BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029G03

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769969.1|  PREDICTED: uncharacterized protein LOC104220...    182   6e-52   Nicotiana sylvestris
ref|XP_009769968.1|  PREDICTED: uncharacterized protein LOC104220...    182   8e-52   Nicotiana sylvestris
ref|XP_009615934.1|  PREDICTED: uncharacterized protein LOC104108...    181   1e-51   Nicotiana tomentosiformis
ref|XP_009615933.1|  PREDICTED: uncharacterized protein LOC104108...    181   2e-51   Nicotiana tomentosiformis
emb|CDP05826.1|  unnamed protein product                                159   3e-43   Coffea canephora [robusta coffee]
ref|XP_006360111.1|  PREDICTED: uncharacterized protein LOC102579806    151   5e-40   
gb|AFX67022.1|  hypothetical protein                                    150   6e-40   Solanum tuberosum [potatoes]
ref|XP_004244170.1|  PREDICTED: uncharacterized protein LOC101263...    149   3e-39   Solanum lycopersicum
ref|XP_010324338.1|  PREDICTED: uncharacterized protein LOC101263...    149   3e-39   Solanum lycopersicum
ref|XP_011097947.1|  PREDICTED: uncharacterized protein LOC105176...    148   6e-39   Sesamum indicum [beniseed]
ref|XP_011097948.1|  PREDICTED: uncharacterized protein LOC105176...    146   2e-38   Sesamum indicum [beniseed]
emb|CBI20469.3|  unnamed protein product                                132   2e-33   Vitis vinifera
ref|XP_010267849.1|  PREDICTED: uncharacterized protein LOC104604963    133   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011048249.1|  PREDICTED: uncharacterized protein LOC105142...    133   3e-33   Populus euphratica
ref|XP_011048250.1|  PREDICTED: uncharacterized protein LOC105142...    132   5e-33   Populus euphratica
ref|XP_002283181.1|  PREDICTED: uncharacterized protein LOC100265933    132   7e-33   Vitis vinifera
ref|XP_010694294.1|  PREDICTED: uncharacterized protein LOC104907109    124   3e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002530912.1|  conserved hypothetical protein                     122   3e-30   
ref|XP_010092273.1|  hypothetical protein L484_021134                   124   4e-30   
gb|EYU33580.1|  hypothetical protein MIMGU_mgv1a010110mg                123   9e-30   Erythranthe guttata [common monkey flower]
gb|KDP39009.1|  hypothetical protein JCGZ_00766                         123   1e-29   Jatropha curcas
gb|KHG00183.1|  hypothetical protein F383_20411                         123   1e-29   Gossypium arboreum [tree cotton]
ref|XP_002316956.1|  hypothetical protein POPTR_0011s13360g             123   2e-29   Populus trichocarpa [western balsam poplar]
gb|KHG12371.1|  HEAT repeat-containing 8                                120   2e-28   Gossypium arboreum [tree cotton]
ref|XP_006452122.1|  hypothetical protein CICLE_v10008955mg             117   4e-28   
gb|ABK93511.1|  unknown                                                 119   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006370583.1|  hypothetical protein POPTR_0001s44020g             119   5e-28   
ref|XP_011095782.1|  PREDICTED: uncharacterized protein LOC105175132    115   6e-28   Sesamum indicum [beniseed]
ref|XP_011030912.1|  PREDICTED: uncharacterized protein LOC105130...    117   2e-27   Populus euphratica
ref|XP_011030911.1|  PREDICTED: uncharacterized protein LOC105130...    117   2e-27   Populus euphratica
ref|XP_006452123.1|  hypothetical protein CICLE_v10008955mg             115   5e-27   Citrus clementina [clementine]
ref|XP_004151972.1|  PREDICTED: uncharacterized protein LOC101218...    115   7e-27   Cucumis sativus [cucumbers]
gb|KJB45630.1|  hypothetical protein B456_007G317200                    115   7e-27   Gossypium raimondii
ref|XP_010910123.1|  PREDICTED: uncharacterized protein LOC105036081    115   1e-26   Elaeis guineensis
ref|XP_008789186.1|  PREDICTED: uncharacterized protein LOC103706755    114   1e-26   Phoenix dactylifera
gb|KJB81865.1|  hypothetical protein B456_013G165300                    114   2e-26   Gossypium raimondii
ref|XP_004294319.1|  PREDICTED: uncharacterized protein LOC101314638    114   3e-26   Fragaria vesca subsp. vesca
ref|XP_010448280.1|  PREDICTED: uncharacterized protein LOC104730767    113   3e-26   Camelina sativa [gold-of-pleasure]
ref|NP_200265.1|  uncharacterized protein                               112   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062936.1|  PREDICTED: uncharacterized protein LOC104450...    112   8e-26   Eucalyptus grandis [rose gum]
ref|XP_008226793.1|  PREDICTED: uncharacterized protein LOC103326356    111   2e-25   Prunus mume [ume]
ref|XP_010443028.1|  PREDICTED: uncharacterized protein LOC104725975    111   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010062934.1|  PREDICTED: uncharacterized protein LOC104450...    111   3e-25   Eucalyptus grandis [rose gum]
ref|XP_008454597.1|  PREDICTED: uncharacterized protein LOC103494...    110   4e-25   Cucumis melo [Oriental melon]
ref|XP_008813171.1|  PREDICTED: uncharacterized protein LOC103723874    110   7e-25   
ref|XP_010482859.1|  PREDICTED: uncharacterized protein LOC104761470    109   9e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002864339.1|  hypothetical protein ARALYDRAFT_495534             109   9e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_008359297.1|  PREDICTED: uncharacterized protein LOC103423006    109   1e-24   
ref|XP_006280901.1|  hypothetical protein CARUB_v10026894mg             108   2e-24   Capsella rubella
ref|XP_007211764.1|  hypothetical protein PRUPE_ppa009590mg             108   3e-24   
gb|KJB45631.1|  hypothetical protein B456_007G317200                    108   3e-24   Gossypium raimondii
gb|KFK27065.1|  hypothetical protein AALP_AA8G329900                    107   5e-24   Arabis alpina [alpine rockcress]
gb|AFK40544.1|  unknown                                                 107   8e-24   Lotus japonicus
gb|AFK40032.1|  unknown                                                 107   9e-24   Lotus japonicus
ref|XP_003539571.1|  PREDICTED: uncharacterized protein LOC100795...    104   5e-23   Glycine max [soybeans]
ref|XP_009355556.1|  PREDICTED: uncharacterized protein LOC103946557    104   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_008454598.1|  PREDICTED: uncharacterized protein LOC103494...    101   5e-22   Cucumis melo [Oriental melon]
ref|XP_004151973.1|  PREDICTED: uncharacterized protein LOC101218...    101   6e-22   
gb|AFK42977.1|  unknown                                                 100   7e-22   Medicago truncatula
ref|XP_008365896.1|  PREDICTED: uncharacterized protein LOC103429531    101   7e-22   
gb|KEH30768.1|  transmembrane protein, putative                         101   1e-21   Medicago truncatula
