE----EPSATGTDIVLYRRIAEVKANDRKKALEEILYALVVQKFMDAN  172

Query  628  VPLVPAITSPSQNSSGSIDTL  690
            V LVPAI+ PS   SG +DT 
Sbjct  173  VSLVPAISPPSSEPSGRVDTW  193



>ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum]
Length=421

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 144/201 (72%), Gaps = 15/201 (7%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  267
            ME  T+ RS  ++   P K+    + D   FV+ GS+  +S   IK       VKL NR+
Sbjct  1    METATAFRSGFSICYKPTKA----SLDGSDFVRVGSQLRMSPSGIKLYPSISHVKLSNRK  56

Query  268  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  447
            V+FGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57   VSFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  448  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
             L+TDR+ E+Q E    EPS +GTDIVLYRRIAEVKANER+K LEEILYALVVQKFMDA+
Sbjct  117  LLKTDRDAEQQKE----EPSPAGTDIVLYRRIAEVKANERKKTLEEILYALVVQKFMDAN  172

Query  628  VPLVPAITSPSQNSSGSIDTL  690
            V LVPAI+  S   SG IDT 
Sbjct  173  VSLVPAISPSSSEPSGRIDTW  193



>ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 [Solanum lycopersicum]
Length=421

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 143/204 (70%), Gaps = 21/204 (10%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPSIK-------VKLG  258
            ME  T+ RS  ++ C       R T  A G   FV+ GS+  +S   IK       VKL 
Sbjct  1    METATAFRSGFSI-CN------RATKAALGGSDFVRVGSQLRMSPSGIKLYPSISHVKLS  53

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  438
            NR+VAFGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL QIL SHPHLVSAAVDQ
Sbjct  54   NRKVAFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLCQILTSHPHLVSAAVDQ  113

Query  439  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  618
            QLE L+ DR+ E+Q E    EPS +GTDIVLYRRIAEVKANER+K LEEILYALVVQKFM
Sbjct  114  QLELLKIDRDAEQQKE----EPSIAGTDIVLYRRIAEVKANERKKTLEEILYALVVQKFM  169

Query  619  DADVPLVPAITSPSQNSSGSIDTL  690
            DA+V LVPAI+  S   SG IDT 
Sbjct  170  DANVSLVPAISPSSSEPSGRIDTW  193



>ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum]
Length=421

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 142/188 (76%), Gaps = 21/188 (11%)
 Frame = +1

Query  178  FTTDAPGFV----------KFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRA  306
            F++ +P +V          + GS++LLS   I+       VKLGNR+V F + KC  IRA
Sbjct  11   FSSVSPNWVARSGPARPELRVGSRSLLSYSWIRQRPSISHVKLGNRKVDFVTRKCTGIRA  70

Query  307  SLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE  486
            S+  S+SG +A PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+ EK+ E
Sbjct  71   SMQPSDSGSAAAPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDAEKEKE  130

Query  487  KQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
                EP+ASGT++VLYRRIAEVKANERRKALEEILYALVVQKFMDA+V L+P IT  S +
Sbjct  131  ----EPAASGTELVLYRRIAEVKANERRKALEEILYALVVQKFMDANVSLIPTITPSSPD  186

Query  667  SSGSIDTL  690
            +SG +D+ 
Sbjct  187  NSGRVDSW  194



>ref|XP_010069444.1| PREDICTED: uncharacterized protein LOC104456368 [Eucalyptus grandis]
 gb|KCW57801.1| hypothetical protein EUGRSUZ_H00558 [Eucalyptus grandis]
Length=423

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 142/197 (72%), Gaps = 18/197 (9%)
 Frame = +1

Query  121  TSLRSSITVGCGPVKSGRR---FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVA  273
            T+ RSS      P     R      D PGFV+FG  A L APS      ++ + G+RRVA
Sbjct  7    TAFRSSTVGALRPSPCASRSAVLAADGPGFVRFG--AGLPAPSKHYTSSLRSRAGHRRVA  64

Query  274  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  453
             GS +C  +RAS    ++G SA PIAPLKLESPIGQFL++ILVSHPHLV AAV+QQLEQL
Sbjct  65   VGSRRC-MVRASASFESAGSSA-PIAPLKLESPIGQFLSEILVSHPHLVPAAVEQQLEQL  122

Query  454  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  633
            QTDR+ E + E    EP+ASGT++VLYRRIAEVKANERRKALEEILYALVVQKFMDA+V 
Sbjct  123  QTDRDAETKKE----EPNASGTELVLYRRIAEVKANERRKALEEILYALVVQKFMDANVS  178

Query  634  LVPAITSPSQNSSGSID  684
            L+P+I + S+  SG +D
Sbjct  179  LIPSINTSSE-PSGRVD  194



>ref|XP_009360040.1| PREDICTED: uncharacterized protein LOC103950540 isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 8/177 (5%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSGGSA  339
             T + PGF++ G K    +    SI + K+G+RR+ FGS +   +RA    S  +S GSA
Sbjct  29   LTANGPGFLRLGPKTHSPIKHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSAGSA  88

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
             PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89   SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            D+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI SP+ + SG +D+ 
Sbjct  148  DLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAI-SPTSDPSGQVDSW  203



>ref|XP_009360039.1| PREDICTED: uncharacterized protein LOC103950540 isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 13/180 (7%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAP------SI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSG  330
             T + PGF++ G K    +P      SI + K+G+RR+ FGS +   +RA    S  +S 
Sbjct  29   LTANGPGFLRLGPKT--HSPIKQHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSA  86

Query  331  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  510
            GSA PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSA
Sbjct  87   GSASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSA  145

Query  511  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            SGTD+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI SP+ + SG +D+ 
Sbjct  146  SGTDLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAI-SPTSDPSGQVDSW  204



>emb|CDO98647.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 141/200 (71%), Gaps = 16/200 (8%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  267
            ME   + RSS+ +   P     R     P FV+FGS + ++  S+K       VKLG  R
Sbjct  1    METAATFRSSLGI---PSYYDVRSVVKGPDFVQFGSISRVTPASVKQHPLISHVKLGQSR  57

Query  268  VAFGSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
            V   S KC  IR+S+  S++ G +  PIAPL+LESPIGQFL++ILVSHPHLV AAV+QQL
Sbjct  58   VTLKSRKCTRIRSSMSSSSNSGGSTAPIAPLQLESPIGQFLSEILVSHPHLVPAAVEQQL  117

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            EQLQTDR+ E Q E    EP+ASGTD+VLYRRIAEVKANERRKALEEILYAL+VQKFMDA
Sbjct  118  EQLQTDRDAESQKE----EPAASGTDLVLYRRIAEVKANERRKALEEILYALIVQKFMDA  173

Query  625  DVPLVPAITSPSQNSSGSID  684
             V L+P+I  PS + SG +D
Sbjct  174  SVSLIPSI-GPSLDPSGQVD  192



>ref|XP_006374243.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374244.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52040.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52041.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=424

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  276
            ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1    MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVSY--SKLGHRRVAY  58

Query  277  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  453
            GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  454  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  633
            QTDR+    +EKQ ++PSA+GTD+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V 
Sbjct  119  QTDRD----SEKQKEDPSATGTDLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVS  174

Query  634  LVPAITSPSQNSSGSIDTL  690
            L+P I   S  SSG +DT 
Sbjct  175  LIPTIGPSSAESSGQVDTW  193



>ref|XP_006374246.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374247.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ABK96147.1| unknown [Populus trichocarpa]
 gb|ERP52043.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52044.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=417

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 140/199 (70%), Gaps = 11/199 (6%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  276
            ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1    MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVS--YSKLGHRRVAY  58

Query  277  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  453
            GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  454  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  633
            QTDR+    +EKQ ++PSA+GTD+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V 
Sbjct  119  QTDRD----SEKQKEDPSATGTDLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVS  174

Query  634  LVPAITSPSQNSSGSIDTL  690
            L+P I   S  SSG +DT 
Sbjct  175  LIPTIGPSSAESSGQVDTW  193



>ref|XP_008240405.1| PREDICTED: uncharacterized protein LOC103338912 [Prunus mume]
Length=428

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 129/173 (75%), Gaps = 9/173 (5%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  351
            F   +PGF  F  K   S    KV  G+RR+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  37   FLRLSPGF-HFSIKHQFSISQPKV--GHRRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  93

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  94   PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  149

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            YRRIAEVKA ERRKALEEILY LVVQKFMDA+V L+PA+T  + + SG +DT 
Sbjct  150  YRRIAEVKATERRKALEEILYTLVVQKFMDANVSLIPALTPSASDLSGRVDTW  202



>ref|XP_011047792.1| PREDICTED: uncharacterized protein LOC105142042 [Populus euphratica]
Length=418

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%), Gaps = 12/200 (6%)
 Frame = +1

Query  109  MEMTTSLRSSITVGC-GPVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLG-NRRVA  273
            ME  T+     ++G  GP KS  R     T+   FV+F  K   S      KLG +RRVA
Sbjct  1    MEAATATVIGSSIGISGPGKSVARLGFLATNKQDFVRFPIKRHSSVSY--SKLGSHRRVA  58

Query  274  FGSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  450
            +GS +  ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQ
Sbjct  59   YGSRRYMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQ  118

Query  451  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  630
            LQTDR+    +EKQ ++PSA+GTD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA+V
Sbjct  119  LQTDRD----SEKQKEDPSATGTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDANV  174

Query  631  PLVPAITSPSQNSSGSIDTL  690
             L+P I   S  SSG +D+ 
Sbjct  175  SLIPTIAPSSTESSGQVDSW  194



>ref|XP_002533448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28932.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 135/201 (67%), Gaps = 16/201 (8%)
 Frame = +1

Query  88   IRHCCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRR  267
            +R+   M + +T++  S+ +             + PGF++F +    S+ S   K G RR
Sbjct  9    VRYPIGMYKPSTTVGRSVFLAA-----------NGPGFLRFSTTKHYSSVSYG-KQGYRR  56

Query  268  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  447
             AFG+ +  ++RAS   S+  G    IAPL+LESPIGQFL+QIL++HPHLV AAV+QQLE
Sbjct  57   EAFGNRRYTAVRASSSSSDRAGPPAQIAPLQLESPIGQFLSQILINHPHLVPAAVEQQLE  116

Query  448  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            QLQTDR+ +K  E    EPS SGTD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA+
Sbjct  117  QLQTDRDADKHKE----EPSVSGTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDAN  172

Query  628  VPLVPAITSPSQNSSGSIDTL  690
            V LVP+I   S   S  +D  
Sbjct  173  VSLVPSIAPASAEPSDPVDMW  193



>ref|XP_007036963.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21464.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=360

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 12/176 (7%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  43   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  101

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  516
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  102  APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  157

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D
Sbjct  158  TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVD  213



>ref|XP_007209930.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
 gb|EMJ11129.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
Length=502

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 9/173 (5%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  351
            F   +PGF  F  K   S    KV  G+ R+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  111  FLRLSPGF-HFSIKHQFSISQPKV--GHWRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  167

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  168  PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  223

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            YRRIAEVKA ERRKALEEILY LVVQKFMDA+V L+PA+T  + + SG +DT 
Sbjct  224  YRRIAEVKATERRKALEEILYTLVVQKFMDANVSLIPALTPSASDLSGRVDTW  276



>gb|EYU21849.1| hypothetical protein MIMGU_mgv1a007186mg [Erythranthe guttata]
Length=416

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 129/170 (76%), Gaps = 11/170 (6%)
 Frame = +1

Query  202  VKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  360
            ++  S+++LS   I+       +K G+R+V   S K  SIRAS    +SG S+ PIAPL+
Sbjct  29   LRLASRSVLSNAWIQQRQSISHMKFGSRKVEPLSKKRTSIRASKQSPDSGNSSAPIAPLQ  88

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
            LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E  NEK++   SASGT++VLYRR
Sbjct  89   LESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAE--NEKED--LSASGTELVLYRR  144

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            I EVKANERR+ALEEILYALVVQKFMD ++PLVP IT  S + SG +DT 
Sbjct  145  IQEVKANERREALEEILYALVVQKFMDVNIPLVPTITPSSPDKSGRVDTW  194



>ref|XP_008393457.1| PREDICTED: uncharacterized protein LOC103455652 isoform X2 [Malus 
domestica]
Length=431

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 134/177 (76%), Gaps = 7/177 (4%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM-  342
             T + PGF++ G K    +    SI + K+G+RR+ +GS +   +RA+   S+   +   
Sbjct  29   LTANGPGFLRLGPKTHSPIKHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGSA  88

Query  343  -PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
             PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89   SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            D+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI+  + + SG +D+ 
Sbjct  148  DLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAISPTASDPSGQVDSW  204



>ref|XP_007036962.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21463.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 12/176 (7%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  516
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89   APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D
Sbjct  145  TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVD  200



>ref|XP_007036961.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21462.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 12/176 (7%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALL------SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30   LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  516
             PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89   APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D
Sbjct  145  TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVD  200



>ref|XP_008393456.1| PREDICTED: uncharacterized protein LOC103455652 isoform X1 [Malus 
domestica]
Length=432

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 131/178 (74%), Gaps = 8/178 (4%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKV-----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  342
             T + PGF++ G K        +      K+G+RR+ +GS +   +RA+   S+   +  
Sbjct  29   LTANGPGFLRLGPKTHSPIKQHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGS  88

Query  343  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  516
              PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASG
Sbjct  89   ASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASG  147

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            TD+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI+  + + SG +D+ 
Sbjct  148  TDLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAISPTASDPSGQVDSW  205



>ref|XP_002317709.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 ref|XP_006376704.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ABK95039.1| unknown [Populus trichocarpa]
 gb|EEE95929.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ERP54501.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
Length=401

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 138/198 (70%), Gaps = 11/198 (6%)
 Frame = +1

Query  109  MEMTTSLRSSITVG-CGPVKSGRR---FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  276
            ME  T+     ++G C P KS  R     T    FV+F  K   S      K G+RRVA+
Sbjct  1    MEAATATFIGSSIGICRPAKSVARSGFLATIGQDFVRFPHKHCSSVSY--SKPGHRRVAY  58

Query  277  GSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  453
            GS +C  +RASL  S+    ++  IAPL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQL
Sbjct  59   GSRRCMGVRASLSSSSDSSGSIASIAPLQLESPVGQFLSQILISHPHLVPAAVEQQLEQL  118

Query  454  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  633
            QTDR+ EKQ E    EPSA+ TD+VLYR+IAEVKANERRKALEEILYALVVQKFMDA+V 
Sbjct  119  QTDRDAEKQKE----EPSATSTDLVLYRKIAEVKANERRKALEEILYALVVQKFMDANVS  174

Query  634  LVPAITSPSQNSSGSIDT  687
            L+  + S S + SG +DT
Sbjct  175  LISTMASSSTDPSGGVDT  192



>ref|XP_006493269.1| PREDICTED: uncharacterized protein LOC102611948 isoform X1 [Citrus 
sinensis]
 ref|XP_006493270.1| PREDICTED: uncharacterized protein LOC102611948 isoform X2 [Citrus 
sinensis]
Length=418

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = +1

Query  190  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             P F++FG+K+LL           K  +RR  FGS +C  +RAS    +SG S  PIAPL
Sbjct  28   GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASSSSESSG-SMDPIAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK  E    E SASGT++VLYR
Sbjct  87   QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEKHKE----EASASGTELVLYR  142

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT 
Sbjct  143  RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTW  193



>ref|XP_006441318.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441319.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441320.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54558.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54559.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54560.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
Length=417

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +1

Query  190  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             P F++FG+K+LL           K  +RR  FGS +C  +RAS    +S  S  PIAPL
Sbjct  28   GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASSSSESSR-SMDPIAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYR
Sbjct  87   QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYR  141

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT 
Sbjct  142  RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTW  192



>ref|XP_009355996.1| PREDICTED: uncharacterized protein LOC103946898 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 131/179 (73%), Gaps = 14/179 (8%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + PGF++ G KA   +PS       + K+G+RR+ +G+ +   +RA+   S+   + 
Sbjct  29   LTANGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSAG  86

Query  340  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  513
               PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSAS
Sbjct  87   SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSAS  142

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            GTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  + + SG +D+ 
Sbjct  143  GTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASDPSGRVDSW  201



>gb|KDO47166.1| hypothetical protein CISIN_1g014467mg [Citrus sinensis]
Length=424

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 129/171 (75%), Gaps = 10/171 (6%)
 Frame = +1

Query  190  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             P F++FG+K+LL           K  +RR  FGS +C  +RAS    +S  S  PIAPL
Sbjct  35   GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASSSSESSR-SMDPIAPL  93

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYR
Sbjct  94   QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYR  148

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT 
Sbjct  149  RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTW  199



>ref|XP_010241168.1| PREDICTED: uncharacterized protein LOC104585831 [Nelumbo nucifera]
Length=424

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 129/204 (63%), Gaps = 18/204 (9%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  258
            ME    LRSS  + C P   V      T  AP FV F SK  LS   IK        K G
Sbjct  1    MEAVAVLRSSSGI-CKPPNFVTESGFLTARAPDFVFFNSKLRLSNGWIKHSPSTYLSKQG  59

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  438
                 F S K   ++AS    +S  SA PIAPLKLESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60   QSSSVFKSRKRTIMKASAS-QDSTESASPIAPLKLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  439  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  618
            QLEQLQTDR+ EKQ E    EPS+S TD+VLYRRIAEVKA ERRKALEEILYALVVQKFM
Sbjct  119  QLEQLQTDRDAEKQKE----EPSSSSTDLVLYRRIAEVKATERRKALEEILYALVVQKFM  174

Query  619  DADVPLVPAITSPSQNSSGSIDTL  690
            D +V L+P I   S   SG +DT 
Sbjct  175  DGNVFLIPTIL--SSKPSGRVDTW  196



>ref|XP_009355995.1| PREDICTED: uncharacterized protein LOC103946898 isoform X1 [Pyrus 
x bretschneideri]
Length=429

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 15/180 (8%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  336
             T + PGF++ G KA   +PS        + K+G+RR+ +G+ +   +RA+   S+   +
Sbjct  29   LTANGPGFLRLGPKA--HSPSKEHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSA  86

Query  337  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  510
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSA
Sbjct  87   GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSA  142

Query  511  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            SGTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  + + SG +D+ 
Sbjct  143  SGTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASDPSGRVDSW  202



>ref|XP_011003767.1| PREDICTED: uncharacterized protein LOC105110429 [Populus euphratica]
Length=401

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = +1

Query  199  FVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPI  375
            FV+F  K   S      K G+RRVA+GS +C  +RASL  S+    ++  IAPL+LESP+
Sbjct  35   FVRFPHKHYSSVSY--SKPGHRRVAYGSRRCMGVRASLSSSSDSSGSIASIAPLQLESPV  92

Query  376  GQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVK  555
            GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EKQ E    EPSA+ TD+VLYR+IAEVK
Sbjct  93   GQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEKQKE----EPSATSTDLVLYRKIAEVK  148

Query  556  ANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT  687
            ANERRKALEEILYALVVQKFMDA++ L+  I S S++ SG ++T
Sbjct  149  ANERRKALEEILYALVVQKFMDANISLISTIASSSKDPSGGLNT  192



>ref|XP_010091765.1| hypothetical protein L484_019353 [Morus notabilis]
 gb|EXB45128.1| hypothetical protein L484_019353 [Morus notabilis]
Length=431

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 136/179 (76%), Gaps = 9/179 (5%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAP---SIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI  348
             T++   F  FG+   LS     S + KLG++R++FGS +   +RAS   S+SG S  PI
Sbjct  28   LTSNRTSFPCFGTNFGLSMKHKTSSRSKLGHKRISFGSRRFLLVRAST-SSDSGSSDSPI  86

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQ-----NEKQNDEPSAS  513
            APL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+  +Q     + ++++EPSA+
Sbjct  87   APLQLESPVGQFLSQILMSHPHLVPAAVEQQLEQLQTDRDAAQQLQTDCDAEKSEEPSAT  146

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            GTD+ LYRRIAEVKANERRKALEEILYALVVQKFMDA+V LVP+I + + + SG +D+ 
Sbjct  147  GTDLALYRRIAEVKANERRKALEEILYALVVQKFMDANVSLVPSIETSASDPSGCVDSW  205



>ref|XP_008466989.1| PREDICTED: uncharacterized protein LOC103504355 [Cucumis melo]
Length=422

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +1

Query  196  GFVKFGSKALLSAPSIKV-------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAP  354
            GFV+F S   LS   I++       KL N+++  G  +   ++AS+  + S  S  PIAP
Sbjct  33   GFVRFPS---LSHVPIRLCPQVSYSKLWNKKLGTGIRRSTIVKASMD-AESSESGEPIAP  88