ref|XP_009385062.1|  PREDICTED: uncharacterized protein LOC103972444  99.8    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45632.1|  hypothetical protein B456_007G317300                  98.2    1e-20   Gossypium raimondii
ref|XP_006401561.1|  hypothetical protein EUTSA_v10014255mg           97.8    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006594801.1|  PREDICTED: uncharacterized protein LOC100779229  95.9    6e-20   Glycine max [soybeans]
gb|KHN27993.1|  hypothetical protein glysoja_007725                   95.5    8e-20   Glycine soja [wild soybean]
ref|XP_009127082.1|  PREDICTED: uncharacterized protein LOC103851954  94.4    2e-19   Brassica rapa
emb|CDY42460.1|  BnaA10g08360D                                        94.0    3e-19   Brassica napus [oilseed rape]
ref|XP_009119980.1|  PREDICTED: uncharacterized protein LOC103844909  94.0    3e-19   Brassica rapa
ref|XP_010520882.1|  PREDICTED: uncharacterized protein LOC104799894  94.0    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_007021147.1|  Uncharacterized protein TCM_031178               94.0    4e-19   
emb|CDY68666.1|  BnaAnng27970D                                        92.0    6e-19   Brassica napus [oilseed rape]
emb|CDY63696.1|  BnaCnng42470D                                        92.4    1e-18   Brassica napus [oilseed rape]
gb|AGV54826.1|  hypothetical protein                                  91.3    2e-18   Phaseolus vulgaris [French bean]
ref|XP_011048251.1|  PREDICTED: uncharacterized protein LOC105142...  90.9    3e-18   Populus euphratica
ref|XP_007133044.1|  hypothetical protein PHAVU_011G146700g           90.9    3e-18   Phaseolus vulgaris [French bean]
ref|XP_006592890.1|  PREDICTED: uncharacterized protein LOC100795...  90.5    4e-18   
emb|CDY64929.1|  BnaCnng45510D                                        90.1    5e-18   Brassica napus [oilseed rape]
ref|XP_003527303.2|  PREDICTED: uncharacterized protein LOC100782462  90.1    8e-18   Glycine max [soybeans]
ref|XP_009402588.1|  PREDICTED: uncharacterized protein LOC103986...  89.0    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928579.1|  PREDICTED: uncharacterized protein LOC105050...  89.0    1e-17   Elaeis guineensis
ref|XP_009393345.1|  PREDICTED: uncharacterized protein LOC103979052  88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402591.1|  PREDICTED: uncharacterized protein LOC103986...  87.8    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928571.1|  PREDICTED: uncharacterized protein LOC105050...  87.4    6e-17   
ref|XP_006659890.1|  PREDICTED: uncharacterized protein LOC102713016  82.4    2e-15   
ref|XP_003573409.1|  PREDICTED: uncharacterized protein LOC100845511  82.4    3e-15   Brachypodium distachyon [annual false brome]
gb|KDO74400.1|  hypothetical protein CISIN_1g021190mg                 80.5    6e-15   Citrus sinensis [apfelsine]
gb|KHN38595.1|  hypothetical protein glysoja_040149                   80.5    7e-15   Glycine soja [wild soybean]
ref|XP_002443952.1|  hypothetical protein SORBIDRAFT_07g004990        81.3    8e-15   Sorghum bicolor [broomcorn]
ref|XP_006452121.1|  hypothetical protein CICLE_v10008955mg           77.0    7e-14   
ref|XP_006851190.1|  hypothetical protein AMTR_s00043p00195000        76.6    3e-13   Amborella trichopoda
gb|EAZ05807.1|  hypothetical protein OsI_28043                        74.7    8e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001061135.1|  Os08g0179900                                     73.6    4e-12   
gb|EPS66227.1|  hypothetical protein M569_08551                       70.5    4e-11   Genlisea aurea
ref|XP_008452336.1|  PREDICTED: uncharacterized protein LOC103493396  70.1    9e-11   Cucumis melo [Oriental melon]
ref|XP_004972711.1|  PREDICTED: uncharacterized protein LOC101763830  68.2    3e-10   Setaria italica
dbj|BAJ88294.1|  predicted protein                                    68.2    3e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004149934.1|  PREDICTED: uncharacterized protein LOC101211780  68.2    4e-10   Cucumis sativus [cucumbers]
ref|XP_008678238.1|  PREDICTED: uncharacterized protein LOC103653035  68.2    4e-10   
ref|NP_001144178.1|  uncharacterized protein LOC100277035             67.4    6e-10   Zea mays [maize]
gb|KDP39008.1|  hypothetical protein JCGZ_00765                       64.7    7e-10   Jatropha curcas
gb|AFW56882.1|  hypothetical protein ZEAMMB73_730622                  67.0    8e-10   
gb|AFW56883.1|  hypothetical protein ZEAMMB73_730622                  67.0    1e-09   
gb|KCW70086.1|  hypothetical protein EUGRSUZ_F03390                   65.1    1e-09   Eucalyptus grandis [rose gum]
ref|XP_004166181.1|  PREDICTED: uncharacterized LOC101211780          66.6    1e-09   
gb|ABK21444.1|  unknown                                               65.1    5e-09   Picea sitchensis
gb|EEE58521.1|  hypothetical protein OsJ_09808                        63.9    7e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00216.1|  predicted protein                                    63.9    9e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABF94497.1|  expressed protein                                     62.0    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KHN36752.1|  hypothetical protein glysoja_001483                   61.2    5e-08   Glycine soja [wild soybean]
ref|XP_010229018.1|  PREDICTED: uncharacterized protein LOC100829035  60.5    1e-07   Brachypodium distachyon [annual false brome]
tpg|DAA43934.1|  TPA: hypothetical protein ZEAMMB73_179991            58.5    6e-07   
ref|XP_002966997.1|  hypothetical protein SELMODRAFT_439861           58.9    6e-07   Selaginella moellendorffii
ref|XP_002961012.1|  hypothetical protein SELMODRAFT_437468           58.5    7e-07   Selaginella moellendorffii
ref|XP_004985312.1|  PREDICTED: uncharacterized protein LOC101783230  57.4    2e-06   Setaria italica
gb|EMT06766.1|  hypothetical protein F775_27558                       55.5    6e-06   
gb|ACF82614.1|  unknown                                               53.9    7e-06   Zea mays [maize]
ref|XP_004987122.1|  PREDICTED: uncharacterized protein LOC101758268  54.3    1e-05   
gb|ABR26041.1|  unknown                                               52.8    2e-05   Oryza sativa Indica Group [Indian rice]
gb|EAY88928.1|  hypothetical protein OsI_10413                        53.5    4e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001049294.1|  Os03g0201000                                     53.5    4e-05   
gb|EEE68150.1|  hypothetical protein OsJ_26259                        50.8    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149673.1|  hypothetical protein PHAVU_005G0894000g          47.4    6e-04   Phaseolus vulgaris [French bean]
gb|EMT30710.1|  hypothetical protein F775_11491                       49.7    6e-04   