Query  355  LKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLY  534
            L+LESPIGQFLTQILVSHPHLV AAV+QQL+QLQ DR+ E      N+E S SGTD+VLY
Sbjct  89   LQLESPIGQFLTQILVSHPHLVPAAVEQQLDQLQNDRDAEG-----NNEASGSGTDLVLY  143

Query  535  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RRIAEVKANER++ LEEILYALVVQKFMDA+VPL+PAIT  S + SG +DT 
Sbjct  144  RRIAEVKANERKQVLEEILYALVVQKFMDANVPLIPAITPSSSDVSGRVDTW  195



>ref|XP_004137518.1| PREDICTED: uncharacterized protein LOC101203627 [Cucumis sativus]
 ref|XP_004167487.1| PREDICTED: uncharacterized protein LOC101228590 [Cucumis sativus]
Length=422

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 134/200 (67%), Gaps = 17/200 (9%)
 Frame = +1

Query  115  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  270
            M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  5    MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  61

Query  271  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  450
              G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  62   GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  120

Query  451  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  630
            LQ DR+ E      N E S SGTD+VLYRRIAEVKANER++ LEEILYALVVQKFMDA+V
Sbjct  121  LQNDRDAEG-----NKEASGSGTDLVLYRRIAEVKANERKQVLEEILYALVVQKFMDANV  175

Query  631  PLVPAITSPSQNSSGSIDTL  690
            PL+PAIT  S + SG +DT 
Sbjct  176  PLIPAITPSSSDVSGRVDTW  195



>ref|XP_010271178.1| PREDICTED: uncharacterized protein LOC104607271 [Nelumbo nucifera]
Length=424

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 130/204 (64%), Gaps = 18/204 (9%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  258
            ME    LRSS  +G  P    KSG   T  AP FV   SK   S   IK        K  
Sbjct  1    MEAVAVLRSSSGIGKHPDFVAKSGV-LTASAPHFVCLSSKLRFSNVWIKHSPSTYLSKQR  59

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  438
              R    S K   +RAS    +S  SA PIAPL+LESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60   QSRSVSRSRKSTIVRASAS-QDSTESAAPIAPLQLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  439  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  618
             LEQLQT R+ EKQ E    EP++SGTD+VLYRRIAEVKANERRKALEEILYAL+VQKFM
Sbjct  119  HLEQLQTSRDAEKQKE----EPASSGTDLVLYRRIAEVKANERRKALEEILYALIVQKFM  174

Query  619  DADVPLVPAITSPSQNSSGSIDTL  690
            DA+V L+P I   S + SG +DT 
Sbjct  175  DANVSLIPTIL--SSDPSGPVDTW  196



>ref|XP_008356700.1| PREDICTED: uncharacterized protein LOC103420417 isoform X2 [Malus 
domestica]
Length=428

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 128/179 (72%), Gaps = 14/179 (8%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T   PGF++ G KA   +PS       + K+G+RR+ +GS +   +RA+   S+   + 
Sbjct  29   LTAHGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSAG  86

Query  340  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  513
               PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSAS
Sbjct  87   SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSAS  142

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            GTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  143  GTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  201



>ref|XP_008356699.1| PREDICTED: uncharacterized protein LOC103420417 isoform X1 [Malus 
domestica]
Length=429

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  336
             T   PGF++ G KA   +PS        + K+G+RR+ +GS +   +RA+   S+   +
Sbjct  29   LTAHGPGFLRLGPKA--HSPSKQHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSA  86

Query  337  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  510
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSA
Sbjct  87   GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSA  142

Query  511  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            SGTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  143  SGTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  202



>ref|XP_002894114.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70373.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 16/185 (9%)
 Frame = +1

Query  166  SGRR--FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLS  321
            SGR    T + PGF++FGS+       +KV+L N  + F      G+T   S R+ +  +
Sbjct  19   SGRSILLTPNCPGFMRFGSRPQFR---LKVRLQNSSLKFSRPLQSGTTCAKSRRSFVVKA  75

Query  322  NSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  495
            ++ G A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   
Sbjct  76   SASGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDSEEQSK---  132

Query  496  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSG  675
            D  S  GTDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG
Sbjct  133  DASSVPGTDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVSLVPSITSSSADPSG  192

Query  676  SIDTL  690
             +DT 
Sbjct  193  RVDTW  197



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 134/200 (67%), Gaps = 17/200 (9%)
 Frame = +1

Query  115  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  270
            M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  171  MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  227

Query  271  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  450
              G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  228  GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  286

Query  451  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  630
            LQ DR+ E      N E S SGTD+VLYRRIAEVKANER++ LEEILYALVVQKFMDA+V
Sbjct  287  LQNDRDAEG-----NKEASGSGTDLVLYRRIAEVKANERKQVLEEILYALVVQKFMDANV  341

Query  631  PLVPAITSPSQNSSGSIDTL  690
            PL+PAIT  S + SG +DT 
Sbjct  342  PLIPAITPSSSDVSGRVDTW  361



>emb|CBI35458.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
            F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  28   FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  87   QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  142

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANER+KALEEILYALVVQKFMDA+V L+P I+S S +SS  +DT 
Sbjct  143  RIAEVKANERKKALEEILYALVVQKFMDANVSLIPTISSSSSDSSDRVDTW  193



>gb|KDP30111.1| hypothetical protein JCGZ_18399 [Jatropha curcas]
Length=431

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 9/149 (6%)
 Frame = +1

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAM-----PIAPLKLESPIGQFLTQILVSHPHLVS  423
            N+RV FGS +C  ++AS   S+S  S       PIAPL++ESPIGQFL+QIL+SHPHLV 
Sbjct  62   NKRVGFGSRRCTVVKASSSSSSSPSSDSGGSLAPIAPLQMESPIGQFLSQILMSHPHLVP  121

Query  424  AAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALV  603
            AAV+QQLEQLQTDR+ +K+ E    EPS +GTD+VLYRRIAEVKANER+KALEEILYALV
Sbjct  122  AAVEQQLEQLQTDRDADKEKE----EPSVTGTDLVLYRRIAEVKANERKKALEEILYALV  177

Query  604  VQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VQKFMDA+V L P I   S + S  +DT 
Sbjct  178  VQKFMDANVSLTPTIAPSSADESDRVDTW  206



>ref|XP_002267281.3| PREDICTED: uncharacterized protein LOC100262899 [Vitis vinifera]
Length=443

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
            F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  52   FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  110

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  111  QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  166

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANER+KALEEILYALVVQKFMDA+V L+P I+S S +SS  +DT 
Sbjct  167  RIAEVKANERKKALEEILYALVVQKFMDANVSLIPTISSSSSDSSDRVDTW  217



>ref|XP_006374245.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52042.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=354

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +1

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
            +PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+    +EKQ ++PSA+GT
Sbjct  18   VPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRD----SEKQKEDPSATGT  73

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            D+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V L+P I   S  SSG +DT 
Sbjct  74   DLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVSLIPTIGPSSAESSGQVDTW  130



>gb|EYU24493.1| hypothetical protein MIMGU_mgv1a007418mg [Erythranthe guttata]
Length=408

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 122/162 (75%), Gaps = 15/162 (9%)
 Frame = +1

Query  193  PGFVKFGS-KALLSAPSIKVKL-------GNRRVAFGSTKCNSIRASL-PLSNSGGSAMP  345
            P F++ GS K++LS    + +L       GN  V F +TK + I AS+   S+SGGS  P
Sbjct  31   PNFLRVGSPKSILSGAWPQQRLLISRKNGGNCGVDFMNTKKSWIGASMQKHSDSGGSIDP  90

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+LESPIGQFL++I++SHPHLVSAAV+QQLEQLQTD +  K+      E SASGT++
Sbjct  91   IAPLELESPIGQFLSKIMISHPHLVSAAVEQQLEQLQTDLDAVKE------ESSASGTEL  144

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            VLYRRIAEVKANERRK LEEILYALVVQKFMDADV LVP IT
Sbjct  145  VLYRRIAEVKANERRKTLEEILYALVVQKFMDADVALVPNIT  186



>gb|EPS73872.1| hypothetical protein M569_00881 [Genlisea aurea]
Length=411

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 114/143 (80%), Gaps = 6/143 (4%)
 Frame = +1

Query  253  LGNRRVAFGSTKCNSI-RASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  429
            LGNR+ +F S++   + RAS+  S+ G S  PIAPL+LESP+GQFL+ IL+SHPHLV AA
Sbjct  50   LGNRKPSFSSSRQRPVTRASIHPSDFGSSQAPIAPLQLESPVGQFLSNILMSHPHLVPAA  109

Query  430  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  609
            V+QQLEQLQTDR    Q E+   EPSASGT++VLYRRIAEVKANERRK LEEILYALVVQ
Sbjct  110  VEQQLEQLQTDR----QAEQTKQEPSASGTELVLYRRIAEVKANERRKVLEEILYALVVQ  165

Query  610  KFMDADVPLVPAITSPSQNSSGS  678
            KFM A+VPL  +IT PS +SS +
Sbjct  166  KFMAANVPLTSSIT-PSPDSSNT  187



>ref|XP_010936872.1| PREDICTED: uncharacterized protein LOC105056391 [Elaeis guineensis]
Length=418

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 120/171 (70%), Gaps = 14/171 (8%)
 Frame = +1

Query  193  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  351
            P FV F  K+   +  +K        KLG R   F   +   IRASL   NS  S+ PIA
Sbjct  31   PDFVSFDPKSHFRSRWLKGCRPISVRKLGQR--GFSDRRNTGIRASLSSPNSSESSSPIA  88

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQL TDR  EK  E    EPS SGTD+VL
Sbjct  89   PLRLESPIGQFLSQILISHPHLVPAAVDQQLEQLHTDREAEKSKE----EPSPSGTDLVL  144

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            YRRIAEVKA ERR+ALEEILYALVVQKFM+ADV L+PA+ S S + SG +D
Sbjct  145  YRRIAEVKAEERRRALEEILYALVVQKFMEADVSLIPAL-SQSTDPSGRVD  194



>ref|XP_008798412.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
 ref|XP_008798421.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
Length=418

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 120/167 (72%), Gaps = 16/167 (10%)
 Frame = +1

Query  193  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  351
            P FV F  ++  S+  +K        KLG R   FG  + + IRASL   NS  S+ PIA
Sbjct  31   PDFVSFDPRSHFSSRWLKGCRSISVRKLGQR--GFGDRRNSGIRASLSSPNSSESSSPIA  88

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQL+QLQTDR  EK  E    EPS SGTD+VL
Sbjct  89   PLQLESPIGQFLSQILISHPHLVPAAVDQQLDQLQTDREAEKNKE----EPSPSGTDLVL  144

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAI---TSPSQ  663
            YRRIAEVKA ERR+ALEEILYALVVQKFM+ADV LVP +   T PS+
Sbjct  145  YRRIAEVKAKERRRALEEILYALVVQKFMEADVSLVPTLSQSTDPSE  191



>ref|XP_006306266.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
 gb|EOA39164.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
Length=421

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 14/193 (7%)
 Frame = +1

Query  127  LRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRA  306
            ++SSI++   P KS    T + PGF++FGS      P  +++  + R     T   S R 
Sbjct  9    VQSSISLRQSPDKS-MFLTPNCPGFMRFGS-----GPQFRLRQKSSRPLQSRTSNVSSRR  62

Query  307  SLPL---SNSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  471
            S  +   ++SGG A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ 
Sbjct  63   SFVVKASASSGGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDA  122

Query  472  EKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E+Q +   D+ S  GTDIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+IT
Sbjct  123  EEQIK---DDSSVPGTDIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSIT  179

Query  652  SPSQNSSGSIDTL  690
            S S + SG +DT 
Sbjct  180  SSSADPSGRVDTW  192



>gb|KJB30250.1| hypothetical protein B456_005G134400 [Gossypium raimondii]
Length=422

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 8/127 (6%)
 Frame = +1

Query  319  SNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  489
            S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ +++ E 
Sbjct  75   SSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDTDEKKE-  133

Query  490  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  669
               EPSASGTD+VLYRRIAEVKANER++ALEEILYALVVQKFMDA++ LVPAITS S + 
Sbjct  134  ---EPSASGTDLVLYRRIAEVKANERKRALEEILYALVVQKFMDANISLVPAITS-SADP  189

Query  670  SGSIDTL  690
            SG +DT 
Sbjct  190  SGRVDTW  196



>ref|XP_010461662.1| PREDICTED: uncharacterized protein LOC104742359 isoform X1 [Camelina 
sativa]
 ref|XP_010461663.1| PREDICTED: uncharacterized protein LOC104742359 isoform X2 [Camelina 
sativa]
 ref|XP_010461664.1| PREDICTED: uncharacterized protein LOC104742359 isoform X3 [Camelina 
sativa]
Length=428

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 122/177 (69%), Gaps = 8/177 (5%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25   LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGDAST  84

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
              IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q   ++D+ S  GT
Sbjct  85   DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQ--IRDDDSSVPGT  142

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            DIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  143  DIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTW  199



>ref|XP_006849427.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
 gb|ERN11008.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
Length=439

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 9/162 (6%)
 Frame = +1

Query  208  FGSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  384
            F + +L  +PS+ + K  + R+A  S +    +AS+   +S G + PIAPL++ESPIGQF
Sbjct  42   FANSSLKYSPSVVLPKHVHTRMAQRSRRNMVAKASM---DSNGDSGPIAPLQMESPIGQF  98

Query  385  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  564
            L+QIL +HPHL+ AAVDQQLEQLQTDR+ E + E    EPS SGTD+VLYRRIAEVKANE
Sbjct  99   LSQILKNHPHLLPAAVDQQLEQLQTDRDSESEKE----EPSPSGTDLVLYRRIAEVKANE  154

Query  565  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RRKALEEI+YAL+VQKFMDA+V L+P+++S   N+S  +DT 
Sbjct  155  RRKALEEIIYALIVQKFMDAEVSLIPSVSSSPDNTS-KVDTW  195



>ref|XP_009414789.1| PREDICTED: uncharacterized protein LOC103995816 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 8/156 (5%)
 Frame = +1

Query  205  KFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  384
            ++ +  L S  SI +    RR+ FG+ +   +RAS   S+S  S++PIAPL+LESPIGQF
Sbjct  42   RYSTLWLKSDSSISLSKQGRRL-FGARRSIGVRAS---SSSSESSLPIAPLQLESPIGQF  97

Query  385  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  564
            L+QILVSHPHL+ AAVDQQLEQLQTDR  EK  E    EP+ SGTDIVLYRRIAEVKANE
Sbjct  98   LSQILVSHPHLLPAAVDQQLEQLQTDREAEKNKE----EPAPSGTDIVLYRRIAEVKANE  153

Query  565  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSS  672
            RR ALEEILYALV+QKF++ADV LVPAI+  +  SS
Sbjct  154  RRTALEEILYALVIQKFVEADVSLVPAISQSTDPSS  189



>gb|KJB53076.1| hypothetical protein B456_008G292100 [Gossypium raimondii]
Length=411

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 5/145 (3%)
 Frame = +1

Query  256  GNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVD  435
             N+R+   S +   +RAS    ++  S   IAPL++ESP GQFL+QIL+SHPHLV AAV+
Sbjct  54   WNKRMVLESRRGIVVRASSSPDSTDPSDP-IAPLRMESPTGQFLSQILISHPHLVPAAVE  112

Query  436  QQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKF  615
            QQL+QLQT+ + E++ E    E SASGTD+VLYRRIAEVKANER++ALEEILYALVVQKF
Sbjct  113  QQLKQLQTEWDTEQKKE----ELSASGTDLVLYRRIAEVKANERKRALEEILYALVVQKF  168

Query  616  MDADVPLVPAITSPSQNSSGSIDTL  690
            MDADV LVPAIT  S+NSSG +DT 
Sbjct  169  MDADVSLVPAITPSSKNSSGQVDTW  193



>gb|KHG11329.1| Alanine--tRNA ligase [Gossypium arboreum]
 gb|KHG12308.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=428

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 108/127 (85%), Gaps = 8/127 (6%)
 Frame = +1

Query  319  SNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  489
            S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQ+DR+ +++ E 
Sbjct  81   SSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAVEQQLEQLQSDRDTDEKKE-  139

Query  490  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  669
               EPSASGTD+VLYRRIAEVKANER++ALEEILYALVVQKFMDA++ LVPAITS S + 
Sbjct  140  ---EPSASGTDLVLYRRIAEVKANERKRALEEILYALVVQKFMDANISLVPAITS-SADP  195

Query  670  SGSIDTL  690
            SG +DT 
Sbjct  196  SGRVDTW  202



>ref|XP_006393405.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
 gb|ESQ30691.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
Length=426

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 125/176 (71%), Gaps = 11/176 (6%)
 Frame = +1

Query  178  FTTDAPGFVKFGSK---ALLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSAM  342
             T   PGF++FGS     L    S+KV   L +R  +  S +   ++AS   ++   S  
Sbjct  28   LTASCPGFMRFGSGPQFRLRHNSSLKVSRPLQSRTTSVKSRRSLVVKAS---ASGDASTD  84

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
             IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+QN+   D  S  GTD
Sbjct  85   SIAPLELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQNK---DASSVPGTD  141

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+I+S S++ SG +DT 
Sbjct  142  IVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVSLVPSISSSSKDPSGRVDTW  197



>dbj|BAH56904.1| AT1G48450 [Arabidopsis thaliana]
Length=321

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 124/178 (70%), Gaps = 17/178 (10%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  339
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  340  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  516
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  137  TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTW  194



>ref|XP_009414790.1| PREDICTED: uncharacterized protein LOC103995816 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 114/145 (79%), Gaps = 9/145 (6%)
 Frame = +1

Query  238  SIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  417
            ++ +K G R   FG+ +   +RAS   S+S  S++PIAPL+LESPIGQFL+QILVSHPHL
Sbjct  45   TLWLKQGRR--LFGARRSIGVRAS---SSSSESSLPIAPLQLESPIGQFLSQILVSHPHL  99

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYA  597
            + AAVDQQLEQLQTDR  EK  E    EP+ SGTDIVLYRRIAEVKANERR ALEEILYA
Sbjct  100  LPAAVDQQLEQLQTDREAEKNKE----EPAPSGTDIVLYRRIAEVKANERRTALEEILYA  155

Query  598  LVVQKFMDADVPLVPAITSPSQNSS  672
            LV+QKF++ADV LVPAI+  +  SS
Sbjct  156  LVIQKFVEADVSLVPAISQSTDPSS  180



>ref|NP_001031154.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32294.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=342

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 124/178 (70%), Gaps = 17/178 (10%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  339
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  340  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  516
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  137  TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTW  194



>ref|NP_001185170.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32295.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=333

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 124/178 (70%), Gaps = 17/178 (10%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSAM  342
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  343  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  516
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  137  TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTW  194



>ref|XP_004513343.1| PREDICTED: uncharacterized protein LOC101494659 isoform X1 [Cicer 
arietinum]
 ref|XP_004513344.1| PREDICTED: uncharacterized protein LOC101494659 isoform X2 [Cicer 
arietinum]
Length=418

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = +1

Query  208  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  387
            F  K   S PS K   G R+++ GS +   +RA+   + S GS+  IAPLKLESPIGQFL
Sbjct  42   FSCKLHASVPSSKQGHG-RKLSVGSKRVFVVRAASSSAESSGSSSNIAPLKLESPIGQFL  100

Query  388  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANER  567
            +QILVSHPHL+SAAV++QLEQ QTDR+ ++Q EK    PSASGTD+VLYRRIAEVKA ER
Sbjct  101  SQILVSHPHLMSAAVERQLEQFQTDRDGDEQKEK----PSASGTDLVLYRRIAEVKAKER  156

Query  568  RKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RKA+EEILY LVVQKFMDADV L+P++     + SG +D+ 
Sbjct  157  RKAIEEILYTLVVQKFMDADVSLIPSVRP---HPSGQVDSW  194



>emb|CBI40011.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +1

Query  256  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  612
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  613  FMDADVPLVPAITSPSQNSSGSIDTL  690
            F+ A+VPL+P ++  S  SSG +D  
Sbjct  159  FVGANVPLIPRMSPSSLGSSGRVDNW  184



>gb|KHN43658.1| hypothetical protein glysoja_027724, partial [Glycine soja]
Length=370

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 7/147 (5%)
 Frame = +1

Query  250  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  429
            K G+ R   GS +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  7    KQGHARHRVGSKRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  66