>ref|XP_009769969.1| PREDICTED: uncharacterized protein LOC104220737 isoform X2 [Nicotiana 
sylvestris]
Length=325

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 141/202 (70%), Gaps = 7/202 (3%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D +PVQ 
Sbjct  16   VTVANSGFRSVTAEHPVFTAARNVVRPVSVSAITSSSEDVKSGVVHGGSI---DVSPVQ-  71

Query  248  PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
               E D WE AGG+E+ MV +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  72   KMSEFDDWEMAGGEEDMMVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSPPA  130

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  607
            S  GS    + +       +   SE  +   APKHAI+AF+FL E  AAQ+VVASIA DP
Sbjct  131  SYGGSCISGSSLL--PFSKACVVSETVVTPSAPKHAIQAFRFLSETPAAQSVVASIACDP  188

Query  608  NVWNAVLANPELQEFLVSQKTS  673
            NVW AVL NP LQEFLVSQKTS
Sbjct  189  NVWTAVLQNPALQEFLVSQKTS  210



>ref|XP_009769968.1| PREDICTED: uncharacterized protein LOC104220737 isoform X1 [Nicotiana 
sylvestris]
Length=328

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 141/202 (70%), Gaps = 7/202 (3%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D +PVQ 
Sbjct  16   VTVANSGFRSVTAEHPVFTAARNVVRPVSVSAITSSSEDVKSGVVHGGSI---DVSPVQ-  71

Query  248  PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
               E D WE AGG+E+ MV +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  72   KMSEFDDWEMAGGEEDMMVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSPPA  130

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  607
            S  GS    + +       +   SE  +   APKHAI+AF+FL E  AAQ+VVASIA DP
Sbjct  131  SYGGSCISGSSLL--PFSKACVVSETVVTPSAPKHAIQAFRFLSETPAAQSVVASIACDP  188

Query  608  NVWNAVLANPELQEFLVSQKTS  673
            NVW AVL NP LQEFLVSQKTS
Sbjct  189  NVWTAVLQNPALQEFLVSQKTS  210



>ref|XP_009615934.1| PREDICTED: uncharacterized protein LOC104108568 isoform X2 [Nicotiana 
tomentosiformis]
Length=327

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 143/204 (70%), Gaps = 9/204 (4%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D + VQ 
Sbjct  16   VTVANSGFRSVTAEHPVYTAARNVVRPVSVSAITSSSEDVKSGVVHGGSV---DVSSVQK  72

Query  248  PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
               E D WE AGG+E+ +V +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  73   ILSEFDDWEMAGGEEDMIVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSQPA  131

Query  428  SDCGST--NGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
            SD G +  +G++ +       +   S+  +   APKHAI+AF+FL E  AAQ+VVASIA 
Sbjct  132  SDYGGSCISGSSLL---PFSKACVVSKTVVTPSAPKHAIQAFRFLSETPAAQSVVASIAC  188

Query  602  DPNVWNAVLANPELQEFLVSQKTS  673
            DPNVW AVL NP LQEFL SQKTS
Sbjct  189  DPNVWTAVLQNPALQEFLESQKTS  212



>ref|XP_009615933.1| PREDICTED: uncharacterized protein LOC104108568 isoform X1 [Nicotiana 
tomentosiformis]
Length=330

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 143/204 (70%), Gaps = 9/204 (4%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            +TVANSGFR + +EHPV +AAR VVRPVSVS I+SSS+ +KS  V        D + VQ 
Sbjct  16   VTVANSGFRSVTAEHPVYTAARNVVRPVSVSAITSSSEDVKSGVVHGGSV---DVSSVQK  72

Query  248  PCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
               E D WE AGG+E+ +V +GEPLPR++FGGAPSLQEA EAT DLKDAL KVY +S P 
Sbjct  73   ILSEFDDWEMAGGEEDMIVKSGEPLPRVVFGGAPSLQEATEATSDLKDALEKVY-LSQPA  131

Query  428  SDCGST--NGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
            SD G +  +G++ +       +   S+  +   APKHAI+AF+FL E  AAQ+VVASIA 
Sbjct  132  SDYGGSCISGSSLL---PFSKACVVSKTVVTPSAPKHAIQAFRFLSETPAAQSVVASIAC  188

Query  602  DPNVWNAVLANPELQEFLVSQKTS  673
            DPNVW AVL NP LQEFL SQKTS
Sbjct  189  DPNVWTAVLQNPALQEFLESQKTS  212



>emb|CDP05826.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 130/198 (66%), Gaps = 9/198 (5%)
 Frame = +2

Query  74   VANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPC  253
            V N G RGI  +HP S+A RKV+RPV+     S+ +++K +AV+       D +PVQ PC
Sbjct  18   VLNGGLRGIVPDHPASTAMRKVLRPVTGLASPSAPENVKEAAVAI------DVSPVQKPC  71

Query  254  RELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  433
             E D WE AGG+E+    +G   PRL+FGGAPS+ EAKEAT++LK+AL KVY +S P + 
Sbjct  72   WEFDDWELAGGEEDLFGGSGVSTPRLVFGGAPSIAEAKEATYELKEALEKVY-LSAPSTP  130

Query  434  CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNV  613
                +G ++  ++        +   I   APKHAI+AF FL E+ A Q+VVASIASDPNV
Sbjct  131  KTGLSGLSR--SEVPETKACVTSETILAPAPKHAIQAFTFLNESPAVQSVVASIASDPNV  188

Query  614  WNAVLANPELQEFLVSQK  667
            WNAVL NP LQ+++ SQK
Sbjct  189  WNAVLLNPTLQDYIQSQK  206



>ref|XP_006360111.1| PREDICTED: uncharacterized protein LOC102579806 [Solanum tuberosum]
Length=328

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = +2

Query  80   NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  259
            NSGFR + +EHPV +AAR V RPVS+SGISS+S+ +KS+ V+AS   + D + V     +
Sbjct  20   NSGFRSVTAEHPVYAAARNVARPVSISGISSTSEDVKSAMVTASHGGSSDVSYVPKMVSD  79

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  439
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY         G
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYL-------SG  130

Query  440  STNGAAQVNNDHsppsnsssenAIAH-----GAPKHAIRAFKFLYENAAAQTVVASIASD  604
            S NG        S  S  S    ++        PKHA++A++ L E  AAQ VVASIA D
Sbjct  131  SANGYGGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACD  190

Query  605  PNVWNAVLANPELQEFLVSQKTS  673
            PNVWNAVL NP LQ+FL SQ++S
Sbjct  191  PNVWNAVLQNPALQDFLESQRSS  213



>gb|AFX67022.1| hypothetical protein [Solanum tuberosum]
Length=324

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = +2

Query  80   NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  259
            NSGFR +  EHPV +AAR V RPVS+SGISS+S+ +KS+ V+AS   + D + V     +
Sbjct  20   NSGFRSVTVEHPVYAAARNVPRPVSISGISSTSEDVKSAMVTASHGGSSDVSYVPKMVSD  79

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  439
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY MS      G
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VY-MS------G  130

Query  440  STNGAAQVNNDHsppsnsssenAIAH-----GAPKHAIRAFKFLYENAAAQTVVASIASD  604
            S NG        S  S  S    ++        PKHA++A++ L E  AAQ VVASIA D
Sbjct  131  SANGYGGSCISGSCSSPVSKACVVSETIVTKSVPKHAVQAYRILSEIPAAQNVVASIACD  190

Query  605  PNVWNAVLANPELQEFLVSQKTS  673
            PNVWNAVL NP LQ+FL SQ+ S
Sbjct  191  PNVWNAVLQNPALQDFLESQRYS  213



>ref|XP_004244170.1| PREDICTED: uncharacterized protein LOC101263228 isoform X2 [Solanum 
lycopersicum]
Length=332

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = +2

Query  80   NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  259
            NSGFR + +EHP+ +AAR V RPVS+SG+SS+S+ +KS  V+AS   ++D + V     +
Sbjct  20   NSGFRSVTAEHPLYAAARNVARPVSISGLSSTSEDVKSGMVTASHGGSLDVSHVPKMVSD  79

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  439
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY         G
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYL-------SG  130

Query  440  STNGAAQVNNDHsppsnsssenAIAH-----GAPKHAIRAFKFLYENAAAQTVVASIASD  604
            S NG        S  S  S    ++        PKHA++A++ L E  AAQ VVASIA D
Sbjct  131  SANGNGGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACD  190

Query  605  PNVWNAVLANPELQEFLVSQKTS  673
            PNVWNAVL NP LQ+FL SQ++S
Sbjct  191  PNVWNAVLQNPALQDFLESQRSS  213



>ref|XP_010324338.1| PREDICTED: uncharacterized protein LOC101263228 isoform X1 [Solanum 
lycopersicum]
Length=334

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 132/203 (65%), Gaps = 14/203 (7%)
 Frame = +2

Query  80   NSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQWPCRE  259
            NSGFR + +EHP+ +AAR V RPVS+SG+SS+S+ +KS  V+AS   ++D + V     +
Sbjct  20   NSGFRSVTAEHPLYAAARNVARPVSISGLSSTSEDVKSGMVTASHGGSLDVSHVPKMVSD  79

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG  439
             D WE AGG+EE MV  GEPLPRL+FGGAPSLQEA EAT DLKDAL  VY         G
Sbjct  80   FDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSDLKDAL--VYL-------SG  130

Query  440  STNGAAQVNNDHsppsnsssenAIAH-----GAPKHAIRAFKFLYENAAAQTVVASIASD  604
            S NG        S  S  S    ++        PKHA++A++ L E  AAQ VVASIA D
Sbjct  131  SANGNGGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSEIPAAQNVVASIACD  190

Query  605  PNVWNAVLANPELQEFLVSQKTS  673
            PNVWNAVL NP LQ+FL SQ++S
Sbjct  191  PNVWNAVLQNPALQDFLESQRSS  213



>ref|XP_011097947.1| PREDICTED: uncharacterized protein LOC105176746 isoform X1 [Sesamum 
indicum]
Length=317

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 124/211 (59%), Gaps = 20/211 (9%)
 Frame = +2

Query  68   ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  244
            IT A+ G RGIA+EH  VSSAAR+       +        + S             A VQ
Sbjct  15   ITAASGGLRGIAAEHYSVSSAARRAASIRPPAATVEDVKLVTSQVE----------AGVQ  64

Query  245  WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  424
             PC E+D W FAGG+EE +V   +P+PR++FGG P+LQEA+EAT +L  AL K Y +S+P
Sbjct  65   RPCLEMDDWVFAGGEEEAVVGVADPMPRVVFGGVPTLQEAREATSELTAALDKTY-LSSP  123