Query  430  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  609
            V+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA ERR ALEEILYALVVQ
Sbjct  67   VEQQLEQFQTDCD----GDKQKKEPSASGTDLVLYRRIAEVKAKERRTALEEILYALVVQ  122

Query  610  KFMDADVPLVPAITSPSQNSSGSIDTL  690
            KFMDA++ L+P++T    N SG +D+ 
Sbjct  123  KFMDANISLIPSLTP---NHSGQVDSW  146



>ref|XP_008375019.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
 ref|XP_008375020.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
Length=428

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSASGTD
Sbjct  90   PIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSASGTD  145

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  146  IVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  201



>ref|XP_008375017.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
 ref|XP_008375018.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
Length=429

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSASGTD
Sbjct  91   PIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSASGTD  146

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  147  IVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  202



>ref|XP_009408539.1| PREDICTED: uncharacterized protein LOC103990949 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 130/216 (60%), Gaps = 47/216 (22%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  246
            ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1    MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  247  V----------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQI  396
            V          K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QI
Sbjct  49   VFDGYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQI  102

Query  397  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  576
            LVSHPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIAEVKANERR+A
Sbjct  103  LVSHPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIAEVKANERRRA  158

Query  577  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            LEEILYALVVQKF++ADV LVPAI   S + SG +D
Sbjct  159  LEEILYALVVQKFVEADVSLVPAICQ-SADPSGKVD  193



>ref|XP_010939981.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939982.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939983.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939984.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
Length=422

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 118/170 (69%), Gaps = 14/170 (8%)
 Frame = +1

Query  193  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  351
            PGFV F  K+L    S+K        KLG     F S +   I+AS    N   S+  IA
Sbjct  32   PGFVSFDPKSLFCTRSLKGCRSLSVSKLGQS--GFCSRRNTGIKASFSSPNPSESSSRIA  89

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQLQTDR    + EK    PS SGTD+VL
Sbjct  90   PLQLESPIGQFLSQILISHPHLVPAAVDQQLEQLQTDR----EAEKNKKGPSPSGTDVVL  145

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  681
            YRRIAEVKA ERR+ALEEILYALVVQKF++AD+ LVP++   + N+SG +
Sbjct  146  YRRIAEVKAKERRRALEEILYALVVQKFIEADISLVPSLAQLT-NASGKV  194



>ref|NP_175278.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79715.1|AC020889_23 T1N15.6 [Arabidopsis thaliana]
 gb|AAL57686.1| At1g48450/T1N15_5 [Arabidopsis thaliana]
 gb|AAN41342.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32293.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=423

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 124/178 (70%), Gaps = 17/178 (10%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSA-  339
            T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26   TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  340  -MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  516
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80   TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  137  TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTW  194



>gb|KFK36092.1| hypothetical protein AALP_AA4G076400 [Arabis alpina]
Length=424

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 123/169 (73%), Gaps = 10/169 (6%)
 Frame = +1

Query  193  PGFVKFGSKALLSAPSIKVK---LGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKL  363
            PGF++F SK     P  +++   L  R ++  S +   ++AS    +   S   IAPL+L
Sbjct  33   PGFMRFSSK-----PQFRLRHNSLQTRTISVKSRRSFVVKASAFDDDVSSSTDSIAPLQL  87

Query  364  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  543
            +SP+GQFL++ILVSHPHLV AAV+QQLEQLQ DR+LE+QN  ++   S  GTDIVLYRRI
Sbjct  88   KSPVGQFLSEILVSHPHLVPAAVEQQLEQLQIDRDLEEQN--KDSSSSVPGTDIVLYRRI  145

Query  544  AEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            AEVK  ERR+ALEEILYALVVQKFMDA+V LVP+I+S S +SSG +DT 
Sbjct  146  AEVKEKERRRALEEILYALVVQKFMDANVSLVPSISSSSADSSGRVDTW  194



>ref|XP_007160560.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
 gb|ESW32554.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
Length=405

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 7/113 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+LESP+GQFL+QILV+HPHLV AAVDQQLEQLQTDR+ ++Q E    EPSASGTD+
Sbjct  75   IAPLQLESPVGQFLSQILVNHPHLVPAAVDQQLEQLQTDRDADQQKE----EPSASGTDL  130

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L P++T    + SG +D
Sbjct  131  VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLTPSVTP---DISGKVD  180



>ref|XP_003534126.1| PREDICTED: uncharacterized protein LOC100802697 isoformX1 [Glycine 
max]
 ref|XP_003534127.1| PREDICTED: uncharacterized protein LOC100802697 isoformX2 [Glycine 
max]
 ref|XP_006587458.1| PREDICTED: uncharacterized protein LOC100802697 isoform X3 [Glycine 
max]
Length=414

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 115/176 (65%), Gaps = 19/176 (11%)
 Frame = +1

Query  163  KSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  342
            +S  RF+T     V F             K G+ R   GS +   +RA+     S     
Sbjct  34   RSNLRFSTKLSTSVSFS------------KQGHARHRVGSKRGFVVRAASFTPESSEPTS  81

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
             IAPLKLESPIGQFL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD
Sbjct  82   KIAPLKLESPIGQFLSQILISHPHLVPAAVEQQLEQFQTDCD----GDKQKKEPSASGTD  137

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            +VLYRRIAEVKA ERR ALEEILYALVVQKFMDA++ L+P++T    N SG +D+ 
Sbjct  138  LVLYRRIAEVKAKERRTALEEILYALVVQKFMDANISLIPSLTP---NHSGQVDSW  190



>ref|XP_009408547.1| PREDICTED: uncharacterized protein LOC103990949 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 129/213 (61%), Gaps = 44/213 (21%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  246
            ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1    MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  247  -------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVS  405
                    K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QILVS
Sbjct  49   GYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQILVS  102

Query  406  HPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEE  585
            HPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIAEVKANERR+ALEE
Sbjct  103  HPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIAEVKANERRRALEE  158

Query  586  ILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            ILYALVVQKF++ADV LVPAI   S + SG +D
Sbjct  159  ILYALVVQKFVEADVSLVPAICQ-SADPSGKVD  190



>emb|CDX95820.1| BnaC05g35710D [Brassica napus]
Length=415

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  SA GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSAPGTD  142

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT 
Sbjct  143  IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTW  198



>ref|XP_010687245.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687246.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 135/199 (68%), Gaps = 11/199 (6%)
 Frame = +1

Query  109  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPS--IKVKLGNRRVA  273
            ME  T LRS +++   P K   R +   P    F++F +    S  +   +VKL    ++
Sbjct  1    MEAATVLRSPLSISI-PQKLASRPSVSVPNGSSFMRFTNNFRFSKSTSPCRVKLEGGSLS  59

Query  274  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  453
              S K   +RAS   SNS  S  PIAPL+LESP+GQFL+QILVSHPHLV AAVDQQLEQL
Sbjct  60   SRSRKSLMVRASKS-SNSFDSTAPIAPLQLESPVGQFLSQILVSHPHLVPAAVDQQLEQL  118

Query  454  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  633
            QT+     ++EKQ +EPSASGTD+VLYRRIAEVK NERRK LEEILY LVVQKFMDA++ 
Sbjct  119  QTN----CESEKQKEEPSASGTDLVLYRRIAEVKENERRKTLEEILYTLVVQKFMDANIS  174

Query  634  LVPAITSPSQNSSGSIDTL  690
            L+P+I+  S N++  +D  
Sbjct  175  LIPSISPSSANATDRVDVW  193



>ref|XP_009145975.1| PREDICTED: uncharacterized protein LOC103869650 [Brassica rapa]
Length=415

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAE+K NERRK LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT 
Sbjct  143  IVLYRRIAELKENERRKTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTW  198



>ref|XP_002273280.1| PREDICTED: uncharacterized protein LOC100245443 isoform X1 [Vitis 
vinifera]
Length=411

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +1

Query  256  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  612
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  613  FMDADVPLVPAITSPSQNSSGSIDTL  690
            F+ A+VPL+P ++  S  SSG +D  
Sbjct  159  FVGANVPLIPRMSPSSLGSSGRVDNW  184



>emb|CDX92162.1| BnaA05g22450D [Brassica napus]
Length=415

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT 
Sbjct  143  IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTW  198



>gb|AGV54799.1| hypothetical protein [Phaseolus vulgaris]
Length=409

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 7/147 (5%)
 Frame = +1

Query  250  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  429
            K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  45   KHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  104

Query  430  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  609
            V+QQLEQ QTD +     +KQ  EP ASGTD+VLYRRIAEVKA ER+ ALEEILYALVVQ
Sbjct  105  VEQQLEQFQTDLD----GDKQKREPPASGTDLVLYRRIAEVKAKERKTALEEILYALVVQ  160

Query  610  KFMDADVPLVPAITSPSQNSSGSIDTL  690
            KFMDAD+ L+P++T    N SG +D+ 
Sbjct  161  KFMDADISLIPSLTP---NQSGRVDSW  184



>ref|XP_003528983.1| PREDICTED: uncharacterized protein LOC100777314 isoform X1 [Glycine 
max]
 ref|XP_006583474.1| PREDICTED: uncharacterized protein LOC100777314 isoform X2 [Glycine 
max]
 ref|XP_006583475.1| PREDICTED: uncharacterized protein LOC100777314 isoform X3 [Glycine 
max]
 ref|XP_006583476.1| PREDICTED: uncharacterized protein LOC100777314 isoform X4 [Glycine 
max]
 gb|KHN25098.1| hypothetical protein glysoja_027512 [Glycine soja]
Length=408

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 9/163 (6%)
 Frame = +1

Query  202  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  381
            ++F +K  LS      K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQ
Sbjct  31   LRFSTK--LSTSVAISKHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQ  88

Query  382  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  561
            FL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA 
Sbjct  89   FLSQILISHPHLVPAAVEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIAEVKAK  144

Query  562  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            ER+ ALEEILYALVVQKFMDA + L+P++T    N SG +D+ 
Sbjct  145  ERKTALEEILYALVVQKFMDASISLIPSLTP---NHSGQVDSW  184



>gb|ACU24516.1| unknown [Glycine max]
Length=408

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 114/163 (70%), Gaps = 9/163 (6%)
 Frame = +1

Query  202  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  381
            ++F +K  LS      K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQ
Sbjct  31   LRFSTK--LSTSVAISKHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQ  88

Query  382  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  561
            FL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA 
Sbjct  89   FLSQILISHPHLVPAAVEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIAEVKAK  144

Query  562  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            ER+ ALEEILYALVVQKFMDA + L+P++T    N SG +D+ 
Sbjct  145  ERKTALEEILYALVVQKFMDASISLIPSLTP---NHSGQVDSW  184



>gb|AFK42768.1| unknown [Lotus japonicus]
Length=412

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
            S+S  SA  IAPL+LESPIGQFL+QIL++ PHLV AAVDQQL QLQTDR+ E    KQN 
Sbjct  68   SDSDESANKIAPLQLESPIGQFLSQILINRPHLVPAAVDQQLLQLQTDRDSESDPNKQNQ  127

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            +PS+S TD+VLYRRIAEVKANERRKALEEILYALVVQKFM A++ L+P+IT    + +G 
Sbjct  128  DPSSSSTDLVLYRRIAEVKANERRKALEEILYALVVQKFMAANISLIPSITP---DPTGR  184

Query  679  IDTL  690
            +D+ 
Sbjct  185  VDSW  188



>gb|KEH26747.1| plant/T1N15-5 protein [Medicago truncatula]
Length=418

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 7/115 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPLKLESP+GQFL+QILVSHPHL+SAAV++QLEQ QTDR+  +Q EK    PSASGTD+
Sbjct  87   IAPLKLESPVGQFLSQILVSHPHLMSAAVERQLEQFQTDRDGYEQKEK----PSASGTDL  142

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVKA ERRKA+EEI+Y LVVQKFMDA+V LVP+IT+   N SG +D+ 
Sbjct  143  VLYRRIAEVKAKERRKAIEEIVYTLVVQKFMDANVSLVPSITA---NPSGQVDSW  194



>ref|XP_011464472.1| PREDICTED: uncharacterized protein LOC101299089 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 133/191 (70%), Gaps = 14/191 (7%)
 Frame = +1

Query  118  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  297
              + R S +VG  P+  G       P F+  G     S  SIK +LG     FG  +C  
Sbjct  14   VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIKHQLG-----FGRRRCLV  61

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  62   VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  121

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  657
            + EK+    SASGTD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVP+I   
Sbjct  122  KKEKEEA--SASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPSIAPA  179

Query  658  SQNSSGSIDTL  690
            + + SG +D  
Sbjct  180  ASDPSGRVDAW  190



>ref|XP_010465837.1| PREDICTED: uncharacterized protein LOC104746127 [Camelina sativa]
Length=410

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  84   PIAPLRLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  140

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP++T PS + SG +DT 
Sbjct  141  IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVT-PSSHPSGRVDTW  195



>ref|XP_009135549.1| PREDICTED: uncharacterized protein LOC103859727 [Brassica rapa]
Length=408

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 116/175 (66%), Gaps = 7/175 (4%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM----P  345
             TT APGF   GSK  L          ++ +   ST  +  R S  +  S  S      P
Sbjct  28   LTTSAPGFTPSGSKLQLRLKQNPFTRFSKPLQ-SSTTASKTRRSFVVKASAASDDASSKP  86

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTDI
Sbjct  87   IAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSLPGTDI  144

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+IT  S + SG +DT 
Sbjct  145  VLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSITPSSSDPSGRVDTW  199



>ref|XP_006297794.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
 gb|EOA30692.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
Length=412

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAEVK NER++ LEEILYALVVQKFM+A+V LVP++T PS + SG +DT 
Sbjct  140  IVLYRRIAEVKENERKRTLEEILYALVVQKFMEANVSLVPSVT-PSSDPSGRVDTW  194



>ref|XP_009145005.1| PREDICTED: uncharacterized protein LOC103868678 [Brassica rapa]
 emb|CDY23684.1| BnaA05g17450D [Brassica napus]
Length=407

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 117/175 (67%), Gaps = 17/175 (10%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVK----LGNRRVAFGSTKCNSIRASLPLSNSGGSAMP  345
             T  +PGF++F S      P  + +    L   R +   T     R S  + +S   +  
Sbjct  22   LTASSPGFIRFSS-----GPQFRHRHSTCLKLSRPSQSRTTSLKSRRSFVVKSSASDS--  74

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+Q   ++   S  GTDI
Sbjct  75   IAPLELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQ--IKDSSSSLPGTDI  132

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVK  ERRKALEEILYALVVQKFMDA+V LVP+ITS    SSG +DT 
Sbjct  133  VLYRRIAEVKEKERRKALEEILYALVVQKFMDANVSLVPSITS----SSGRVDTW  183



>dbj|BAJ34170.1| unnamed protein product [Thellungiella halophila]
Length=419

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 121/187 (65%), Gaps = 30/187 (16%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  333
             T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  29   LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  79

Query  334  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  489
            S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  80   SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  138

Query  490  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  669
              D  S+ GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+I SPS + 
Sbjct  139  --DATSSPGTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSI-SPS-DP  194

Query  670  SGSIDTL  690
            SG +DT 
Sbjct  195  SGRVDTW  201



>ref|XP_010479269.1| PREDICTED: uncharacterized protein LOC104758146 [Camelina sativa]
Length=429

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  339
             T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25   LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGESST  84

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
              IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q    +  P  +GT
Sbjct  85   DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQIRDDSSVP-GTGT  143

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            DIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  144  DIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTW  200



>gb|KFK39108.1| hypothetical protein AALP_AA3G202000 [Arabis alpina]
Length=418

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 125/184 (68%), Gaps = 14/184 (8%)
 Frame = +1

Query  166  SGRRF-TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--------PL  318
            SG  F T   PGF +FGS+  L +        +R     +T   + R+ +          
Sbjct  23   SGSMFLTASGPGFTRFGSELQLRSKQNAFSRVSRPSQSLTTSAKTRRSFVVRAAASSDGD  82

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
             +SG S+ PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+  + 
Sbjct  83   GSSGSSSKPIAPLELQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNKDASS  142

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            +P   GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+ADV L+P+I SPS + SG 
Sbjct  143  KP---GTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEADVSLIPSI-SPS-DPSGR  197

Query  679  IDTL  690
            +DT 
Sbjct  198  VDTW  201



>ref|XP_006406690.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
 gb|ESQ48143.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
Length=466

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 121/187 (65%), Gaps = 30/187 (16%)
 Frame = +1

Query  178  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  333
             T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  76   LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  126

Query  334  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  489
            S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  127  SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  185

Query  490  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  669
              D  S+ GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+I SPS + 
Sbjct  186  --DATSSPGTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSI-SPS-DP  241

Query  670  SGSIDTL  690
            SG +DT 
Sbjct  242  SGRVDTW  248



>ref|XP_010549033.1| PREDICTED: uncharacterized protein LOC104820333 isoform X1 [Tarenaya 
hassleriana]
Length=413

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 5/117 (4%)
 Frame = +1

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
            +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  80   VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  135

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            DIVLYRRIAEVK +ERR+ALEEILY LVVQKFMDA+V LVP+I S S + SG +DT 
Sbjct  136  DIVLYRRIAEVKESERRRALEEILYTLVVQKFMDANVSLVPSIKS-SSDPSGRVDTW  191



>ref|XP_010549034.1| PREDICTED: uncharacterized protein LOC104820333 isoform X2 [Tarenaya 
hassleriana]
Length=412

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 5/117 (4%)
 Frame = +1

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  519
            +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  79   VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  134

Query  520  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            DIVLYRRIAEVK +ERR+ALEEILY LVVQKFMDA+V LVP+I S S + SG +DT 
Sbjct  135  DIVLYRRIAEVKESERRRALEEILYTLVVQKFMDANVSLVPSIKS-SSDPSGRVDTW  190



>ref|XP_010500371.1| PREDICTED: uncharacterized protein LOC104777762 [Camelina sativa]
Length=429

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q     D+ S  GTDI
Sbjct  89   IAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQI---RDDSSVPGTDI  145

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  146  VLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTW  200



>ref|XP_004299503.1| PREDICTED: uncharacterized protein LOC101299089 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 132/191 (69%), Gaps = 13/191 (7%)
 Frame = +1

Query  118  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  297
              + R S +VG  P+  G       P F+  G     S  SIK      ++ FG  +C  
Sbjct  14   VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIK----QHQLGFGRRRCLV  62

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  63   VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  122

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  657
            + EK+    SASGTD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVP+I   
Sbjct  123  KKEKEEA--SASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPSIAPA  180

Query  658  SQNSSGSIDTL  690
            + + SG +D  
Sbjct  181  ASDPSGRVDAW  191



>emb|CDY58279.1| BnaCnng32840D [Brassica napus]
Length=425

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+L+SP+GQFL+QILVSHPHLV AA++QQLEQLQTDR  E +   ++   S  GTDI
Sbjct  85   IAPLQLKSPVGQFLSQILVSHPHLVPAAIEQQLEQLQTDR--EAEEHIKDSFSSLPGTDI  142

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVK  ERRKALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT 
Sbjct  143  VLYRRIAEVKEKERRKALEEILYALVVQKFMDANVSLVPSITSSSTDPSGRVDTW  197



>emb|CAN79123.1| hypothetical protein VITISV_030635 [Vitis vinifera]
Length=411

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 5/146 (3%)
 Frame = +1

Query  256  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            G+R++A G  +   +RA   + N S  SA  IAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43   GHRKMASGWKEQTMVRAXATVDNDSYESAAXIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  612
            ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103  ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  613  FMDADVPLVPAITSPSQNSSGSIDTL  690
            F+ A+VPL+P ++  S  SSG +D  
Sbjct  159  FVGANVPLIPRMSPSSLGSSGRVDNW  184



>ref|XP_010661178.1| PREDICTED: uncharacterized protein LOC100245443 isoform X2 [Vitis 
vinifera]
Length=365

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 107/142 (75%), Gaps = 5/142 (4%)
 Frame = +1

Query  268  VAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
            +A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV++QL
Sbjct  1    MASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAVERQL  60

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            EQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQKF+ A
Sbjct  61   EQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQKFVGA  116

Query  625  DVPLVPAITSPSQNSSGSIDTL  690
            +VPL+P ++  S  SSG +D  
Sbjct  117  NVPLIPRMSPSSLGSSGRVDNW  138



>emb|CDX82345.1| BnaA03g34760D [Brassica napus]
Length=406

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTD
Sbjct  85   PIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDTSSSLPGTD  142

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+IT PS + SG +DT 
Sbjct  143  IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSIT-PSSDPSGRVDTW  197



>emb|CDX75937.1| BnaC03g40200D [Brassica napus]
Length=414

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 116/179 (65%), Gaps = 6/179 (3%)
 Frame = +1

Query  166  SGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM-  342
            +G  F T + GF   GSK  +          ++ +   +T  +  R S  +  S  S   
Sbjct  23   AGSMFLTTSGGFTPSGSKLQVRLKQNAFTRFSKPLQTSTTTASKTRRSFVVKASAASDDA  82

Query  343  ---PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  513
               PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  
Sbjct  83   SSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSVP  140

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            GTDIVLYRRIAE+K NER + LEEILYALVVQKFM+A+V L+P+IT  S + SG +DT 
Sbjct  141  GTDIVLYRRIAELKENERHRTLEEILYALVVQKFMEANVSLIPSITPSSSDPSGRVDTW  199



>ref|XP_007152648.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
 gb|ESW24642.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
Length=403

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 105/134 (78%), Gaps = 5/134 (4%)
 Frame = +1

Query  265  RVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
            R + GS +   +RA+     S   +  +APLKLESPIGQFL+QIL+SHPHLV AAV++QL
Sbjct  56   RHSVGSKRGFVVRATSSFPESSEPSSNVAPLKLESPIGQFLSQILMSHPHLVPAAVERQL  115

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            EQ QTD  ++  N+K+  EP ASGTD+VLYRRIAEVKA ER+ ALEEILYALVVQKFMDA
Sbjct  116  EQFQTD--IDGDNQKR--EPPASGTDLVLYRRIAEVKAKERKTALEEILYALVVQKFMDA  171

Query  625  DVPLVPAITSPSQN  666
            D+ L+P++T P+Q+
Sbjct  172  DISLIPSLT-PNQS  184



>ref|XP_003525180.1| PREDICTED: uncharacterized protein LOC100817892 isoform X1 [Glycine 
max]
 gb|KHN10526.1| hypothetical protein glysoja_040681 [Glycine soja]
Length=399

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 7/113 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  69   IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  124

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T    + SG +D
Sbjct  125  VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVTP---DLSGKVD  174



>ref|XP_006580389.1| PREDICTED: uncharacterized protein LOC100817892 isoform X2 [Glycine 
max]
Length=400

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 7/113 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  70   IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  125

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T    + SG +D
Sbjct  126  VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVTP---DLSGKVD  175



>ref|XP_004503251.1| PREDICTED: uncharacterized protein LOC101489103 [Cicer arietinum]
Length=401

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 6/115 (5%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+L SPIGQFL+QIL +HPHL+ AAVDQQL QLQ+D + ++QN+   D PS + TD+
Sbjct  69   IAPLQLHSPIGQFLSQILTNHPHLLPAAVDQQLHQLQSDHDADQQNQ---DPPSTTATDL  125

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVKANERRKALEEILY LVVQKFMDA++ L+P+IT    + SG +D+ 
Sbjct  126  VLYRRIAEVKANERRKALEEILYTLVVQKFMDANISLIPSITP---DPSGRVDSW  177



>gb|AFK36208.1| unknown [Medicago truncatula]
Length=421

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87   IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVKANERR ALEEILY LVVQKFMDA++ L+P+IT    ++SG +D+ 
Sbjct  146  VLYRRIAEVKANERRTALEEILYTLVVQKFMDANISLIPSITP---DASGRVDSW  197



>gb|ACJ84884.1| unknown [Medicago truncatula]
Length=421

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87   IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAEVKANERR ALEEILY LVVQKFMDA++ L+P+IT    ++SG +D+ 
Sbjct  146  VLYRRIAEVKANERRTALEEILYTLVVQKFMDANISLIPSITP---DASGRVDSW  197



>gb|ABR17692.1| unknown [Picea sitchensis]
 gb|ACN40252.1| unknown [Picea sitchensis]
Length=434

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 107/166 (64%), Gaps = 15/166 (9%)
 Frame = +1

Query  196  GFVKFGSKALLSAPSIKVKLGNR-RVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESP  372
            G +KF    +   P  +     R R  FG      +RA+    N   S+ PIAPL+LESP
Sbjct  52   GSLKFSQSIITPGPQWRCTYSKRSRRNFG------VRAA---GNYDESSKPIAPLQLESP  102

Query  373  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  552
             GQFL+Q+L  HPHL+ AAV+QQLE+L  DR+       Q D PS++ T++VLYRRIAEV
Sbjct  103  TGQFLSQLLKDHPHLLPAAVEQQLERLVADRD----AAAQQDPPSSTSTELVLYRRIAEV  158

Query  553  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            KA ERRKALEEI+YAL+VQKFMDA + L+P I+ P    +G IDT 
Sbjct  159  KAAERRKALEEIMYALIVQKFMDARISLIPCISMPDP-VTGQIDTW  203



>gb|ADE77481.1| unknown [Picea sitchensis]
Length=435

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 5/115 (4%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL  ESPIGQFL+QIL +HPHL+ AA+DQQLE+L  DR+   Q+E    +PS S TD+
Sbjct  86   IAPLDFESPIGQFLSQILKNHPHLLPAAIDQQLERLAADRDAASQHE----QPSTSSTDL  141

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            VLYRRIAE+KA ERRKALEEI+Y L+VQKFMDA V L+P I+ P+   SG +DT 
Sbjct  142  VLYRRIAELKAEERRKALEEIIYTLIVQKFMDAGVSLIPTISLPAAG-SGKVDTW  195



>gb|EAY91660.1| hypothetical protein OsI_13299 [Oryza sativa Indica Group]
 gb|EAZ28380.1| hypothetical protein OsJ_12360 [Oryza sativa Japonica Group]
Length=413

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  81   IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  138

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D
Sbjct  139  VLYRRIAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVD  190



>ref|XP_010487675.1| PREDICTED: uncharacterized protein LOC104765624 [Camelina sativa]
Length=409

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  140  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  174



>ref|XP_010505920.1| PREDICTED: uncharacterized protein LOC104782624 [Camelina sativa]
Length=409

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83   PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  140  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  174



>ref|XP_002885230.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61489.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSDGQNK---DASSVPGTD  153

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAEVK NERR+ LEEILYALVVQKFM+A+
Sbjct  154  IVLYRRIAEVKENERRRTLEEILYALVVQKFMEAN  188



>gb|AAL32564.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13275.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  148  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  182



>ref|NP_566588.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02703.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76008.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=421

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  148  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  182



>ref|XP_003530975.1| PREDICTED: uncharacterized protein LOC100793300 [Glycine max]
 gb|KHN00132.1| hypothetical protein glysoja_028660 [Glycine soja]
Length=404

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 123/191 (64%), Gaps = 18/191 (9%)
 Frame = +1

Query  118  TTSLRSSITVGCGPVK--SGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKC  291
             T+ RS + +   PV   +  RF +   GF +    + +  P  K K G RR        
Sbjct  5    VTAFRSPLIILRRPVNESASARFGSTF-GFSRKQRFSSVCIPKHKHKQGRRR-------G  56

Query  292  NSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  471
              +RAS   S     A  IAPL+ ES IGQFL+QIL  HPHLV AAVDQQL+QLQTDR+ 
Sbjct  57   FVVRASASSSPESDDA-KIAPLQFESSIGQFLSQILKDHPHLVPAAVDQQLQQLQTDRDA  115

Query  472  EKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
             +QNE    +PSAS TD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T
Sbjct  116  HQQNE----QPSASTTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVT  171

Query  652  SPSQNSSGSID  684
                + SG +D
Sbjct  172  P---DLSGKVD  179



>dbj|BAF01343.1| hypothetical protein [Arabidopsis thaliana]
Length=421

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  148  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  182



>ref|NP_001078173.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76009.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=427

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 3/95 (3%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97   PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  153

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+
Sbjct  154  IVLYRRIAELKENERRRTLEEILYALVVQKFMEAN  188



>ref|NP_001051084.1| Os03g0717900 [Oryza sativa Japonica Group]
 gb|ABF98564.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12998.1| Os03g0717900 [Oryza sativa Japonica Group]
 dbj|BAG94154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  123  IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  180

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D
Sbjct  181  VLYRRIAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVD  232



>ref|XP_010919980.1| PREDICTED: uncharacterized protein LOC105043949 [Elaeis guineensis]
Length=404

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 8/144 (6%)
 Frame = +1

Query  253  LGNRRVAFGSTKCNSIRASL-PLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  429
            +G   + F   K  + R  +  L NSG + +PIAPL+ ESPIGQ L+QI+ +HPHL+ AA
Sbjct  52   IGWPNIGFQLEKYRARRLKVKALENSGENQIPIAPLQFESPIGQLLSQIMQTHPHLLPAA  111

Query  430  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  609
            +DQQLE+LQ+DR+ EK+      E   +  D++LYRRIAEVKA ER+KALEEI+Y L+VQ
Sbjct  112  IDQQLERLQSDRDAEKE------ETPPATQDLLLYRRIAEVKAKERQKALEEIIYCLIVQ  165

Query  610  KFMDADVPLVPAITSPSQNSSGSI  681
            KFMD D+ ++PAI SPS + +  +
Sbjct  166  KFMDNDISMIPAI-SPSSDPNSEV  188



>gb|ACF87802.1| unknown [Zea mays]
 tpg|DAA51042.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=423

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  516
            IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++   D+ + +G
Sbjct  85   IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  144

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             D+VLYRRIAEVK  ERR+ LEEILYALVVQKF++A V LVPA+ S S + SG +D
Sbjct  145  GDLVLYRRIAEVKEKERRRTLEEILYALVVQKFVEAGVSLVPAL-SRSTDPSGRVD  199



>ref|XP_006650499.1| PREDICTED: uncharacterized protein LOC102715191 [Oryza brachyantha]
Length=327

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
            +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K  E   D+P+ S  DIVLYRR
Sbjct  1    MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAK--EDGGDKPTPSDGDIVLYRR  58

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            IAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S NSSG +D
Sbjct  59   IAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSINSSGRVD  105



>ref|NP_001143815.1| uncharacterized protein LOC100276591 [Zea mays]
 gb|ACG35630.1| hypothetical protein [Zea mays]
Length=424

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  516
            IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++   D+ + +G
Sbjct  86   IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  145

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             ++VLYRRIAEVK  ERR+ LEEILYALVVQKF++A V LVPA+ S S + SG +D
Sbjct  146  GNLVLYRRIAEVKEKERRRTLEEILYALVVQKFVEAGVSLVPAL-SRSTDPSGRVD  200



>gb|ABF98565.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG87500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
            +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DIVLYRR
Sbjct  1    MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDIVLYRR  58

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            IAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D
Sbjct  59   IAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVD  105



>dbj|BAJ85118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 90/113 (80%), Gaps = 3/113 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++  ++ + Q   P A+G DI
Sbjct  77   IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQDSAEKKDAQA--PPAAG-DI  133

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVK  ER++ +EEILYALVVQKF++A V LVPA++     SSG +D
Sbjct  134  VLYRRIAEVKEKERKRTMEEILYALVVQKFVEAGVSLVPALSHSIDTSSGRVD  186



>ref|XP_011028101.1| PREDICTED: uncharacterized protein LOC105128231 [Populus euphratica]
Length=413

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 108/167 (65%), Gaps = 20/167 (12%)
 Frame = +1

Query  208  FGSKALLSAPSIKVK----LGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKL  363
            F S + LS PS   K     G  R+  G  K      ++RAS    +S G+ +P++PL+ 
Sbjct  37   FHSLSFLSPPSHLTKRCPSFGIPRLGAGMYKFRPRGLTVRAS---GDSAGNPVPVSPLEF  93

Query  364  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  543
            ESP+GQ L QIL +HPHL+ AA+DQQLE LQTDR+ +K       E +AS  D  LY+RI
Sbjct  94   ESPVGQLLAQILQTHPHLLPAAIDQQLENLQTDRDAQK-------EEAASSQDF-LYKRI  145

Query  544  AEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            AEVK  ERRKALEEI+Y+++V KF+D D+ ++P I SP+ + +G +D
Sbjct  146  AEVKEKERRKALEEIIYSMIVHKFLDNDISMIPKI-SPTSDPTGRVD  191



>ref|XP_006854071.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
 gb|ERN15538.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
Length=383

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 7/125 (6%)
 Frame = +1

Query  286  KCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDR  465
            K  ++R    ++ SG ++ PIAPL+ ESPIGQFL QIL +HPHL+ AAVDQQLE+LQ+DR
Sbjct  57   KLANLRVRRGINASGETSTPIAPLQFESPIGQFLAQILRTHPHLLPAAVDQQLERLQSDR  116

Query  466  NLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPA  645
                  E Q +E S S TD+ L RRIAEVK  ER++ALEEI+YAL+VQKFMD  V + P 
Sbjct  117  ------ESQKEEKSPSATDL-LSRRIAEVKDKERQRALEEIIYALIVQKFMDVGVSMFPN  169

Query  646  ITSPS  660
            I +PS
Sbjct  170  IPTPS  174



>ref|NP_001169730.1| hypothetical protein [Zea mays]
 gb|ACN34695.1| unknown [Zea mays]
 gb|AFW67799.1| hypothetical protein ZEAMMB73_826524 [Zea mays]
Length=416

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASG  516
            +APL++ESP GQ L+QIL +HPHL+ AA +QQLE LQTDR  EK  +K++   D+ + +G
Sbjct  77   MAPLRMESPAGQLLSQILHTHPHLLPAAAEQQLELLQTDREAEKNKDKESDAGDKLAPTG  136

Query  517  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             D+VLYRRIA+VK  ERR+ LEEILYALVV+KF++A V LVPA+ S S +SSG +D
Sbjct  137  VDLVLYRRIAQVKEKERRRTLEEILYALVVEKFVEAGVSLVPAL-SRSIDSSGRVD  191



>gb|EMT10781.1| hypothetical protein F775_30852 [Aegilops tauschii]
Length=493

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++    ++K    P A+G DI
Sbjct  126  IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQD--SADKKDAQAPPAAG-DI  182

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIAEVK  ER++ +EEILYALVVQKF++A V LVPA++     SSG +D
Sbjct  183  VLYRRIAEVKEKERKRTMEEILYALVVQKFVEAGVSLVPALSHSIDASSGRVD  235



>ref|XP_008800077.1| PREDICTED: uncharacterized protein LOC103714566 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 91/119 (76%), Gaps = 6/119 (5%)
 Frame = +1

Query  316  LSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  495
            L NSG +  PIAPL+ ESP+GQ L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+     
Sbjct  75   LENSGENHTPIAPLQFESPVGQLLSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE-----  129

Query  496  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSS  672
            + P A+  D+ LYRRIAEVKA ER+KALEEI+Y L+VQKFMD  + ++PAI+  S  +S
Sbjct  130  ETPPAT-QDLPLYRRIAEVKAKERQKALEEIIYCLIVQKFMDNGISMIPAISPTSDPNS  187



>ref|XP_009413223.1| PREDICTED: uncharacterized protein LOC103994576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=402

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 14/149 (9%)
 Frame = +1

Query  208  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  387
            F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44   FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  388  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANER  567
            +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYRRIAEVK  ER
Sbjct  96   SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYRRIAEVKEKER  149

Query  568  RKALEEILYALVVQKFMDADVPLVPAITS  654
             KALEEI+Y L+VQKFM+ ++ ++P +T+
Sbjct  150  HKALEEIIYCLIVQKFMEKEIDMIPTVTT  178



>ref|XP_010261560.1| PREDICTED: uncharacterized protein LOC104600354 [Nelumbo nucifera]
Length=409

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 105/171 (61%), Gaps = 29/171 (17%)
 Frame = +1

Query  208  FGSKALLSA------PSIKVKLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPL  357
            + +K+LLS       PS  ++LG      G  KC     S+RAS    +S     PIAPL
Sbjct  33   YDTKSLLSGGILKRYPSCFLRLGA-----GLEKCRTRSLSVRAS---GHSNNDTTPIAPL  84

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE--KQNDEPSASGTDIVL  531
            + ESP+GQ L QI+ +HPHL+ AA+DQQLE LQTD+  + +     QND         +L
Sbjct  85   RFESPVGQLLVQIMQTHPHLLPAAIDQQLENLQTDQGAQGEESLPPQND---------LL  135

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            YRRIAEV+  ERRKALEEI+Y L+VQKFM+  + ++P I+ PS + +G +D
Sbjct  136  YRRIAEVQEKERRKALEEIIYCLIVQKFMENAISMIPPISVPSSDPTGRVD  186



>ref|XP_004981973.1| PREDICTED: uncharacterized protein LOC101781190 isoform X1 [Setaria 
italica]
Length=411

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 108/152 (71%), Gaps = 12/152 (8%)
 Frame = +1

Query  262  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  417
            R  AFGS + NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37   RGFAFGSKQLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  96

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIAEVKANERRKALEEI  588
            + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIAEVK  ERR+ALEEI
Sbjct  97   LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIAEVKEKERRRALEEI  156

Query  589  LYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            LYALVVQKF++A V LVPA+ S S +SSG +D
Sbjct  157  LYALVVQKFVEAGVSLVPAL-SHSIDSSGRVD  187



>ref|XP_002276652.1| PREDICTED: uncharacterized protein LOC100260823 [Vitis vinifera]
Length=403

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 14/144 (10%)
 Frame = +1

Query  265  RVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            ++  G  KC     ++RAS+   NS    +P+APL+LESPIGQ L QIL +HPHL+ AA+
Sbjct  49   KLGVGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESPIGQLLAQILQTHPHLLPAAI  105

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  612
            DQQLE LQTDR+       Q +E   S  D++LYRRIA V+  ER+K LEEILY L+VQK
Sbjct  106  DQQLENLQTDRD------AQREETPPSSHDLLLYRRIAAVREKERQKVLEEILYCLIVQK  159

Query  613  FMDADVPLVPAITSPSQNSSGSID  684
            F+D ++ ++P I++ S +  G +D
Sbjct  160  FVDKNISMIPKISATS-DPVGRVD  182



>emb|CBI33818.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 104/164 (63%), Gaps = 20/164 (12%)
 Frame = +1

Query  208  FGSKALLSAPSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESP  372
            F +    S PS  + KLG      G  KC     ++RAS+   NS    +P+APL+LESP
Sbjct  34   FKNLLFRSCPSFCIPKLG-----VGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESP  85

Query  373  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  552
            IGQ L QIL +HPHL+ AA+DQQLE LQTDR+       Q +E   S  D++LYRRIA V
Sbjct  86   IGQLLAQILQTHPHLLPAAIDQQLENLQTDRD------AQREETPPSSHDLLLYRRIAAV  139

Query  553  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            +  ER+K LEEILY L+VQKF+D ++ ++P I++ S +  G +D
Sbjct  140  REKERQKVLEEILYCLIVQKFVDKNISMIPKISATS-DPVGRVD  182



>ref|XP_003560595.1| PREDICTED: uncharacterized protein LOC100829350 [Brachypodium 
distachyon]
Length=413

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            IAPL++ES +GQFL+QILV+HPHL+ AA +QQLEQLQT  +  K+    + +    G DI
Sbjct  80   IAPLQMESAVGQFLSQILVTHPHLLPAAAEQQLEQLQTVHDAAKKENGSDTQAPPPGGDI  139

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VLYRRIA+VK  E+++ LEEILYA+VVQKF++A V LVPA+ S S ++SG +D
Sbjct  140  VLYRRIAQVKEKEKKRTLEEILYAMVVQKFVEAGVSLVPAL-SHSIDTSGRVD  191



>ref|XP_004981974.1| PREDICTED: uncharacterized protein LOC101781190 isoform X2 [Setaria 
italica]
Length=410

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 108/152 (71%), Gaps = 13/152 (9%)
 Frame = +1

Query  262  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  417
            R  AFGS K NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37   RGFAFGS-KLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  95

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIAEVKANERRKALEEI  588
            + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIAEVK  ERR+ALEEI
Sbjct  96   LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIAEVKEKERRRALEEI  155

Query  589  LYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            LYALVVQKF++A V LVPA+ S S +SSG +D
Sbjct  156  LYALVVQKFVEAGVSLVPAL-SHSIDSSGRVD  186



>emb|CDP11681.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 10/130 (8%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            ++RAS   S   G  +PIAP++LESP+GQFL QIL +HPHL+ AA+DQQLE LQ++R+ E
Sbjct  64   AVRASESFS---GDLVPIAPVQLESPVGQFLAQILQNHPHLLPAAIDQQLENLQSERDAE  120

Query  475  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
                  N++   S  D++LY+RIAEVK  ERRKA+E+I+Y LVV KF+D  + ++P ITS
Sbjct  121  ------NEKNPPSSQDLLLYKRIAEVKDKERRKAVEDIIYCLVVHKFVDNKISMIPKITS  174