Query  425  PS-DC-----GSTNGAAQVNNDHsppsnsssenAI--AHGAPKHAIRAFKFLYENAAAQT  580
             S  C     G    ++ +++  +  + +     I  A   P  AI AF+FL E++AAQ 
Sbjct  124  NSVGCEGSFVGDHGSSSPLSDKQAAETKACVTTGIAVAPAVPAPAIMAFRFLSESSAAQN  183

Query  581  VVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            VVASIA DPNVWNAVL N ELQEFL SQKTS
Sbjct  184  VVASIACDPNVWNAVLQNQELQEFLQSQKTS  214



>ref|XP_011097948.1| PREDICTED: uncharacterized protein LOC105176746 isoform X2 [Sesamum 
indicum]
Length=304

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 123/210 (59%), Gaps = 20/210 (10%)
 Frame = +2

Query  68   ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  244
            IT A+ G RGIA+EH  VSSAAR+       +        + S             A VQ
Sbjct  15   ITAASGGLRGIAAEHYSVSSAARRAASIRPPAATVEDVKLVTSQVE----------AGVQ  64

Query  245  WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  424
             PC E+D W FAGG+EE +V   +P+PR++FGG P+LQEA+EAT +L  AL K Y +S+P
Sbjct  65   RPCLEMDDWVFAGGEEEAVVGVADPMPRVVFGGVPTLQEAREATSELTAALDKTY-LSSP  123

Query  425  PS-DC-----GSTNGAAQVNNDHsppsnsssenAI--AHGAPKHAIRAFKFLYENAAAQT  580
             S  C     G    ++ +++  +  + +     I  A   P  AI AF+FL E++AAQ 
Sbjct  124  NSVGCEGSFVGDHGSSSPLSDKQAAETKACVTTGIAVAPAVPAPAIMAFRFLSESSAAQN  183

Query  581  VVASIASDPNVWNAVLANPELQEFLVSQKT  670
            VVASIA DPNVWNAVL N ELQEFL SQKT
Sbjct  184  VVASIACDPNVWNAVLQNQELQEFLQSQKT  213



>emb|CBI20469.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 116/208 (56%), Gaps = 21/208 (10%)
 Frame = +2

Query  68   ITVANSGFRGIAS----EHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGA  235
            + V N+G RG  +    E P+++AARK   PVS    S+       S             
Sbjct  61   VGVVNAGLRGAPAVQPVEQPMAAAARKATVPVSSVISSAKLGDAPVS-------------  107

Query  236  PVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  415
             VQ P  ELD WEFA  +EE  +  GEPLPR++FGG P+LQEAKEAT +LKDAL ++Y  
Sbjct  108  -VQRPSWELDDWEFASVEEEINIGTGEPLPRVVFGGVPTLQEAKEATSELKDALDQLYLS  166

Query  416  STPPSDCGSTN-GAAQV-NNDHsppsnsssenA-IAHGAPKHAIRAFKFLYENAAAQTVV  586
             +     G    G  Q+ N+DH       +         P HAI+AF +L ++ AAQ VV
Sbjct  167  PSRSIRSGVQQLGLLQIANSDHLETKACVATTENTVATVPAHAIQAFAYLKDSPAAQNVV  226

Query  587  ASIASDPNVWNAVLANPELQEFLVSQKT  670
            ASIASDPNVW+AV+ N  L EFL +QKT
Sbjct  227  ASIASDPNVWSAVMQNEALVEFLQAQKT  254



>ref|XP_010267849.1| PREDICTED: uncharacterized protein LOC104604963 [Nelumbo nucifera]
Length=339

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 98/150 (65%), Gaps = 5/150 (3%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            VQ P  E+D WEFAG DEE ++ +  P+PR++FGG P+L+EAKEAT DLKDAL KVY  S
Sbjct  79   VQRPSWEIDDWEFAGDDEELLLDSMNPMPRIVFGGVPTLEEAKEATSDLKDALEKVYFSS  138

Query  419  TPPSDCGSTNGAAQVNNDHs----ppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTV  583
            +  S C       Q +  +S         +SE  ++   AP HA++AFK L E+A AQ+V
Sbjct  139  SNASGCIDPVAVVQESTKNSEFPETKVCVTSETTVSRPSAPIHALQAFKLLKESAEAQSV  198

Query  584  VASIASDPNVWNAVLANPELQEFLVSQKTS  673
            VAS+ SD NVW+AV+ N E+ EFL SQ TS
Sbjct  199  VASLVSDKNVWDAVMKNEEVVEFLQSQHTS  228



>ref|XP_011048249.1| PREDICTED: uncharacterized protein LOC105142358 isoform X1 [Populus 
euphratica]
Length=326

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 10/156 (6%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60   ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120  Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
               QTVVA++ASDPNVWNAV  N  LQ+FL SQ T+
Sbjct  179  PKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNTT  214



>ref|XP_011048250.1| PREDICTED: uncharacterized protein LOC105142358 isoform X2 [Populus 
euphratica]
Length=325

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 100/155 (65%), Gaps = 10/155 (6%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60   ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120  Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
               QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  179  PKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213



>ref|XP_002283181.1| PREDICTED: uncharacterized protein LOC100265933 [Vitis vinifera]
Length=339

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 117/210 (56%), Gaps = 25/210 (12%)
 Frame = +2

Query  68   ITVANSGFRGIAS----EHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGA  235
            + V N+G RG  +    E P+++AARK   PVS    S+                    A
Sbjct  15   VGVVNAGLRGAPAVQPVEQPMAAAARKATVPVSSVISSAKLGD----------------A  58

Query  236  PV--QWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            PV  Q P  ELD WEFA  +EE  +  GEPLPR++FGG P+LQEAKEAT +LKDAL ++Y
Sbjct  59   PVSVQRPSWELDDWEFASVEEEINIGTGEPLPRVVFGGVPTLQEAKEATSELKDALDQLY  118

Query  410  NMSTPPSDCGSTN-GAAQV-NNDHsppsnsssenA-IAHGAPKHAIRAFKFLYENAAAQT  580
               +     G    G  Q+ N+DH       +         P HAI+AF +L ++ AAQ 
Sbjct  119  LSPSRSIRSGVQQLGLLQIANSDHLETKACVATTENTVATVPAHAIQAFAYLKDSPAAQN  178