Query  655  PSQNSSGSID  684
             S + +G +D
Sbjct  175  TS-DPAGRVD  183



>ref|XP_009413222.1| PREDICTED: uncharacterized protein LOC103994576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 97/153 (63%), Gaps = 18/153 (12%)
 Frame = +1

Query  208  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  387
            F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44   FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  388  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR----RIAEVK  555
            +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYR    RIAEVK
Sbjct  96   SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYRFTKERIAEVK  149

Query  556  ANERRKALEEILYALVVQKFMDADVPLVPAITS  654
              ER KALEEI+Y L+VQKFM+ ++ ++P +T+
Sbjct  150  EKERHKALEEIIYCLIVQKFMEKEIDMIPTVTT  182



>ref|XP_011081424.1| PREDICTED: uncharacterized protein LOC105164476 [Sesamum indicum]
Length=408

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 108/165 (65%), Gaps = 18/165 (11%)
 Frame = +1

Query  190  APGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLES  369
            +PGF K       S P+ K+++G  ++    T+   +RAS    NSGG  +P+APL+LES
Sbjct  40   SPGFSKN-----CSFPNPKLEIGPEKL---RTRGFMVRAS---GNSGGDLIPVAPLQLES  88

Query  370  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAE  549
            P+GQ L QIL +HPHL+ A  +QQLE LQ+ R+     +K+   PS+   D++LY+RIAE
Sbjct  89   PVGQLLAQILQTHPHLLLATAEQQLENLQSQRD----GQKETTAPSSQ--DLLLYKRIAE  142

Query  550  VKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VK  ERRK LEEI+Y L+VQ+F+   + ++P I++ S + +G +D
Sbjct  143  VKEKERRKTLEEIIYCLIVQRFVANHISMIPKISTTS-DPTGRVD  186



>ref|XP_007209264.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
 gb|EMJ10463.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
Length=369

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 99/149 (66%), Gaps = 20/149 (13%)
 Frame = +1

Query  250  KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  417
            KLGN     G  KC +    +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL
Sbjct  55   KLGN-----GLYKCRARGLIVRAS---KDSSDNLVPVAPLQFESPAGQLLAQILQNHPHL  106

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYA  597
            +SAA+DQQLE LQ DR+  ++      E SAS  D  LY+RIA+VK  ERR ALEEI+Y 
Sbjct  107  LSAAIDQQLENLQKDRDARRE------ETSASSAD-PLYKRIAQVKEKERRMALEEIIYC  159

Query  598  LVVQKFMDADVPLVPAITSPSQNSSGSID  684
            L+VQKF++ D+ ++P I++ S + +G +D
Sbjct  160  LIVQKFIENDISMIPKISATS-DPTGRVD  187



>gb|KHG08376.1| Beta-casein [Gossypium arboreum]
Length=399

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 104/177 (59%), Gaps = 13/177 (7%)
 Frame = +1

Query  157  PVKSGRRFTTDAPGFVKFGSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGG  333
            P      F    P      S      PS+ + KLG     +   +C ++RA   L  SG 
Sbjct  15   PSAGALNFRHFHPNHFFLSSPFFKRCPSLCIPKLGMVPDKYRGGRCLTMRA---LGESGD  71

Query  334  SAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  513
            +  PIAP++ ESP+GQ L QIL +HPHL+ AAVDQQL+ LQ+D+N + +   Q+ +    
Sbjct  72   NLSPIAPVEFESPVGQLLAQILRTHPHLLPAAVDQQLDNLQSDKNDQTEETLQSHD----  127

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
                +LY+RIAEVK  ER+K LEEI+Y L+VQKF+D ++ ++P +T  S + +G +D
Sbjct  128  ----LLYKRIAEVKEKERQKTLEEIIYCLIVQKFVDNEISMIPKVTETS-DPTGRVD  179



>gb|KJB21160.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
 gb|KJB21161.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
Length=400

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 19/161 (12%)
 Frame = +1

Query  223  LLSAPSIKV-------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  381
             LS+P  K        KLG     +   +C ++RAS     SG +  PIAP++ ESP+GQ
Sbjct  31   FLSSPFFKRCPTLCIPKLGMVPDKYRGGRCLTMRAS---GESGDNLSPIAPVEFESPVGQ  87

Query  382  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  561
             L QIL +HPHL+ AAVDQQL+ LQ+D+N + +   Q+ +        +LY+RIAEVK  
Sbjct  88   LLAQILRTHPHLLPAAVDQQLDNLQSDKNDQTEETPQSQD--------LLYKRIAEVKEK  139

Query  562  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            ER+K LEEI+Y L+VQKF+D ++ ++P +T  S + +G +D
Sbjct  140  ERQKTLEEIIYCLIVQKFVDNEISMIPKVTETS-DPTGRVD  179



>ref|XP_006471483.1| PREDICTED: uncharacterized protein LOC102623998 [Citrus sinensis]
Length=408

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 98/149 (66%), Gaps = 23/149 (15%)
 Frame = +1

Query  250  KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  417
            KLGN     G  KC     ++RAS    +S  + +PIAPL+ ESP+GQ L QIL +HPHL
Sbjct  54   KLGN-----GMDKCRMRDLTVRAS---GSSDRNVVPIAPLQFESPVGQLLAQILQTHPHL  105

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYA  597
            + AA+DQQLE +Q D+N+++++  Q+          +LY+RIAEVK  ER+KA+EEI+Y 
Sbjct  106  LPAAIDQQLENIQIDKNVQREDTSQD----------LLYQRIAEVKEKERQKAVEEIIYC  155

Query  598  LVVQKFMDADVPLVPAITSPSQNSSGSID  684
            L+VQKF++ D+ ++P I   S +  G +D
Sbjct  156  LIVQKFVENDISMIPKIGETS-DPVGRVD  183



>gb|KDP30713.1| hypothetical protein JCGZ_15541 [Jatropha curcas]
Length=405

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 103/160 (64%), Gaps = 19/160 (12%)
 Frame = +1

Query  223  LLSAPSIKV------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  384
            L SAPS +       KLGN    F   +   +RAS   SN    ++PI+PL+ ESP+GQ 
Sbjct  35   LSSAPSRRYPSFGMPKLGNGMTKF-RERGFIVRASGDPSNY---SVPISPLQFESPVGQL  90

Query  385  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  564
            L QIL +HPHL+ AAVDQQLE LQTDR     + K+++ P +     +LY+RIAEV+  E
Sbjct  91   LAQILQTHPHLLPAAVDQQLENLQTDR-----DTKRDETPPSQD---LLYKRIAEVREKE  142

Query  565  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            RR ALEEI+Y+L+VQKF+D  + ++P I S S + +G +D
Sbjct  143  RRNALEEIIYSLIVQKFLDNGISMIPKI-SASSDPTGRVD  181



>ref|XP_008238169.1| PREDICTED: uncharacterized protein LOC103336834 [Prunus mume]
Length=405

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 100/148 (68%), Gaps = 18/148 (12%)
 Frame = +1

Query  250  KLGN---RRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLV  420
            KLGN   +R A G      +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL+
Sbjct  55   KLGNGLHKRRARGLI----VRAS---KDSSDNLVPVAPLQFESPAGQLLAQILQNHPHLL  107

Query  421  SAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYAL  600
            SAA+DQQLE LQ DR+ +++      E SAS  D  LY+RIA++K  ERR ALEEI+Y L
Sbjct  108  SAAIDQQLENLQKDRDAQRK------ETSASSED-PLYKRIAQIKEKERRMALEEIIYCL  160

Query  601  VVQKFMDADVPLVPAITSPSQNSSGSID  684
            +VQKF++ D+ ++P I++ S + +G +D
Sbjct  161  IVQKFIENDISMIPKISATS-DPTGRVD  187



>ref|XP_004300191.1| PREDICTED: uncharacterized protein LOC101292798 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 99/144 (69%), Gaps = 16/144 (11%)
 Frame = +1

Query  265  RVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            +V  G  KC +    +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL+ AAV
Sbjct  55   KVGNGLYKCRARGLIVRAS---EDSSANLVPVAPLQFESPAGQLLGQILQTHPHLLPAAV  111

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  612
            DQQLE+LQT+R+ +++     + P++ G    LY+RIAEVK  ERR AL+EI+Y L+VQK
Sbjct  112  DQQLEKLQTERDAQEE-----ESPASKGP---LYKRIAEVKEKERRAALQEIIYCLIVQK  163

Query  613  FMDADVPLVPAITSPSQNSSGSID  684
            F++ ++ ++P I++ S + +G +D
Sbjct  164  FVENEISMIPKISATS-DPTGRVD  186



>ref|XP_002518989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43522.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 12/130 (9%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            ++RAS    ++   ++P+ PLK ESP+GQ L QIL +HPHL+ +A+DQQLE LQ+DR+  
Sbjct  73   TLRAS---GDANNYSVPLPPLKFESPVGQLLAQILQTHPHLLPSAIDQQLENLQSDRD--  127

Query  475  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
                  + + S S  D+ LY+RIAEVK  ERRK LEEI+Y+L+VQKF+D D+ ++P +++
Sbjct  128  -----ASTDQSPSSQDL-LYKRIAEVKEKERRKTLEEIIYSLIVQKFLDNDILMIPKVSA  181

Query  655  PSQNSSGSID  684
             S + +G +D
Sbjct  182  TS-DPTGRVD  190



>ref|XP_008466019.1| PREDICTED: uncharacterized protein LOC103503577 isoform X1 [Cucumis 
melo]
Length=405

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            SIRAS    +   +  P+APL+ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67   SIRAS----DDSRNVYPVAPLQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  475  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
                 Q +E  +S  D  LY+RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT 
Sbjct  121  ----SQTEEAPSSSQD-PLYKRIAEVKEKERRKTLEEILYCLIVGKFVENDISMIPKITE  175

Query  655  PSQNSSGSID  684
             S + +G +D
Sbjct  176  TS-DPTGRVD  184



>ref|XP_007040722.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
 gb|EOY25223.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
Length=402

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 89/130 (68%), Gaps = 12/130 (9%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            ++RAS     S  S  PIAP++ ESP+GQ L QIL +HPHL+ AA+DQQLE LQ+D    
Sbjct  61   TMRAS---GESDDSLSPIAPVQFESPVGQLLAQILRTHPHLLPAAIDQQLENLQSD----  113

Query  475  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
            K ++K+   PS      +LY+RIAEVK  ERR+ LEEI+Y L+VQKF+D ++ ++P I +
Sbjct  114  KDDQKEETTPSQD----LLYKRIAEVKEKERRRTLEEIIYCLIVQKFVDNEISMIPKIMA  169

Query  655  PSQNSSGSID  684
             S + +G +D
Sbjct  170  TS-DPTGRVD  178



>ref|XP_006352932.1| PREDICTED: uncharacterized protein LOC102595128 [Solanum tuberosum]
Length=402

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 10/127 (8%)
 Frame = +1

Query  283  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  462
            T+  +IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +
Sbjct  57   TRSWTIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNE  115

Query  463  RNLE-KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLV  639
            R+ + K+N+        S T  VL +RIAEV+  ERRK LEE+LY L+V KF+D D+ ++
Sbjct  116  RDAQLKENQ--------SSTKDVLQKRIAEVREKERRKILEEVLYCLIVHKFVDNDISMI  167

Query  640  PAITSPS  660
            P I+  S
Sbjct  168  PKISETS  174



>ref|XP_009804854.1| PREDICTED: uncharacterized protein LOC104250017 [Nicotiana sylvestris]
Length=405

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 103/174 (59%), Gaps = 21/174 (12%)
 Frame = +1

Query  154  GPVKSGRRFTTDAPGFVK--FGSKALLSAPSIKV---KLGNRRVAFGSTKCNSIRASLPL  318
            G +K  + F+     F+   F   +  S P + +   K  NR     +T   S       
Sbjct  20   GGLKKFQAFSDPTKSFLSHSFSKSSPFSVPRLGIGPEKAQNRNWMIRATASGS-------  72

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
              SGG  +P+AP++LES +GQFL QIL +HPHL+ AA++QQLE LQ +R+     + + +
Sbjct  73   --SGGDLVPVAPVQLESAVGQFLAQILQTHPHLLPAAIEQQLENLQNERD----TQLKEN  126

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPS  660
            +PS+     VL++RIAEV+  ERR+ALEEILY L+V KF+D ++ L+P I+  S
Sbjct  127  QPSSKD---VLHKRIAEVREKERRRALEEILYCLIVHKFVDNEISLIPKISETS  177



>ref|XP_004136206.1| PREDICTED: uncharacterized protein LOC101213975 [Cucumis sativus]
 ref|XP_004163203.1| PREDICTED: uncharacterized LOC101213975 [Cucumis sativus]
 gb|KGN60350.1| hypothetical protein Csa_3G895960 [Cucumis sativus]
Length=405

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 12/130 (9%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            SIRAS    +   +  P+AP++ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67   SIRAS----DDSRNVYPVAPVQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  475  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
                 Q +E  +S  D  LY+RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT 
Sbjct  121  ----SQTEEAPSSSQD-PLYKRIAEVKDKERRKTLEEILYCLIVGKFVENDISMIPKITE  175

Query  655  PSQNSSGSID  684
             S + +G +D
Sbjct  176  TS-DPTGRVD  184



>ref|XP_010677383.1| PREDICTED: uncharacterized protein LOC104893042 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 10/129 (8%)
 Frame = +1

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            +RAS    NSG +  PIAP++LESP G  LTQIL +HPHL+ AA+DQQLE LQ D++ +K
Sbjct  73   VRAS---DNSGENLTPIAPVQLESPAGLLLTQILQTHPHLLPAAIDQQLENLQNDKDAQK  129

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  657
            +      E  +S   + LYRRIAEV+  ERRKALEEI+Y  +VQ+F++  + ++P I S 
Sbjct  130  E------ETPSSSQGLPLYRRIAEVREKERRKALEEIIYCSIVQRFVERSILMIPEI-SQ  182

Query  658  SQNSSGSID  684
            S + +G +D
Sbjct  183  SPDITGRVD  191



>ref|XP_008373529.1| PREDICTED: uncharacterized protein LOC103436859 [Malus domestica]
Length=403

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (62%), Gaps = 28/168 (17%)
 Frame = +1

Query  214  SKALLSA------PSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLK  360
            SK+ LSA      PS  + KLGN     G   C +    +RAS    +S  + +P+APL+
Sbjct  42   SKSFLSASFFRSCPSFCIPKLGN-----GLYNCRARGLVVRAS---KDSSDNLVPVAPLQ  93

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
             ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +LY+R
Sbjct  94   FESPAGQLLAQILZTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANLLYKR  145

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            IA+VK  ERR ALEEI+Y L+V KF+D ++ ++P I+  S + +G +D
Sbjct  146  IAKVKDKERRMALEEIIYCLIVHKFVDREISMIPKISETS-DPTGRVD  192



>ref|XP_009373461.1| PREDICTED: uncharacterized protein LOC103962488 [Pyrus x bretschneideri]
Length=403

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 104/168 (62%), Gaps = 28/168 (17%)
 Frame = +1

Query  214  SKALLSA------PSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLK  360
            SK+ LSA      PS  + KLGNR        C +    +RAS    +S  + +P++PL+
Sbjct  42   SKSFLSASIFRSCPSFCIPKLGNR-----PYNCRARGLVVRAS---KDSSDNLVPVSPLQ  93

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
             ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +LY+R
Sbjct  94   FESPPGQLLAQILQTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANLLYKR  145

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            IAEVK  ERR ALEEI+Y L+V KF+D ++ ++P I+  S + +G +D
Sbjct  146  IAEVKDKERRMALEEIIYCLIVHKFVDREISMIPKISETS-DPTGRVD  192



>gb|KCW71713.1| hypothetical protein EUGRSUZ_E00224 [Eucalyptus grandis]
Length=465

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (70%), Gaps = 12/129 (9%)
 Frame = +1

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  128  IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  184

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  657
            +       P+++    +LY+RIAEVK  ER K LEEI+Y L+VQ+F++ ++ ++P IT+ 
Sbjct  185  EK-----NPASAD---LLYQRIAEVKEKERHKTLEEIIYCLIVQRFVENNISMIPKITAT  236

Query  658  SQNSSGSID  684
            S + +G +D
Sbjct  237  S-DPTGRVD  244



>ref|XP_010055250.1| PREDICTED: uncharacterized protein LOC104443499 [Eucalyptus grandis]
Length=408

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (70%), Gaps = 12/129 (9%)
 Frame = +1

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  71   IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  127

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  657
            +       P+++    +LY+RIAEVK  ER K LEEI+Y L+VQ+F++ ++ ++P IT+ 
Sbjct  128  EK-----NPASAD---LLYQRIAEVKEKERHKTLEEIIYCLIVQRFVENNISMIPKITAT  179

Query  658  SQNSSGSID  684
            S + +G +D
Sbjct  180  S-DPTGRVD  187



>ref|XP_004245960.1| PREDICTED: uncharacterized protein LOC101262445 [Solanum lycopersicum]
Length=402

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%), Gaps = 10/127 (8%)
 Frame = +1

Query  283  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  462
            T+   IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQL+ LQ +
Sbjct  57   TRSWKIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLDNLQNE  115

Query  463  RNLE-KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLV  639
            R+ + K+N+        S T  VL +RIAEVK  ERRK LEEILY L+V KF++ D+ ++
Sbjct  116  RDAQLKENQ--------SSTKDVLQKRIAEVKEKERRKILEEILYCLIVHKFVENDISMI  167

Query  640  PAITSPS  660
            P I+  S
Sbjct  168  PKISETS  174



>ref|XP_009607216.1| PREDICTED: uncharacterized protein LOC104101473 [Nicotiana tomentosiformis]
Length=405

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 16/178 (9%)
 Frame = +1

Query  154  GPVKSGRRFTTDAPGFVK--FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNS  327
            G +K    F+     F+   F   +  S P + +  G        T+   IRA+    +S
Sbjct  20   GGLKQFHAFSEPTKSFLSHSFSKSSPFSVPRLGIGPGK-----AQTRNWMIRATSS-GSS  73

Query  328  GGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPS  507
            GG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +R+     + + ++PS
Sbjct  74   GGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNERD----TQLKENQPS  129

Query  508  ASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  681
            +     VL++RIAEV+  ERRK LEEILY L V KF+D ++ L+P I+  S + +GS+
Sbjct  130  SKD---VLHKRIAEVREKERRKVLEEILYCLSVHKFVDNEISLIPKISETS-DPTGSV  183



>ref|XP_008800078.1| PREDICTED: uncharacterized protein LOC103714566 isoform X2 [Phoenix 
dactylifera]
Length=390

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 99/156 (63%), Gaps = 20/156 (13%)
 Frame = +1

Query  235  PSIKVKL-----GNRRVAFGSTKCNSIRASLPLSNSGGS-----AMPIAPLKLESPIGQF  384
            P + +KL      + R  F S KC S   S+   N GG      A  +    LE+ +GQ 
Sbjct  27   PPVDLKLLPSLSSDSRAGF-SNKCYS---SVGWPNIGGQLEKYRARSLKVKALENSVGQL  82

Query  385  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  564
            L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+     + P A+  D+ LYRRIAEVKA E
Sbjct  83   LSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE-----ETPPAT-QDLPLYRRIAEVKAKE  136

Query  565  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSS  672
            R+KALEEI+Y L+VQKFMD  + ++PAI+  S  +S
Sbjct  137  RQKALEEIIYCLIVQKFMDNGISMIPAISPTSDPNS  172



>gb|EPS63452.1| hypothetical protein M569_11331, partial [Genlisea aurea]
Length=342

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 86/129 (67%), Gaps = 14/129 (11%)
 Frame = +1

Query  286  KCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDR  465
            +   +RAS   S SG    PI+PL+LESP+GQ L+Q L +HPHL+ AAV+QQLE LQ  R
Sbjct  5    RSTMVRAS---STSGRD--PISPLELESPVGQLLSQALQTHPHLLMAAVEQQLENLQRQR  59

Query  466  NLEKQNEKQNDEPSASGT------DIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  627
            +   + +K+   P +  T      D VLY+RIAE K  ERRKA+EEI+Y L+V +F+D +
Sbjct  60   D---EGKKEPSRPQSKNTASTPSSDDVLYKRIAEFKEKERRKAVEEIMYCLIVHRFVDNN  116

Query  628  VPLVPAITS  654
            + ++P I++
Sbjct  117  ISMIPKIST  125



>ref|XP_003612708.1| hypothetical protein MTR_5g028020 [Medicago truncatula]
 gb|AES95666.1| plant/F3C3-6 protein [Medicago truncatula]
Length=410