Query  581  VVASIASDPNVWNAVLANPELQEFLVSQKT  670
            VVASIASDPNVW+AV+ N  L EFL +QKT
Sbjct  179  VVASIASDPNVWSAVMQNEALVEFLQAQKT  208



>ref|XP_010694294.1| PREDICTED: uncharacterized protein LOC104907109 [Beta vulgaris 
subsp. vulgaris]
Length=295

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 96/148 (65%), Gaps = 14/148 (9%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPL-PRLIFGGAPSLQEAKEATFDLKDALHKVYNM  415
            VQ P  E+D WEFAGG+++ +V     + PRL+FG  P+ +E KEAT +LKDAL KVY +
Sbjct  60   VQRPAWEIDDWEFAGGEDDFVVDRINSVKPRLVFGPVPTFEETKEATSELKDALDKVY-L  118

Query  416  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVA  589
            S+P S  GS    + ++          ++  I H +P  K A++AFK L EN AAQTVVA
Sbjct  119  SSPKS-SGSVESFSALHE---------TKACITHESPVPKSAMQAFKLLKENPAAQTVVA  168

Query  590  SIASDPNVWNAVLANPELQEFLVSQKTS  673
            SIA DPNVWNAV+ NP L EFL S+K S
Sbjct  169  SIACDPNVWNAVMQNPTLMEFLDSEKKS  196



>ref|XP_002530912.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31461.1| conserved hypothetical protein [Ricinus communis]
Length=198

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 18/146 (12%)
 Frame = +2

Query  242  QWPCREL-DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            Q P  E+ D WE AG +E E +   EPLPRL+FGG PSL+EAK AT ++KDAL KVY +S
Sbjct  65   QGPAFEVSDDWEIAGFEESEELQLIEPLPRLVFGGPPSLEEAKAATSEVKDALEKVY-LS  123

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  598
            +P  +  S      + +D           A A  AP HAI+AF  L  +  AQT+VASIA
Sbjct  124  SPGLETTSC-----IISD-----------ARASSAPTHAIKAFTLLNRSPQAQTIVASIA  167

Query  599  SDPNVWNAVLANPELQEFLVSQKTSM  676
            +DPNVW+AVL N  LQE+L+SQ T +
Sbjct  168  TDPNVWDAVLKNGALQEYLLSQNTKL  193



>ref|XP_010092273.1| hypothetical protein L484_021134 [Morus notabilis]
 gb|EXB50907.1| hypothetical protein L484_021134 [Morus notabilis]
Length=325

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            D  P+Q P  E+DGWE     ++ ++  GEPLPR++F GAPS  EAKEAT +LKDAL KV
Sbjct  65   DVPPIQMPAWEMDGWE-----DDLVMTDGEPLPRVVFAGAPSFDEAKEATIELKDALDKV  119

Query  407  YNMSTPPSDCGSTNGAAQVN-----NDHsppsnsssenAIAHG--APKHAIRAFKFLYEN  565
            Y      S+ G    A Q++     +D +  + +        G   P HA++AFKFL  +
Sbjct  120  YLSPHESSESGEVVAANQLSGLSLCSDPNSETKTCLIVDTGRGRPVPNHALKAFKFLSRS  179

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            + AQTVVAS+A+D NVWNAV+ NP LQ+F+ + K S
Sbjct  180  SEAQTVVASLATDLNVWNAVMQNPVLQDFMQANKNS  215



>gb|EYU33580.1| hypothetical protein MIMGU_mgv1a010110mg [Erythranthe guttata]
Length=322

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 95/154 (62%), Gaps = 6/154 (4%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMVAAG-EPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            G  +Q PC E+D W FAG +EE+M AA  +P+PRL+F G P++QEAKEAT +L  AL K 
Sbjct  60   GVGMQRPCSEMDDWVFAGVEEEQMAAAAADPIPRLVFAGVPTIQEAKEATSELSVALEKA  119

Query  407  YNMSTPPSDCG---STNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
            Y   +PPS  G   S  G    +   S      +  ++++  P  AI AF+ L+E+  A+
Sbjct  120  Y--LSPPSSIGYEGSIIGDGDSSLSVSDKQIIENSGSVSNAVPATAIMAFRLLHESPMAK  177

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
             VVASIA DPNVWNAV  N ELQ FL SQ  S++
Sbjct  178  NVVASIACDPNVWNAVRQNQELQGFLQSQGASLV  211



>gb|KDP39009.1| hypothetical protein JCGZ_00766 [Jatropha curcas]
Length=316

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            VQ P  EL+ WE AGG+EE ++ + EP+PR++FG  PSL EAK AT DLKDAL KVY +S
Sbjct  65   VQKPAWELEDWELAGGEEELLIESSEPMPRVVFGAPPSLNEAKAATADLKDALEKVY-LS  123

Query  419  TPP-------SDCGSTNGAAQV-NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  574
            +P              +G + V N+D        +++  A+ APK A+ AFK L E+  A
Sbjct  124  SPAHSGAGGSFGSSRLSGLSLVTNSDDLDTKRCIADDLRANSAPKCAVTAFKLLNESPEA  183

Query  575  QTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
            QTVVASIASDPNVW+AV  N  LQEFL SQKT
Sbjct  184  QTVVASIASDPNVWDAVWKNVALQEFLQSQKT  215



>gb|KHG00183.1| hypothetical protein F383_20411 [Gossypium arboreum]
Length=316

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAA----GEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
            +D WEFAGG EEE+  A    GEP+PR++FGGAP+L+EAKEA  DLKDAL K Y  S   
Sbjct  76   VDDWEFAGGIEEEVPTAISGGGEPMPRVLFGGAPTLEEAKEAASDLKDALDKAYLSSLNS  135

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  607
            +D   ++ A+ ++ +     +  + +A A   PK A++AFK L E+ A Q++VASIA+DP
Sbjct  136  TDDTRSSRASLLSEE---TKDCVAYDAKATLLPKPAVQAFKLLNESPAVQSMVASIAADP  192

Query  608  NVWNAVLANPELQEFLVSQKTSML  679
            NVWNAVL NP   +F+ S KT+ +
Sbjct  193  NVWNAVLHNPAYMDFIGSHKTNYI  216



>ref|XP_002316956.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
 gb|EEE97568.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
Length=326

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 98/154 (64%), Gaps = 9/154 (6%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A +Q P  E+D WE AGG EEEMV  + EP+ R++F G+P SLQEAK AT +LKDAL KV
Sbjct  60   AGMQRPAWEVDEWELAGGVEEEMVVDSAEPVARVVFWGSPPSLQEAKAATCELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQV------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  568
            Y +S+P    GS+ G +Q+      N+D    +   S +      PK+A++AF  L E+ 
Sbjct  120  Y-LSSPNLGTGSSLGGSQLSGHPLTNSDFLETNGCISCDPNRAPVPKYAMQAFSLLNESP  178

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
              QTVVA++ASDPNVWNAV  N  LQE L SQ T
Sbjct  179  KIQTVVAALASDPNVWNAVWENEALQELLQSQNT  212



>gb|KHG12371.1| HEAT repeat-containing 8 [Gossypium arboreum]
Length=317

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 87/146 (60%), Gaps = 9/146 (6%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  415
            +D WEFAG  E+E    G        EP+ R++F G PSL+EAKEAT DLKDAL KVY  
Sbjct  78   VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGVPSLEEAKEATNDLKDALDKVYLS  137

Query  416  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            S   S+     G + ++N        +     A   PK AI+AFK L E+ A Q+VVASI
Sbjct  138  SPKYSETVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPAVQSVVASI  196

Query  596  ASDPNVWNAVLANPELQEFLVSQKTS  673
            ASDPNVWNAVL N    +F+ SQ+TS
Sbjct  197  ASDPNVWNAVLNNSAYMDFIKSQQTS  222



>ref|XP_006452122.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|ESR65362.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74401.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=224

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 95/147 (65%), Gaps = 12/147 (8%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  433
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  434  CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  592
             G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVAS
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVAS  185

Query  593  IASDPNVWNAVLANPELQEFLVSQKTS  673
            IA DP VWNAV+ N  L EF+ SQKTS
Sbjct  186  IACDPAVWNAVVKNDALVEFVQSQKTS  212



>gb|ABK93511.1| unknown [Populus trichocarpa]
Length=325

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHK  403
             A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+L DA  K
Sbjct  59   AATVQRPSWELDEWEFAGGLEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELNDAFQK  118

Query  404  VYNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYE  562
            VY +S+P S  GS+ G +Q++       ++     +    +      PK+A++AF  L E
Sbjct  119  VY-LSSPNSGTGSSVGGSQLSGLPLLRKSESLETKDCIPCDPTGAPVPKYAMQAFSLLNE  177

Query  563  NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
            +   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  178  SPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213



>ref|XP_006370583.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
 gb|ERP67152.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
Length=325

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 10/156 (6%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHK  403
             A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+L DA  K
Sbjct  59   AATVQRPSWELDEWEFAGGLEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELNDAFQK  118

Query  404  VYNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYE  562
            VY +S+P S  GS+ G +Q++       ++     +    +      PK+A++AF  L E
Sbjct  119  VY-LSSPNSGTGSSVGGSQLSGLPLLRKSESLETKDCIPCDPTGAPVPKYAMQAFSLLNE  177

Query  563  NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
            +   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  178  SPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213



>ref|XP_011095782.1| PREDICTED: uncharacterized protein LOC105175132 [Sesamum indicum]
Length=198

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 109/202 (54%), Gaps = 28/202 (14%)
 Frame = +2

Query  68   ITVANSGFRGIASEH-PVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQ  244
            ITVAN GFR I  EH PV SA  K       +  S                     A VQ
Sbjct  11   ITVANGGFRAITLEHCPVFSATVKAASSRPEASQSQ--------------------AGVQ  50

Query  245  WPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  424
                E+D W FAG   E +V+A + +PR++FGG P+LQEAKEAT DL  AL KVY +S+ 
Sbjct  51   MTSSEMDDWVFAGEKAEPVVSAVDQMPRVVFGGRPTLQEAKEATSDLTVALEKVY-LSSI  109

Query  425  PSDCGSTNGAAQV------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  586
             S  GS    A+        +      N +SE A+A   P HA  AF+FLYE++AAQ VV
Sbjct  110  HSSAGSEVSFAKSLYPCLSVSSSQLIENKASERAVAPAVPAHAFMAFQFLYESSAAQDVV  169

Query  587  ASIASDPNVWNAVLANPELQEF  652
            ASIA D NVWNAVL N ELQ F
Sbjct  170  ASIACDQNVWNAVLHNQELQGF  191



>ref|XP_011030912.1| PREDICTED: uncharacterized protein LOC105130206 isoform X2 [Populus 
euphratica]
Length=325

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A +Q P  E+D WE +GG EEEMV  + EP+ R++F  AP SLQEAK AT +LKDAL KV
Sbjct  60   AGMQRPAWEVDEWELSGGVEEEMVVDSAEPVARVVFWDAPPSLQEAKAATCELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHG---APKHAIRAFKFLYENAAAQ  577
            Y +S+P    GS+ G +Q++      S +    +        PK+A++AF  L E+   Q
Sbjct  120  Y-LSSPNLGTGSSLGGSQLSGHSLTNSETKGCISCDPNRAPVPKYAMQAFSLLNESPKIQ  178

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQ  664
            TVVA++ASDPNVWNAV  N  LQE L SQ
Sbjct  179  TVVAALASDPNVWNAVWENEALQELLQSQ  207



>ref|XP_011030911.1| PREDICTED: uncharacterized protein LOC105130206 isoform X1 [Populus 
euphratica]
Length=331

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A +Q P  E+D WE +GG EEEMV  + EP+ R++F  AP SLQEAK AT +LKDAL KV
Sbjct  60   AGMQRPAWEVDEWELSGGVEEEMVVDSAEPVARVVFWDAPPSLQEAKAATCELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHG---APKHAIRAFKFLYENAAAQ  577
            Y +S+P    GS+ G +Q++      S +    +        PK+A++AF  L E+   Q
Sbjct  120  Y-LSSPNLGTGSSLGGSQLSGHSLTNSETKGCISCDPNRAPVPKYAMQAFSLLNESPKIQ  178