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 94/161 (58%), Gaps = 18/161 (11%)
 Frame = +1

Query  199  FVKFGSKALLSA-------PSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
            F  F +K +LS        PS   K  N   +F   +   +RAS   ++S  + +P  PL
Sbjct  29   FHSFDAKNVLSTGFLKSCPPSYNAKHYNEPYSFRG-RGLVVRAS---TDSSDNFVPSPPL  84

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            + ESP+GQ L QIL +HPHL  A +DQQLE+LQT+R+        N E S++  +  LY+
Sbjct  85   QFESPVGQLLEQILQTHPHLFLATIDQQLEKLQTERD-------ANKEESSTSYEDSLYK  137

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPS  660
            RIAE+K  E+R  LEEI+Y L+V KF +  + ++P I++ S
Sbjct  138  RIAEIKEKEKRTTLEEIMYCLIVNKFKENKISMIPKISATS  178



>gb|EYU43718.1| hypothetical protein MIMGU_mgv1a007450mg [Erythranthe guttata]
Length=407

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 95/158 (60%), Gaps = 23/158 (15%)
 Frame = +1

Query  193  PGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMP--IAPLKLE  366
            PGF K  S      P ++V L   R     T+  ++RAS    NS G  +     P+++E
Sbjct  36   PGFSKNWSS---RNPKLEVGLDKLR-----TRSFTVRAS---GNSDGDLVEENKNPVQME  84

Query  367  SPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIA  546
            SP+GQ L QIL +HPHL+ A  +QQLE LQ++R      E ++D    S  D++LY+RI 
Sbjct  85   SPVGQLLAQILQTHPHLLLATAEQQLENLQSER------EAKDD----SSKDLLLYKRIG  134

Query  547  EVKANERRKALEEILYALVVQKFMDADVPLVPAITSPS  660
            EVK  ERRK LEEILY L+VQ+F++ ++ L+P I + S
Sbjct  135  EVKEKERRKILEEILYCLIVQRFVENNISLIPKIMATS  172



>ref|XP_004500125.1| PREDICTED: uncharacterized protein LOC101505128 isoform X1 [Cicer 
arietinum]
 ref|XP_004500126.1| PREDICTED: uncharacterized protein LOC101505128 isoform X2 [Cicer 
arietinum]
 ref|XP_004500127.1| PREDICTED: uncharacterized protein LOC101505128 isoform X3 [Cicer 
arietinum]
 ref|XP_004500128.1| PREDICTED: uncharacterized protein LOC101505128 isoform X4 [Cicer 
arietinum]
Length=142

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = +1

Query  229  SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSH  408
            S PS K   G R+++ GS +   +RA+   + S GS+  IAPLKLESPIGQFL+QILVSH
Sbjct  42   SVPSSKQGHG-RKLSVGSKRVFVVRAASSSAESSGSSCNIAPLKLESPIGQFLSQILVSH  100

Query  409  PHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            PHL+SAAV++QLEQ QTDR+ ++Q EK    PSASGTD+VLYR
Sbjct  101  PHLMSAAVEKQLEQFQTDRDGDEQKEK----PSASGTDLVLYR  139



>ref|XP_004976664.1| PREDICTED: uncharacterized protein LOC101761297 [Setaria italica]
Length=402

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 78/122 (64%), Gaps = 10/122 (8%)
 Frame = +1

Query  283  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  462
            T+   I+A    + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++
Sbjct  63   TRTFKIKAK---AESGDGYTRLAPLRFESPSGQLLVQILQSHPHLLPATVDQQLENLQSE  119

Query  463  RNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
            ++ +K+      E S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFMD D+ + P
Sbjct  120  KDAQKE------EASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMDNDISMTP  172

Query  643  AI  648
            A+
Sbjct  173  AL  174



>ref|XP_007158234.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
 gb|ESW30228.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
Length=408

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 103/169 (61%), Gaps = 16/169 (9%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             +DA GF+  G   L S PS    KL N    F + + +  RAS   +NS  + +P APL
Sbjct  33   VSDAKGFLSGG--FLKSCPSSYNPKLYNEFYNFRA-RGSVARAS---ANSRDNPVPFAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+ +K+        S++  +  L +
Sbjct  87   QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARDAQKE--------SSTSPNNSLNK  138

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            RIAEVK  E+R  LEEI+Y  +V KF++ ++ ++P +++ S + +G +D
Sbjct  139  RIAEVKEKEKRMILEEIMYCSIVHKFLENNILMIPKLSATS-DPTGRVD  186



>ref|XP_002977160.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
 gb|EFJ21769.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
Length=333

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N     EK  +   +SG+++
Sbjct  2    VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKN--AAAEKSTN---SSGSEL  56

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT  687
            VLY+RIAEVK  ER+KA+ E++Y+LVVQKF+D+ + LVP I  PS  ++  +DT
Sbjct  57   VLYKRIAEVKEQERQKAVVEVIYSLVVQKFLDSRLALVPKI--PSLPANQKVDT  108



>gb|AFW59314.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=400

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +1

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLENLQSEKS------AQSE  123

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E S    D+ LY+RIAEVK  ER+ ALEEI+Y  V  +FM+ D+ + PA++
Sbjct  124  EASKVPQDL-LYKRIAEVKEKERQNALEEIIYCWVTYRFMENDIYMTPALS  173



>gb|EEC77902.1| hypothetical protein OsI_17223 [Oryza sativa Indica Group]
Length=420

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 95/184 (52%), Gaps = 20/184 (11%)
 Frame = +1

Query  97   CCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  276
            CCC+       R S ++G      G  F+     F  F  K+ L   S K          
Sbjct  29   CCCLR------RPSASLGPATPPQGASFSIRDMVFRLF-DKSFLYTSSPKSGF-----LI  76

Query  277  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  456
             S +  S++    + +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ
Sbjct  77   NSCRARSLKVKAKM-DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQ  135

Query  457  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  636
            ++++       Q  E S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ +
Sbjct  136  SEKD------AQEKEASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISM  188

Query  637  VPAI  648
             PA+
Sbjct  189  TPAL  192



>ref|XP_004512464.1| PREDICTED: uncharacterized protein LOC101507671 [Cicer arietinum]
Length=410

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 95/162 (59%), Gaps = 16/162 (10%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSA--PSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAP  354
             +DA  F+  G    L +  PS   K  N    F + +   +RAS   ++S  +++P  P
Sbjct  33   VSDAKNFLSAG---FLKSCPPSYNAKHYNEPYNFRA-RGLVVRAS---TDSSDNSVPSPP  85

Query  355  LKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLY  534
            L+ E+P+GQ L QIL +HPHLVSA +DQQLE+L T+R+  K       E S++  +  LY
Sbjct  86   LQFETPVGQLLEQILQTHPHLVSATIDQQLEKLLTERDAHK-------EESSASYENSLY  138

Query  535  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPS  660
            +RIAE+K  E+R  LEEI+Y  +V KF +  + ++P I + S
Sbjct  139  KRIAEIKEKEKRTTLEEIMYCSIVNKFKENKISMIPKIAATS  180



>ref|XP_010540738.1| PREDICTED: uncharacterized protein LOC104814412 [Tarenaya hassleriana]
Length=407

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 89/151 (59%), Gaps = 17/151 (11%)
 Frame = +1

Query  232  APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHP  411
            AP +     N     G  +  ++RAS     S  ++  IAPL+LESP+GQ L QIL +HP
Sbjct  47   APKLGAAFDN-----GRGRGVTVRAS---GESNENSDLIAPLELESPVGQLLVQILRTHP  98

Query  412  HLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEIL  591
            HL+   VDQQLE L  ++       + N+ PS+      LY+RIAEVK  ERRK LEEIL
Sbjct  99   HLLPITVDQQLENLANEKE-----ARGNELPSSQDP---LYKRIAEVKEKERRKTLEEIL  150

Query  592  YALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            Y LVVQ+F + ++ ++P I   S + +G +D
Sbjct  151  YCLVVQRFAENEISMIPQIKQTS-DPAGRVD  180



>ref|XP_003534296.1| PREDICTED: uncharacterized protein LOC100802337 [Glycine max]
Length=408

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 98/168 (58%), Gaps = 15/168 (9%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  360
             +DA GFV  G   L S PS         +     +    RAS   ++S  + +P APL+
Sbjct  33   VSDAKGFVSGG--FLKSCPSSYNPKHYHELYNFRARGLVARAS---ADSRDNLVPFAPLQ  87

Query  361  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  540
            LESP+GQ L +I  +HPHL++A +DQQLE LQ  R+ +K+++   D          LY+R
Sbjct  88   LESPVGQLLEKISNTHPHLLTAVIDQQLENLQNVRDAQKESDPSQDS---------LYKR  138

Query  541  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            IAEVK  E+R  LEEI+Y  +V KF++ ++ ++P I++ S + +G +D
Sbjct  139  IAEVKDKEKRITLEEIIYCSIVHKFLENNISMIPKISATS-DPTGRVD  185



>ref|XP_002448446.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
 gb|EES12774.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
Length=402

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = +1

Query  328  GGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPS  507
            G     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ+++        Q++E S
Sbjct  75   GDGYTRLAPLRFESPSGQLLVQILQSHPHLIPATVDQQLENLQSEKT------AQSEEAS  128

Query  508  ASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
                D+ LY+RIAEVK  ER+ ALEEI+Y  ++ +FMD D+ +  A++
Sbjct  129  KVPQDL-LYKRIAEVKEKERQNALEEIIYCWIIYRFMDNDISMTSALS  175



>emb|CDY35549.1| BnaA05g16370D [Brassica napus]
Length=402

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 9/114 (8%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72   PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             +L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID
Sbjct  125  -ILSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEITMIPQI-KPTSDPAGRID  176



>ref|XP_009145204.1| PREDICTED: uncharacterized protein LOC103868901 [Brassica rapa]
Length=401

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 9/114 (8%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72   PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             +L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID
Sbjct  125  -ILSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEITMIPQI-KPTSDPAGRID  176



>ref|XP_002890970.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67229.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 10/136 (7%)
 Frame = +1

Query  277  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  456
            G  +  ++RAS    +S G+  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  56   GRGRIVTVRASGE-EDSNGNFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  114

Query  457  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  636
                     E +  +  +S T  +L +RI+EV+  ERRK L EI+Y LVVQ+F++  + +
Sbjct  115  A--------ENETLKADSSATQDILQKRISEVRDKERRKTLAEIIYCLVVQRFVEKGISM  166

Query  637  VPAITSPSQNSSGSID  684
            +P I  P+ + +G ID
Sbjct  167  IPQI-KPTSDPAGRID  181



>ref|NP_001145533.1| uncharacterized protein LOC100278968 [Zea mays]
 gb|ACG48280.1| hypothetical protein [Zea mays]
Length=400

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +1

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQL  LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLGNLQSEKS------AQSE  123

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E S    D+ LY+RIAEVK  ER+ ALEEI+Y  V  +FM+ D+ + PA++
Sbjct  124  EASKVPQDL-LYKRIAEVKEKERQNALEEIIYCWVTYRFMENDIYMTPALS  173



>ref|NP_001053731.1| Os04g0595100 [Oryza sativa Japonica Group]
 emb|CAE03929.1| OSJNba0093F12.3 [Oryza sativa Japonica Group]
 emb|CAD41566.3| OSJNBa0006A01.21 [Oryza sativa Japonica Group]
 dbj|BAF15645.1| Os04g0595100 [Oryza sativa Japonica Group]
 gb|EAZ31841.1| hypothetical protein OsJ_16003 [Oryza sativa Japonica Group]
 dbj|BAG90593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=405

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ++++       Q  E
Sbjct  76   DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQSEKD------AQEKE  129

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAI  648
             S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA+
Sbjct  130  ASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISMTPAL  177



>ref|XP_006415245.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
 gb|ESQ33598.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
Length=405

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 9/136 (7%)
 Frame = +1

Query  277  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  456
            G  +  ++RAS    +S  S  P+AP++LESP+GQ L QIL +HPHL+   VDQQLE+  
Sbjct  54   GRGRGVTVRASGGEEDSNESFAPLAPVELESPVGQLLEQILRTHPHLLPITVDQQLEKFA  113

Query  457  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  636
                   +NE    E S+S    +L +RI+EV+  ERRK L EI+Y LVVQ+F++  + +
Sbjct  114  A------ENESLKAESSSSQD--LLSKRISEVREKERRKTLAEIIYCLVVQRFVEKGISM  165

Query  637  VPAITSPSQNSSGSID  684
            +P I  P+ + +G +D
Sbjct  166  IPQI-KPTSDPAGRVD  180



>gb|KHN40428.1| hypothetical protein glysoja_000926 [Glycine soja]
Length=406

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 96/169 (57%), Gaps = 16/169 (9%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             +DA GF+  G   L S PS    K  N    F +    +  ++ P  N     +P APL
Sbjct  33   VSDAKGFLSGG--FLKSCPSSYNPKHYNELYNFRARGLVARASADPRDN----LVPFAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE  +    +       Y+
Sbjct  87   QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNESSDSSLDSL------YK  138

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            RIAEVK  E+R  LEEILY  +V KF++ ++ ++P I++ S + +G +D
Sbjct  139  RIAEVKEKEKRTTLEEILYCSIVHKFLENNISMIPKISATS-DPTGRVD  186



>ref|NP_001242537.1| uncharacterized protein LOC100810147 [Glycine max]
 gb|ACU21518.1| unknown [Glycine max]
Length=406

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 96/169 (57%), Gaps = 16/169 (9%)
 Frame = +1

Query  181  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  357
             +DA GF+  G   L S PS    K  N    F +    +  ++ P  N     +P APL
Sbjct  33   VSDAKGFLSGG--FLKSCPSSYNPKHYNELYNFRARGLVARASADPRDN----LVPFAPL  86

Query  358  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE  +    +       Y+
Sbjct  87   QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNESSDSSLDSL------YK  138

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            RIAEVK  E+R  LEEILY  +V KF++ ++ ++P I++ S + +G +D
Sbjct  139  RIAEVKEKEKRTTLEEILYCSIVHKFLENNISMIPKISATS-DPTGRVD  186



>ref|XP_002965311.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
 gb|EFJ34149.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
Length=333

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N     EK  +   +S +++
Sbjct  2    VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKN--AAAEKSTN---SSDSEL  56

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT  687
            VLY+RIAEVK  ER+KA+ E++Y+LVVQKF+D+ + LVP I  PS  ++  +D+
Sbjct  57   VLYKRIAEVKEQERQKAVVEVIYSLVVQKFLDSRLALVPKI--PSLPANQKVDS  108



>ref|XP_010240349.1| PREDICTED: uncharacterized protein LOC104585415 [Brachypodium 
distachyon]
Length=391

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +SG     +APLK E+P GQ L QIL SHPHL+   VDQQLE LQ++++       QN+E
Sbjct  62   DSGDGETQLAPLKFETPSGQLLVQILQSHPHLIPVTVDQQLENLQSEKD------AQNEE  115

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
             +    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KF++ D+ + P
Sbjct  116  AAKVPQDL-LYKRIAEVKEKERQTTLEEIIYCWILFKFVENDISMTP  161



>ref|XP_006653725.1| PREDICTED: uncharacterized protein LOC102702753 [Oryza brachyantha]
Length=399

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 7/110 (6%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +SG     +APL  ESP GQ L QIL SHPHL+ A VD QLE LQ++++       Q  E
Sbjct  70   DSGDGRTRLAPLIFESPSGQLLVQILQSHPHLLPATVDHQLENLQSEKD------AQEKE  123

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
                  D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFMD D+ + PA++
Sbjct  124  ALKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMDNDIAMTPALS  172



>ref|XP_006307539.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
 gb|EOA40437.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
Length=440

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 9/136 (7%)
 Frame = +1

Query  277  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  456
            G  +C ++RA     ++  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  90   GRGRCVTVRALGDEDSNNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  149

Query  457  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  636
                     E +  +   S +  VL +RI+EV+  ERRK L EI+Y LVV +F++  + +
Sbjct  150  A--------ESEALKAETSSSQDVLSKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISM  201

Query  637  VPAITSPSQNSSGSID  684
            +P I  P+ + +G ID
Sbjct  202  IPQI-KPTSDPAGRID  216



>ref|NP_564389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG23441.1|AC084165_7 unknown protein [Arabidopsis thaliana]
 gb|AAK59781.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AAM65447.1| unknown [Arabidopsis thaliana]
 gb|AAO11596.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AEE31442.1| uncharacterized protein AT1G32160 [Arabidopsis thaliana]
Length=406

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 10/136 (7%)
 Frame = +1

Query  277  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  456
            G  +  ++RAS    +S  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  56   GRGRSVTVRASGD-EDSNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  114

Query  457  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  636
                     E ++ +  +S T  +L +RI+EV+  ERRK L EI+Y LVV +F++  + +
Sbjct  115  A--------ESESRKADSSSTQDILQKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISM  166

Query  637  VPAITSPSQNSSGSID  684
            +P I  P+ + +G ID
Sbjct  167  IPRI-KPTSDPAGRID  181



>gb|EMT04061.1| hypothetical protein F775_32804 [Aegilops tauschii]
Length=392

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E
Sbjct  61   DSGDGETQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------E  113

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
             +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA++S
Sbjct  114  KAAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDIQMTPALSS  164



>gb|EMS68345.1| hypothetical protein TRIUR3_07699 [Triticum urartu]
Length=391

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +SG     +AP+K E+P GQ L Q+L S PHL+   VDQQLE L  ++  +K       E
Sbjct  60   DSGDGETQLAPVKFETPSGQLLAQMLQSQPHLIPVTVDQQLENLTAEKIAQK-------E  112

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
             +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA++S
Sbjct  113  KAAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDIQMTPALSS  163



>emb|CDY29940.1| BnaC05g28960D [Brassica napus]
Length=401

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 9/114 (8%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T        E +N +  +S + 
Sbjct  72   PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST--------ENENLKAESSSSQ  123

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
              L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID
Sbjct  124  DSLSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEISMIPQI-KPTSDPAGRID  176



>dbj|BAJ87444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 8/112 (7%)
 Frame = +1

Query  325  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEP  504
            SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E 
Sbjct  62   SGDGEAQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------EK  114

Query  505  SASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPS  660
            +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA+ SPS
Sbjct  115  AAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDISMTPAL-SPS  165



>ref|XP_010478637.1| PREDICTED: uncharacterized protein LOC104757587 [Camelina sativa]
Length=407

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 78/121 (64%), Gaps = 8/121 (7%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+         +NE    +
Sbjct  70   DSNENFAPLAPVELESPVGQLLEQILRTHPHLFPVTVDEQLEKFAA------ENETLKAD  123

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  681
             S+S  D VL +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G I
Sbjct  124  SSSSSQD-VLSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRI  181

Query  682  D  684
            D
Sbjct  182  D  182



>gb|KFK44959.1| hypothetical protein AALP_AA1G325800 [Arabis alpina]
Length=405

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = +1

Query  346  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
            +AP+ LESP+GQ L QIL +HPHL+   VD+QLE+L +      +NE    E   S T  
Sbjct  77   LAPVDLESPVGQLLMQILRTHPHLLPVTVDEQLEKLAS------ENESLKAE--LSSTQD  128

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
            VL +RI+EV+  ERRK L EI+Y LVV +F++  + ++P I  P+ + +G +D
Sbjct  129  VLSKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISMIPQI-KPTSDPAGRVD  180



>ref|XP_010461033.1| PREDICTED: uncharacterized protein LOC104741810 [Camelina sativa]
Length=406

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 75/121 (62%), Gaps = 9/121 (7%)
 Frame = +1

Query  322  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  501
            +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+        K        
Sbjct  70   DSNENFAPLAPVELESPVGQLLDQILRTHPHLFPVTVDEQLEKFAAGNETLKS-------  122

Query  502  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  681
             S+S  DI L +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G I
Sbjct  123  VSSSSQDI-LSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRI  180

Query  682  D  684
            D
Sbjct  181  D  181



>ref|XP_010499760.1| PREDICTED: uncharacterized protein LOC104777247 [Camelina sativa]
Length=410

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 9/114 (8%)
 Frame = +1

Query  343  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  522
            P+AP++LES +GQ L QIL +HPHL    VD+QLE+           E +  +  AS + 
Sbjct  81   PLAPVELESHVGQLLEQILRTHPHLFPVTVDEQLEKFAA--------ENETLKADASSSQ  132

Query  523  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  684
             +L +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G ID
Sbjct  133  DILSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRID  185



>gb|ABR16101.1| unknown [Picea sitchensis]
Length=420

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 94/184 (51%), Gaps = 18/184 (10%)
 Frame = +1

Query  151  CGPVK---SGRRFTTDAPGFVKF-GSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPL  318
            CG +    S  RF  D      F GS+ L      K K           K + I  +   
Sbjct  22   CGRLSRSCSASRFYKDKRVCTDFQGSRDLYGKAVFKSK--------NWHKISGIHIARAE  73

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
             + G  +   APL+L+S  GQ L+ IL + PHL   A  +QLE+L  DR+    +     
Sbjct  74   YHEGYVSSQFAPLELKSSAGQLLSDILQNQPHLFHVAAAKQLEELAADRD----DAITRQ  129

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            E S+S    VL+R+IAE+KA+E + A  E++Y L+VQKF++ +VP+VP + S  +N  G 
Sbjct  130  ELSSSDAYSVLHRKIAELKAHECQTAAGEVIYMLIVQKFVELNVPMVPRLVSCMEN--GK  187

Query  679  IDTL  690
            +DT 
Sbjct  188  VDTW  191



>ref|XP_008800079.1| PREDICTED: uncharacterized protein LOC103714566 isoform X3 [Phoenix 
dactylifera]
Length=372

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +1

Query  415  LVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILY  594
            L ++A+DQQLE+LQ+DR+ +K+      E   +  D+ LYRRIAEVKA ER+KALEEI+Y
Sbjct  75   LENSAIDQQLEKLQSDRDAQKE------ETPPATQDLPLYRRIAEVKAKERQKALEEIIY  128

Query  595  ALVVQKFMDADVPLVPAITSPSQNSS  672
             L+VQKFMD  + ++PAI+  S  +S
Sbjct  129  CLIVQKFMDNGISMIPAISPTSDPNS  154



>ref|XP_006385682.1| hypothetical protein POPTR_0003s09620g [Populus trichocarpa]
 gb|ERP63479.1| hypothetical protein POPTR_0003s09620g [Populus trichocarpa]
Length=145

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 87/160 (54%), Gaps = 26/160 (16%)
 Frame = +1

Query  88   IRHCCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVK----L  255
            IR       ++ S+ S+ T G G +KS +    +      F S + LS PS   K     
Sbjct  4    IRGGAASEVLSVSIPSTSTTG-GALKSPQLLAQN------FHSLSFLSPPSHLTKRCPSF  56

Query  256  GNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVS  423
            G  R+  G  KC     ++RAS    +S G+ +P++PL+ ESP+GQ L QIL +HPHL+ 
Sbjct  57   GIPRLGAGMYKCRPRGLTVRAS---GDSAGNPVPVSPLEFESPVGQLLAQILQTHPHLLP  113

Query  424  AAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  543
            AA+DQQLE LQTDR+ +K       E +AS  D  LY+ +
Sbjct  114  AAIDQQLENLQTDRDAQK-------EEAASSQDF-LYKDV  145



>emb|CAN81624.1| hypothetical protein VITISV_014254 [Vitis vinifera]
Length=169

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 13/95 (14%)
 Frame = +1

Query  265  RVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  432
            ++  G  KC     ++RAS+   NS    +P+APL+LESPIGQ L QIL +HPHL+ AA+
Sbjct  84   KLGVGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESPIGQLLAQILQTHPHLLPAAI  140

Query  433  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            DQQLE LQTDR      + Q +E   S  D++LYR
Sbjct  141  DQQLENLQTDR------DAQREEAPPSSHDLLLYR  169



>gb|KHG07714.1| Ribosomal L11 methyltransferase [Gossypium arboreum]
Length=340

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            RIAEVKANER++ALEEILYALVV KFMDADV LVPAIT  S++SSG +DT 
Sbjct  72   RIAEVKANERKRALEEILYALVVLKFMDADVSLVPAITPSSKDSSGQVDTW  122



>gb|KDO57187.1| hypothetical protein CISIN_1g035864mg [Citrus sinensis]
Length=135

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 13/94 (14%)
 Frame = +1

Query  229  SAPSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQ  393
            S PS  + KLGN     G  KC     ++RAS    +S  + +PIAPL+ ESP+GQ L Q
Sbjct  46   SCPSFCIPKLGN-----GMDKCRMRDLTVRAS---GSSDQNVVPIAPLQFESPVGQLLAQ  97

Query  394  ILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  495
            IL +HPHL+ AA+DQQLE +Q D+N+++++  Q+
Sbjct  98   ILQTHPHLLPAAIDQQLENIQIDKNVQREDTSQD  131



>ref|XP_002981973.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
 gb|EFJ17066.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
Length=324

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  391  QILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERR  570
            Q L  +PHL  AA +QQLE L  +R          ++P+ +G D +LY+RIA++K+ ERR
Sbjct  2    QTLKGNPHLFHAAAEQQLELLDLERR------SALEQPNPAGNDHILYKRIAQLKSEERR  55

Query  571  KALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            +A++E++Y LVV+KF+ A + +VP I++      GS
Sbjct  56   RAVQEVIYVLVVEKFLKAGIKMVPKISALVNREGGS  91



>ref|XP_002982952.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
 gb|EFJ16197.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
Length=324

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  391  QILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERR  570
            Q L  +PHL  AA +QQLE L  +R          ++P+ +G D +LY+RIA++K+ ERR
Sbjct  2    QTLKGNPHLFHAAAEQQLELLDLERR------SALEQPNPAGNDHILYKRIAQLKSEERR  55

Query  571  KALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            +A++E++Y LVV+KF+ A + +VP I++      GS
Sbjct  56   RAVQEVIYVLVVEKFLKAGIKMVPKISALVNREGGS  91



>ref|XP_010908554.1| PREDICTED: uncharacterized protein LOC105034920 isoform X1 [Elaeis 
guineensis]
Length=408

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = +1

Query  325  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  498
            SG  +MP+ P+   SP G+FL  IL + PH+  AA ++QLE+L  DRN    +       
Sbjct  82   SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPAAAERQLEELANDRNGAFIRWAHSMGS  138

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++
Sbjct  139  EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLS  183



>ref|XP_010908555.1| PREDICTED: uncharacterized protein LOC105034920 isoform X2 [Elaeis 
guineensis]
Length=351

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 66/111 (59%), Gaps = 11/111 (10%)
 Frame = +1

Query  325  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  498
            SG  +MP+ P+   SP G+FL  IL + PH+  AA ++QLE+L  DRN    +       
Sbjct  25   SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPAAAERQLEELANDRNGAFIRWAHSMGS  81

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++
Sbjct  82   EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLS  126



>gb|KDO36404.1| hypothetical protein CISIN_1g034247mg [Citrus sinensis]
Length=100

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  474
            ++RAS    +S  + +PIAPL+ ESP+GQ L QIL +HPHL+ AA+DQQLE +Q D+N++
Sbjct  10   TVRAS---GSSDRNVVPIAPLQFESPVGQLLAQILQTHPHLLPAAIDQQLENIQIDKNVQ  66

Query  475  KQNEKQN  495
            +++  Q+
Sbjct  67   REDTSQD  73



>ref|XP_010088656.1| hypothetical protein L484_007878 [Morus notabilis]
 gb|EXB36816.1| hypothetical protein L484_007878 [Morus notabilis]
Length=255

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 69/117 (59%), Gaps = 18/117 (15%)
 Frame = +1

Query  208  FGSKALLSA------PSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLE  366
            + SK+ LS+      PS    KLGN    +   K  ++RAS    +S G+ +P APL+ E
Sbjct  34   YDSKSFLSSGFFRSCPSFYFPKLGNALYKY-RAKDVTVRAS---EHSSGNLVPFAPLQFE  89

Query  367  SPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  537
            SP+GQ L QIL +HPHL+  A+DQQLE L+TDR+       Q  E S+S  D+ LY+
Sbjct  90   SPVGQLLCQILQTHPHLLPVAIDQQLENLETDRD------AQEKEVSSSPQDL-LYK  139



>emb|CAL07981.1| hypothetical protein [Platanus x acerifolia]
Length=273

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +1

Query  535  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  678
            RRIAEVKANERRKALEEILYALVVQKFMDADV L+P I SPS  +  S
Sbjct  1    RRIAEVKANERRKALEEILYALVVQKFMDADVSLMPTI-SPSSATDAS  47



>ref|XP_008776305.1| PREDICTED: uncharacterized protein LOC103696450 [Phoenix dactylifera]
Length=408

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 64/111 (58%), Gaps = 11/111 (10%)
 Frame = +1

Query  325  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  498
            SG  +MP+ P+   SP G+FL  IL + PH+   A  +QLE+L  DRN    +       
Sbjct  82   SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPVAAARQLEELANDRNGAFVRWAHSMGS  138

Query  499  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++
Sbjct  139  EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLS  183



>ref|XP_006848511.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
 gb|ERN10092.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
Length=424

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 92/179 (51%), Gaps = 28/179 (16%)
 Frame = +1

Query  172  RRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRV----AFGSTKCNSIRASLPLSNSGGSA  339
            R F  +  G VKF +       + K K G  R+    + GS KC++ +            
Sbjct  44   RSFEANFRGSVKFNNVGPFGVDT-KNKNGKARLGPVASAGSGKCHTRKV-----------  91

Query  340  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSAS  513
               +P++ +S  G+ L+ IL  H HL + AV +Q+E+L  DR   + +Q     +E S  
Sbjct  92   --FSPMEPQSEEGKLLSHILQYHRHLFNGAVSEQIEKLSADRAGAIARQELCVGNEES--  147

Query  514  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
                +L+RR+AE++  E + A+EE++Y L+V KF + +VP+VP ++   +N  G  DT 
Sbjct  148  ----LLHRRVAELREKECQVAIEEVMYMLIVHKFSEINVPMVPRLSKCIKN--GKADTW  200



>ref|XP_003081567.1| unnamed protein product, partial [Ostreococcus tauri]
Length=218

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            AP   ESP GQ L  IL + P +  +AVD QL+ L   R +E++  +  +    S   +V
Sbjct  60   APSTPESPRGQQLAYILRTSPEMFESAVDSQLDALV--REIEEEGARAGE----SSEQLV  113

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
            LY+RIA+V+A ERR  LE+I+Y  ++QKF+   V ++P
Sbjct  114  LYKRIADVRALERRNGLEDIMYTSIIQKFLSVGVDMLP  151



>ref|XP_010271747.1| PREDICTED: uncharacterized protein LOC104607751 [Nelumbo nucifera]
Length=141

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
            RIA VKANERRKALEEILYAL+VQKFMDA+V L+PAI S
Sbjct  54   RIAGVKANERRKALEEILYALIVQKFMDANVSLIPAILS  92



>gb|EYU24492.1| hypothetical protein MIMGU_mgv1a012902mg [Erythranthe guttata]
Length=236

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  538  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  654
            RIAEVKANERRK LEEILYALVVQKFMDADV LVP I S
Sbjct  67   RIAEVKANERRKTLEEILYALVVQKFMDADVALVPNIAS  105



>emb|CEF99337.1| Protein of unknown function DUF760 [Ostreococcus tauri]
Length=443

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            AP   ESP GQ L  IL + P +  +AVD QL+ L   R +E++  +  +    S   +V
Sbjct  60   APSTPESPRGQQLAYILRTSPEMFESAVDSQLDALV--REIEEEGARAGE----SSEQLV  113

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
            LY+RIA+V+A ERR  LE+I+Y  ++QKF+   V ++P
Sbjct  114  LYKRIADVRALERRNGLEDIMYTSIIQKFLSVGVDMLP  151



>gb|AFK33975.1| unknown [Lotus japonicus]
Length=157

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 10/86 (12%)
 Frame = +1

Query  298  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  477
            +RAS   ++S  + +P APL+ ESP+GQ L QI+ +H HL+S A+DQQLE LQT R+  K
Sbjct  72   MRAS---ADSSDNLVPSAPLQFESPVGQLLGQIMQNHSHLLSTAIDQQLENLQTARDAPK  128

Query  478  QNEKQNDEPSASGTDIVLYRRIAEVK  555
                   E S + +   LY+RIAE+K
Sbjct  129  -------EESFTSSPDPLYKRIAELK  147



>ref|XP_001420115.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98408.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=441

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            AP   ESP GQ L  IL + P +  AAVD QL+ L      E + E ++    A    +V
Sbjct  65   APSTPESPRGQQLAYILRTAPEMFDAAVDSQLDGLGE----EVEREAKSASEEAKTEQLV  120

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
            L++RIA+V+A ERR  LE+I+Y  ++QKF+   V ++P
Sbjct  121  LFKRIADVRALERRNGLEDIMYTTIIQKFLSVGVDMLP  158



>ref|NP_001143759.1| uncharacterized protein LOC100276521 [Zea mays]
 gb|ACG35058.1| hypothetical protein [Zea mays]
Length=390

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 77/145 (53%), Gaps = 22/145 (15%)
 Frame = +1

Query  271  AFGSTKC----------NSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQI  396
            AFG   C           SI A+  L ++  SA P         APL+ ++  G FL  +
Sbjct  30   AFGYYTCWQLQGNILNWRSISATKKLWSTVASAKPDDSKFESVDAPLEPQTCEGSFLCGL  89

Query  397  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  576
            L + PH+  AA ++QL++L   R    +   +  E S    +  L+RRIAE+K +E ++A
Sbjct  90   LKNLPHIFLAAAEKQLQELSYQR----EESLKRWEHSIGSKEDCLHRRIAELKEHECQRA  145

Query  577  LEEILYALVVQKFMDADVPLVPAIT  651
            +E+I+Y L+V KF   +VP+VP ++
Sbjct  146  IEDIMYMLIVYKFFKIEVPMVPNLS  170



>ref|XP_001691046.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05492.1| predicted protein [Chlamydomonas reinhardtii]
Length=445

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +1

Query  301  RASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQ  480
            RAS  + ++  +   +AP + ++P G+ L   L   PHL   AVD +L +L+ D   E++
Sbjct  15   RASKLVVHAEANEFGLAPAQPKTPYGEMLQYYLRMEPHLFRTAVDSELAKLR-DEKRERR  73

Query  481  NEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
             +++    S+ GT++ LY+R+ EV+A E R  LE+++Y  +++KF+   V ++P
Sbjct  74   AKEETLAASSDGTELALYKRMEEVRAREVRSTLEDLMYVSILEKFLLLGVDMLP  127



>gb|AAQ14307.1| ABRH7, partial [Marsilea quadrifolia]
Length=176

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +1

Query  331  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  510
             S  P+APL  ESP GQFLT++L SHPHLV AA +QQLE L   R      E    +P+ 
Sbjct  110  ASTTPLAPLIPESPSGQFLTELLQSHPHLVPAAAEQQLETLAEAREAASSQE----QPTP  165

Query  511  SGTDIVLYRR  540
             G ++VLY+R
Sbjct  166  DGNELVLYKR  175



>gb|ACF84114.1| unknown [Zea mays]
 gb|AFW60826.1| hypothetical protein ZEAMMB73_797295 [Zea mays]
Length=390

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 22/145 (15%)
 Frame = +1

Query  271  AFGSTKC----------NSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQI  396
            AFG   C           SI A+  L ++  SA P         APL+ ++  G FL  +
Sbjct  30   AFGYYTCWQLQGNILNWRSISATKKLWSTVASAKPDDSKFESVDAPLEPQTCEGSFLCGL  89

Query  397  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  576
            L + PH+  AA  +QL++L   R    +   +  E S    +  L+RRIAE+K +E ++A
Sbjct  90   LKNLPHIFLAAAAKQLQELSYQR----EESLKRWEHSIGSKEDCLHRRIAELKEHECQRA  145

Query  577  LEEILYALVVQKFMDADVPLVPAIT  651
            +E+++Y L+V KF   +VP+VP ++
Sbjct  146  IEDVMYMLIVYKFFKIEVPMVPNLS  170



>gb|AGT16908.1| hypothetical protein SHCRBa_217_A17_F_90 [Saccharum hybrid cultivar 
R570]
Length=391

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 5/131 (4%)
 Frame = +1

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  438
            N R  F + K  S  AS    +S   ++  APL+ ++  G FL  +L + PH+  AA  +
Sbjct  45   NWRSIFAAKKLWSTVASAKPDDSKFESVD-APLEPQTWEGSFLCGLLKNLPHIFLAAAAK  103

Query  439  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  618
            QL++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF 
Sbjct  104  QLQELSYQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFF  159

Query  619  DADVPLVPAIT  651
              +VP+VP ++
Sbjct  160  KIEVPMVPNLS  170



>ref|XP_004979240.1| PREDICTED: uncharacterized protein LOC101761319 [Setaria italica]
Length=393

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 71/131 (54%), Gaps = 5/131 (4%)
 Frame = +1

Query  259  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  438
            N R  F S K  S  A     +S   ++  APL+ E+  G FL  +L + PH+  AA  +
Sbjct  47   NWRSKFASKKLLSTVAGAMPDDSEFESVD-APLEPETWEGSFLCGLLKNLPHIFLAAAAK  105

Query  439  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  618
            QL++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF 
Sbjct  106  QLQELSNQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFF  161

Query  619  DADVPLVPAIT  651
              +VP+VP ++
Sbjct  162  KIEVPMVPNLS  172



>ref|XP_003520988.1| PREDICTED: uncharacterized protein LOC100793365 [Glycine max]
Length=393

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query  223  LLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI------APLKLESPIGQF  384
              + P +    G  RVA  S+ C       P   +   A P       +PL+  S +G+F
Sbjct  27   FFTRPDLGGGGGGVRVASSSSSCLLFHRRRPFIRASAGASPCEFSSLNSPLEPRSMVGKF  86

Query  385  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  564
            L  +L +HP +   AV ++L+ L  DR+             ++  + +L+RRIA VK N+
Sbjct  87   LIGVLQNHPQMFHLAVGEELKLLAEDRDAAHARMVLG----SASDEALLHRRIALVKENQ  142

Query  565  RRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
             + A+E+++Y L+  KF +  VP+VP ++S   N
Sbjct  143  CQIAVEDVIYLLIFYKFSEIRVPMVPKLSSCLYN  176



>ref|XP_008676966.1| PREDICTED: uncharacterized protein LOC100276521 isoform X1 [Zea 
mays]
Length=398

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 12/127 (9%)
 Frame = +1

Query  295  SIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  450
            SI A+  L ++  SA P         APL+ ++  G FL  +L + PH+  AA  +QL++
Sbjct  56   SISATKKLWSTVASAKPDDSKFESVDAPLEPQTCEGSFLCGLLKNLPHIFLAAAAKQLQE  115

Query  451  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  630
            L   R    +   +  E S    +  L+RRIAE+K +E ++A+E+++Y L+V KF   +V
Sbjct  116  LSYQR----EESLKRWEHSIGSKEDCLHRRIAELKEHECQRAIEDVMYMLIVYKFFKIEV  171

Query  631  PLVPAIT  651
            P+VP ++
Sbjct  172  PMVPNLS  178



>ref|XP_010247844.1| PREDICTED: uncharacterized protein LOC104590798 [Nelumbo nucifera]
Length=415

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDI  525
            PL+L S  G+FL+ IL +  HL + AV +QL++L  DR+  + + N       S   ++ 
Sbjct  91   PLELTSSAGKFLSDILQNQRHLFNVAVKEQLDELAFDRDGAVGRMN------LSVGSSES  144

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
             L+RRIAE+K    + A+E+++Y LVV +F   +VP+VP ++   +N
Sbjct  145  CLHRRIAELKECVCQIAIEDVMYMLVVHQFSKVEVPMVPRLSRCVRN  191



>ref|XP_006599165.1| PREDICTED: uncharacterized protein LOC100804253 [Glycine max]
Length=388

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 68/114 (60%), Gaps = 6/114 (5%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            +PL+  S +G+FL+ +L +HP +   AV ++L+ L  DR+             ++  + +
Sbjct  70   SPLEPRSMVGKFLSAVLQNHPQMFHVAVGEELKLLAEDRDAAHARMVLG----SASDEAL  125

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            L+RRIA+VK N+ + A+E+++Y L+  KF +  VP+VP ++S   N  G ++ L
Sbjct  126  LHRRIAQVKENQCQIAVEDVMYLLIFYKFSEIRVPMVPKLSSCLYN--GRLEIL  177



>gb|AGT15907.1| hypothetical protein SHCRBa_013_F04_R_50 [Saccharum hybrid cultivar 
R570]
Length=391

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = +1

Query  289  CNSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
              SI A+  L ++  SA P         APL+ ++  G FL  +L + PH+  AA  +QL
Sbjct  46   WRSISAAKKLWSTVASAKPDDSKFESVDAPLEPQTWEGSFLCGLLKNLPHIFLAAAAKQL  105

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            ++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF   
Sbjct  106  QELSYQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFFKI  161

Query  625  DVPLVPAIT  651
            +VP+VP ++
Sbjct  162  EVPMVPNLS  170



>gb|AGT16639.1| Protein of unknown function DUF760 [Saccharum hybrid cultivar 
R570]
Length=390

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = +1

Query  289  CNSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
              SI A+  L ++  SA P         APL+ ++  G FL  +L + PH+  AA  +QL
Sbjct  46   WRSISAAKKLWSTVASAKPDDSKFESVDAPLEPQTWEGSFLCGLLKNLPHIFLAAAAKQL  105

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            ++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF   
Sbjct  106  QELSYQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFFKI  161

Query  625  DVPLVPAIT  651
            +VP+VP ++
Sbjct  162  EVPMVPNLS  170



>dbj|BAK05587.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 87/167 (52%), Gaps = 18/167 (11%)
 Frame = +1

Query  193  PGFVKFGSK--ALLSAPSIKVKLG---NRRVAFGSTKCNSIRASLPLSNSGGSAMPI---  348
            P  V  GS+  + LS+PS   + G   NRR     +KC S +    ++ + G        
Sbjct  17   PAAVCRGSRRPSYLSSPSPCWQQGDMLNRR-----SKCTSRKLLTTVTGAKGDESEFDSV  71

Query  349  -APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  525
             APL+ ++  G FL  +L + P +   A  +QL+QL    ++++++     E S    + 
Sbjct  72   NAPLEPQTWEGSFLCGLLKNQPQIFLVAAARQLQQL----SIQRKDTLTRWEHSIGSPEN  127

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
             L+RRIAE+K  E R A+E+++Y L+V K+   +VP+VP ++    N
Sbjct  128  CLHRRIAEMKEQECRTAIEDVMYMLIVHKYSKIEVPMVPNLSKIINN  174



>gb|AGT16547.1| hypothetical protein SHCRBa_093_N12_F_10 [Saccharum hybrid cultivar 
R570]
 gb|AGT16881.1| hypothetical protein SHCRBa_172_L15_F_10 [Saccharum hybrid cultivar 
R570]
Length=391

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = +1

Query  289  CNSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQILVSHPHLVSAAVDQQL  444
              SI A+  L ++  SA P         APL+ ++  G FL  +L + PH+  AA  +QL
Sbjct  46   WRSISAAKKLWSTVASAKPDDSKFESVDAPLEPQTWEGSFLCGLLKNLPHIFLAAAAKQL  105

Query  445  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  624
            ++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF   
Sbjct  106  QELSYQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFFKI  161

Query  625  DVPLVPAIT  651
            +VP+VP ++
Sbjct  162  EVPMVPNLS  170



>ref|XP_003577586.1| PREDICTED: uncharacterized protein LOC100826589 [Brachypodium 
distachyon]
Length=387

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            APL+ ++  G FL  +L S PH+   A  + L+QL   RN    +     E S   ++  
Sbjct  69   APLEPQTWEGSFLCGLLKSQPHIFLVAATKLLQQLSLKRN----DSLIRWEHSIGSSEDC  124

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            L+RRIAE+K  E R A+E+++Y L+V  +   +VP+VP ++    N
Sbjct  125  LHRRIAEMKEQECRTAIEDVMYMLIVHNYFKIEVPMVPNLSKLISN  170



>ref|XP_007134152.1| hypothetical protein PHAVU_010G023700g [Phaseolus vulgaris]
 gb|ESW06146.1| hypothetical protein PHAVU_010G023700g [Phaseolus vulgaris]
Length=392

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 64/107 (60%), Gaps = 6/107 (6%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD-I  525
            +PL+  S +G+FL+ +L +HP +   AV ++L+ L  DR+              S TD  
Sbjct  74   SPLEPRSMVGKFLSGVLQNHPQMFHVAVGEELKLLAEDRD-----AAHARMVLGSVTDEA  128

Query  526  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            +L+RRIA++K N+ + A+E+++Y L+  KF +  VPLVP ++S   N
Sbjct  129  LLHRRIAQLKENQCQIAVEDVMYLLIFYKFSEIRVPLVPKLSSCLYN  175



>gb|AFW59313.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=135

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 7/73 (10%)
 Frame = +1

Query  319  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  498
            + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++++       Q++
Sbjct  70   AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLENLQSEKS------AQSE  123

Query  499  EPSASGTDIVLYR  537
            E S    D+ LY+
Sbjct  124  EASKVPQDL-LYK  135



>ref|XP_003055064.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60316.1| predicted protein [Micromonas pusilla CCMP1545]
Length=493

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 61/112 (54%), Gaps = 14/112 (13%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL--QTDRNLEKQN---EKQNDEPSAS  513
            AP+   SP GQ L  +L + P L  AAV+  L++L  + D      N   +  ND+   +
Sbjct  86   APMDPGSPQGQLLAHVLDNEPQLFDAAVEATLDRLCDEIDDAESASNGVIDVTNDDGDGN  145

Query  514  GTD---------IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  642
              D         +VL+RRI E++A ERR  +++++YA ++QKFM   V ++P
Sbjct  146  AADRAAPKKGGELVLFRRIQEMRAMERRSGVQDVMYAQILQKFMTIGVDMLP  197



>ref|XP_011399310.1| WD repeat-containing protein 89-like protein [Auxenochlorella 
protothecoides]
 gb|KFM26414.1| WD repeat-containing protein 89-like protein [Auxenochlorella 
protothecoides]
Length=655

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            AP    + +G+  +  L   PHL    VD+Q   LQ  +  ++ +E   +  S++ TD+V
Sbjct  370  APSPPTTSLGEMASYYLSVQPHLFQETVDRQFSLLQEAKEKDQASES-GEGTSSTSTDLV  428

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  690
            L RR+AEV+  ER +A+E+++Y  ++ KF D  V ++P I    ++S    DTL
Sbjct  429  LSRRMAEVQRAERGRAVEDLMYVCILGKFRDLGVDMLPRIEEVQESS----DTL  478



>ref|XP_002503881.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65139.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 76/141 (54%), Gaps = 18/141 (13%)
 Frame = +1

Query  262  RRVAFGSTKCNSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQILVSHPHL  417
            RRV  G+ K  + + S    +S  S+ P         AP+   S  GQ L  +L + P L
Sbjct  85   RRVRRGAVKVAAAKGS----DSDSSSNPKRPDPTFQGAPMSPGSGHGQMLAHVLDAEPQL  140

Query  418  VSAAVDQQLEQLQTDRNLEKQNEKQ----NDEPSASGTDIVLYRRIAEVKANERRKALEE  585
              AAV+  L+++  + + ++Q+E       DE    G  +VL+RRI +++A ERR  +++
Sbjct  141  FEAAVEATLDRMIDELDQQEQSEGSIDVSQDEKDKGG--MVLFRRIEQMRALERRSGVQD  198

Query  586  ILYALVVQKFMDADVPLVPAI  648
            ++YA ++QKF+   V ++P +
Sbjct  199  VMYANILQKFLSIGVDMLPPL  219



>ref|XP_004510240.1| PREDICTED: uncharacterized protein LOC101489146 [Cicer arietinum]
Length=383

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 9/165 (5%)
 Frame = +1

Query  172  RRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  351
            R   T  P    F +  ++S+  +  +    RVA        I+AS   S+   S++  +
Sbjct  7    RHHFTIKPQIGGFFTTPIISSSCLNFRCSGNRVALKRV----IKASGGASHCEFSSLN-S  61

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL+  S +G+FL+ +  +H  L   AV ++L+ L  DR    Q        +++    +L
Sbjct  62   PLEPRSLVGKFLSGVFQNHRQLFHVAVQEELKLLSDDR----QAALSRMLLASNSDQALL  117

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            +RRIA++K N+   A+E+I+  L+  KF +  VPLVP ++S   N
Sbjct  118  HRRIAQIKENQCEVAVEDIMSLLIFYKFSEIRVPLVPKLSSCLYN  162



>ref|XP_010100787.1| hypothetical protein L484_015816 [Morus notabilis]
 gb|EXB84485.1| hypothetical protein L484_015816 [Morus notabilis]
Length=363

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 6/100 (6%)
 Frame = +1

Query  370  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND-EPSASGTDIVLYRRIA  546
            P G+ L  +L++HP L   +V  +L+ L  DR+  +    ++D  P A      L+RRIA
Sbjct  51   PAGKALIGVLLNHPQLFHLSVADELKHLADDRDAARNRMIRSDGSPEA-----CLHRRIA  105

Query  547  EVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            ++K NE + A+E+I+Y L+  KF +  VPLVP ++    N
Sbjct  106  QLKENECQVAVEDIMYLLIFYKFSEIKVPLVPRLSGCVYN  145



>ref|XP_004290164.1| PREDICTED: uncharacterized protein LOC101305809 [Fragaria vesca 
subsp. vesca]
Length=379

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            +PL   +  G+ L+ +L +HP L   AV Q+L+QL  +R    Q+ +     SA   +  
Sbjct  58   SPLDPRTRSGKDLSSVLQNHPQLFHLAVAQELKQLADER----QDARCRMNLSAQSHEAC  113

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            L+RRIA++K  + + A+E+++Y L+  KF +  VPLVP ++    N
Sbjct  114  LHRRIAQLKEQQCQIAVEDVMYLLIFYKFSEVKVPLVPKLSKCIYN  159



>gb|ABA93505.2| expressed protein [Oryza sativa Japonica Group]
 gb|EAY80821.1| hypothetical protein OsI_36001 [Oryza sativa Indica Group]
 gb|EAZ18271.1| hypothetical protein OsJ_33807 [Oryza sativa Japonica Group]
Length=388

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            APL+ ++  G FL  +L + P ++  A  +QL++L   R    ++     E S    +  
Sbjct  69   APLEPQTWEGSFLCGLLKNQPQVLPVAAAKQLQELSNQR----KDTLIRWEHSIGSPEDC  124

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            L+RRIAE+K +E + A+E+I+Y L+V KF   +VPLVP ++
Sbjct  125  LHRRIAEMKEHECQTAIEDIMYTLIVYKFFKIEVPLVPNLS  165



>ref|NP_001067848.2| Os11g0456100 [Oryza sativa Japonica Group]
 gb|ABA93506.2| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG94195.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28211.2| Os11g0456100 [Oryza sativa Japonica Group]
Length=351

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            APL+ ++  G FL  +L + P ++  A  +QL++L   R    ++     E S    +  
Sbjct  32   APLEPQTWEGSFLCGLLKNQPQVLPVAAAKQLQELSNQR----KDTLIRWEHSIGSPEDC  87

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            L+RRIAE+K +E + A+E+I+Y L+V KF   +VPLVP ++
Sbjct  88   LHRRIAEMKEHECQTAIEDIMYTLIVYKFFKIEVPLVPNLS  128



>emb|CDP03929.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 73/147 (50%), Gaps = 21/147 (14%)
 Frame = +1

Query  262  RRVAFGS-TKCNSIRASLPLSNSG---------GSAMPIAPLKLESPIGQFLTQILVSHP  411
            RR+ FG  T+    R  L L+ SG         G   P+ P    +P G+ L  +L++ P
Sbjct  40   RRINFGGRTRSPYRRGFLVLAASGTGSECGEYRGLYTPVQP---TTPAGRLLGTVLLNDP  96

Query  412  HLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEE  585
                  V +QLEQL  DR   L + N       S++  +  L+RRIAE+K +E + A+E+
Sbjct  97   DYFPQVVQKQLEQLAVDRYEALLRMN------LSSASHEACLHRRIAELKEHECQAAIED  150

Query  586  ILYALVVQKFMDADVPLVPAITSPSQN  666
             +Y ++  KF +  V LVP ++    N
Sbjct  151  AMYVVICSKFYEIRVHLVPQLSKCMYN  177



>ref|XP_010685095.1| PREDICTED: uncharacterized protein LOC104899578 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 60/100 (60%), Gaps = 4/100 (4%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PLKL+SP+G+ L+ +L + PH    AV  +L ++  DR+          + S   ++  L
Sbjct  53   PLKLKSPVGRSLSSVLQNEPHCFYDAVSVELNRIAEDRD----AAFARFDLSLGSSEASL  108

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            +RRIA++K  E + A+E++LY +++  F +  VPL P+++
Sbjct  109  HRRIAKLKEEECQVAVEDVLYMIILYNFSEFKVPLAPSLS  148



>ref|XP_006662927.1| PREDICTED: uncharacterized protein LOC102711023 [Oryza brachyantha]
Length=351

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +1

Query  349  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  528
            APL+ ++  G FL  +L + P ++  A  +QL++L + R    ++     E S    +  
Sbjct  32   APLEPQTWEGSFLCGLLKNQPQVLPVAAAKQLQELSSQR----KDTLIRWEHSIGSPEDC  87

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            L+RRIAE+K  E + A+E+I+Y L+V KF   +VPLVP ++    N
Sbjct  88   LHRRIAEMKDQECQTAIEDIMYTLIVYKFFKIEVPLVPNLSKLISN  133



>ref|XP_011024597.1| PREDICTED: uncharacterized protein LOC105125729 [Populus euphratica]
Length=404

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV-  528
            PL+L S  G+FL+ +  +   L   AV  +L+ L  DR+        +    +SG+D   
Sbjct  80   PLELRSAAGKFLSGVFQNQKQLFHVAVTDELKLLADDRD-----SALSRMVRSSGSDEAS  134

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  681
            L+RRIAE+K +E + A+E+++Y LV+ KF +  VPLVP ++    N+   I
Sbjct  135  LHRRIAELKEHECQVAVEDVMYMLVLYKFSEIRVPLVPKLSRCIYNARLEI  185



>ref|XP_010274079.1| PREDICTED: uncharacterized protein LOC104609452 [Nelumbo nucifera]
Length=414

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 4/105 (4%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            P +  S  G+FL+ +L +  HL + AV + L++L   R+          + S   ++  L
Sbjct  90   PFEPCSSAGKFLSGVLQNQRHLFNVAVAETLDELAAGRD----GATARRDLSIGSSESCL  145

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
            +RRIAE+K  E + A+E+++Y LVV KF + +VP++P ++   +N
Sbjct  146  HRRIAELKEFECQIAVEDVMYMLVVHKFSEINVPMIPRLSRCVRN  190



>ref|XP_010069618.1| PREDICTED: uncharacterized protein LOC104456510 [Eucalyptus grandis]
 gb|KCW58026.1| hypothetical protein EUGRSUZ_H00754 [Eucalyptus grandis]
Length=389

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 4/100 (4%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  531
            PL  +S  G++LT++L +   L  AAV ++L+QL  DR+            SA   +  L
Sbjct  68   PLVPKSAAGRYLTRVLQNQRQLFHAAVAEELKQLADDRDAAVSRVLL----SAGSDEACL  123

Query  532  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            +RRIAE+K  +R+ A+++++Y L++ KF +  V LVP ++
Sbjct  124  HRRIAEIKERDRQVAIKDVMYMLILYKFSEIRVHLVPKLS  163



>ref|XP_002303068.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
 gb|EEE82341.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
Length=407

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 60/101 (59%), Gaps = 6/101 (6%)
 Frame = +1

Query  352  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV-  528
            PL+L S  G+FL+ +  +   L   AV  +L+ L  DR+        +    +SG+D   
Sbjct  83   PLELRSAAGKFLSGVFQNQKQLFHVAVADELKLLADDRD-----SALSRMVRSSGSDEAS  137

Query  529  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            L+RRIAE+K +E + A+E+++Y LV+ KF +  VPLVP ++
Sbjct  138  LHRRIAELKEHECQVAVEDVMYMLVLYKFSEIRVPLVPKLS  178



>ref|XP_008341108.1| PREDICTED: LOW QUALITY PROTEIN: cell division control protein 
48-like [Malus domestica]
Length=408

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 8/68 (12%)
 Frame = +1

Query  427  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  606
            A+DQQLE LQ +R  ++       E +AS  D+ LY+ IA+VK  ERR ALE I+Y+L++
Sbjct  176  AIDQQLENLQIERGAQR-------EEAASSVDL-LYKHIAKVKEKERRMALEXIIYSLIM  227

Query  607  QKFMDADV  630
             KF+D ++
Sbjct  228  HKFLDKEI  235



>ref|XP_002948306.1| hypothetical protein VOLCADRAFT_88515 [Volvox carteri f. nagariensis]
 gb|EFJ50713.1| hypothetical protein VOLCADRAFT_88515 [Volvox carteri f. nagariensis]
Length=403

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  382  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  561
             L   L   PHL   AVD QL +L+ ++ L +Q +++    S+ GT++ LYRR+ EV+  
Sbjct  1    MLQYYLRMEPHLFKTAVDTQLTKLREEK-LRRQEKEEQLLASSDGTELALYRRMEEVREV  59

Query  562  ERRKALEEILYALVVQKFMDADVPLVP  642
            E R  LE+++Y  +++KF+   V ++P
Sbjct  60   EVRATLEDLMYVSILEKFLLLGVDMLP  86



>ref|XP_006280743.1| hypothetical protein CARUB_v10026712mg [Capsella rubella]
 gb|EOA13641.1| hypothetical protein CARUB_v10026712mg [Capsella rubella]
Length=345

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = +1

Query  316  LSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  495
            ++ SG  A   APL   S  G+FL+ +LV    L   AV   L+QL  D    K+     
Sbjct  47   IAASGAGASLDAPLVPRSAQGRFLSSVLVKKRQLFHFAVADLLKQLADD----KEAALSR  102

Query  496  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQN  666
               S+   +  L+RRIA++K ++ + A+E+I+Y L++ KF +  VPLVP + S   N
Sbjct  103  MFLSSGSDEASLHRRIAQLKESDCQTAIEDIMYMLILYKFSEIRVPLVPKLPSCVYN  159



>ref|XP_010552027.1| PREDICTED: uncharacterized protein LOC104822482 [Tarenaya hassleriana]
Length=386

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +1

Query  331  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  510
            GS++ + PL+L S  G+FL+ +L + P L   A   +L+QL  DR         +    +
Sbjct  65   GSSLNL-PLELRSVQGKFLSSVLQNKPQLFHFAAADELKQLADDRE-----SAVSRMILS  118

Query  511  SGTD-IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  651
            SG+D   L+RRIA++K +  + A+++I+Y L+  KF +  VPLVP ++
Sbjct  119  SGSDEACLHRRIAQLKEHYSQIAVQDIMYMLIFYKFSEIRVPLVPKLS  166



>ref|NP_199670.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10692.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO41921.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63919.1| unknown protein [Arabidopsis thaliana]
 gb|AED95692.1| uncharacterized protein AT5G48590 [Arabidopsis thaliana]
Length=344

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 5/121 (4%)
 Frame = +1

Query  307  SLPLSNSGGSAMPI-APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQN  483
            SL + ++  S   I APL   SP G+FL+ +LV    L   AV   L+QL  D    K+ 
Sbjct  42   SLVVVSAASSGQSIDAPLVPRSPQGRFLSSVLVKKRQLFHFAVADLLKQLADD----KEA  97

Query  484  EKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQ  663
                   S    +  L+RRIA++K ++ + A+E+I+Y L++ KF +  VPLVP + S   
Sbjct  98   SLSRMFLSYGSDEASLHRRIAQLKESDCQIAIEDIMYMLILYKFSEIRVPLVPKLPSCIY  157

Query  664  N  666
            N
Sbjct  158  N  158



>gb|KJB42555.1| hypothetical protein B456_007G157400 [Gossypium raimondii]
Length=398

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (51%), Gaps = 5/140 (4%)
 Frame = +1

Query  247  VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSA  426
            ++ G     F   K  S++AS   S+   S++  APL+ +S  G+FL+ +L +       
Sbjct  42   LRTGFTSTPFNGRKAPSVKASAGASHCDFSSLN-APLEPKSAPGKFLSGVLQNQRQFFHF  100

Query  427  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  606
            A   +L++L  DR+            S    +  L+RRIA++K  E + A+E+++Y L+ 
Sbjct  101  AAADELKRLSDDRDAAVARMF----VSLDSDEACLHRRIAQLKEQECQAAVEDVMYMLIF  156

Query  607  QKFMDADVPLVPAITSPSQN  666
             KF D  VPLVP ++    N
Sbjct  157  YKFSDLRVPLVPKLSRCMYN  176



Lambda      K        H        a         alpha
   0.315    0.130    0.366    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520