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQ  664
            TVVA++ASDPNVWNAV  N  LQE L SQ
Sbjct  179  TVVAALASDPNVWNAVWENEALQELLQSQ  207



>ref|XP_006452123.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 ref|XP_006475259.1| PREDICTED: uncharacterized protein LOC102621279 isoform X1 [Citrus 
sinensis]
 gb|ESR65363.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74399.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=316

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 94/146 (64%), Gaps = 12/146 (8%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  433
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  434  CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  592
             G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVAS
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVAS  185

Query  593  IASDPNVWNAVLANPELQEFLVSQKT  670
            IA DP VWNAV+ N  L EF+ SQKT
Sbjct  186  IACDPAVWNAVVKNDALVEFVQSQKT  211



>ref|XP_004151972.1| PREDICTED: uncharacterized protein LOC101218021 isoform 1 [Cucumis 
sativus]
 gb|KGN57942.1| hypothetical protein Csa_3G402460 [Cucumis sativus]
Length=317

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            V  P  E D WEFA  + +  + +    PR++FG  PS +EAKEAT ++K+AL KVY  S
Sbjct  69   VHKPTWEFDDWEFANFENDMGMDSVGFKPRIVFGAVPSFEEAKEATTEVKEALDKVYLSS  128

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAH--GAPKHAIRAFKFLYENAAAQTVVAS  592
            +P SD   +N    +N      S  S+E ++      P+HAI+AFK L E+A AQTVVAS
Sbjct  129  SPESD--GSNMIVPINRKIESVSCLSNETSLQSQTSVPQHAIQAFKLLKESAEAQTVVAS  186

Query  593  IASDPNVWNAVLANPELQEFLVSQKTSML  679
            IASDPNVWNA+L N  L+ FL S +T+ +
Sbjct  187  IASDPNVWNAMLGNEALKSFLQSYQTNKI  215



>gb|KJB45630.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=317

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  415
            +D WEFAG  E+E    G        EP+ R++F GAPSL+EAKEAT DLKDAL KVY  
Sbjct  78   VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGAPSLEEAKEATNDLKDALDKVYLS  137

Query  416  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            S   S+     G + ++N        +     A   PK AI+AFK L E+ A Q+VVASI
Sbjct  138  SPQYSEMVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPAVQSVVASI  196

Query  596  ASDPNVWNAVLANPELQEFLVSQKT  670
            ASDP+VW+AVL N    +F+ SQ+T
Sbjct  197  ASDPHVWDAVLNNSAYMDFIKSQQT  221



>ref|XP_010910123.1| PREDICTED: uncharacterized protein LOC105036081 [Elaeis guineensis]
Length=318

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            +Q    E+D WEFAGG+EEE++ +  P PR++FG  P+L+EAKEAT DLKDA+ +VY   
Sbjct  74   IQRSSWEIDEWEFAGGEEEELLDSLHPAPRVVFGPVPTLEEAKEATADLKDAVERVYFSP  133

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  598
            +         G     N            A+    PKH ++AF  L  +  AQ VVAS+A
Sbjct  134  STEVSLEGVQGCTSREN-----------VALVQSMPKHVVQAFSLLQGSPEAQDVVASLA  182

Query  599  SDPNVWNAVLANPELQEFLVSQKTSML  679
            +D NVW+AV+ N ++ EF  +Q++ +L
Sbjct  183  ADKNVWDAVMKNEKVMEFYRTQQSVVL  209



>ref|XP_008789186.1| PREDICTED: uncharacterized protein LOC103706755 [Phoenix dactylifera]
Length=316

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            +Q    E+D WEFAGG+EEE+ A+  P PRL+FG  P+L+EAKEAT DLKDA+ + Y   
Sbjct  72   IQQASWEIDDWEFAGGEEEELHASLHPAPRLVFGPVPTLEEAKEATADLKDAVERAYFSP  131

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  598
            +         G A   N            A     PKH ++AF  L+ +  AQ VVAS+A
Sbjct  132  SIEVSLEGVQGCASCEN-----------VAPLQSMPKHVVQAFSLLHGSPEAQNVVASLA  180

Query  599  SDPNVWNAVLANPELQEFLVSQKTSML  679
            +D NVW+AV+ N ++ EF  +Q++ +L
Sbjct  181  ADKNVWDAVMKNEKVMEFYRTQQSVVL  207



>gb|KJB81865.1| hypothetical protein B456_013G165300 [Gossypium raimondii]
Length=316

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAA----GEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP  427
            +D WEFAGG EEE+  A    GEP+PR++FG AP+L++AKEA  DLKDAL K Y  S   
Sbjct  76   VDDWEFAGGVEEEVPTAISGGGEPMPRVLFGVAPTLEQAKEAASDLKDALDKAYLSSLDS  135

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  607
            +D      ++  +       +  + +A A   PK A++AFK L E+ A Q++VASIA+DP
Sbjct  136  TD---DTRSSCSSLLSEETKDCVAYDAKATLLPKPAVQAFKLLNESPAVQSMVASIAADP  192

Query  608  NVWNAVLANPELQEFLVSQKTSML  679
            NVWNAVL NP   +F+ S KT+ +
Sbjct  193  NVWNAVLHNPAYMDFIGSHKTNYI  216



>ref|XP_004294319.1| PREDICTED: uncharacterized protein LOC101314638 [Fragaria vesca 
subsp. vesca]
Length=313

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 89/140 (64%), Gaps = 11/140 (8%)
 Frame = +2

Query  269  WEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP-------P  427
            W+  GG++E +++AGEP+PR++FG APS +EAKEAT +LKDAL K Y +S+P       P
Sbjct  75   WQVVGGEDELVMSAGEPMPRVVFGAAPSFKEAKEATAELKDALDKAY-LSSPKITELEDP  133

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDP  607
            +     +G +  +N  +   +           P+HA +AF+ L  +  AQ VVASIASDP
Sbjct  134  TAADKVSGQSLFSNPGAETESVLVTRT---SVPQHAYKAFELLSRSPEAQNVVASIASDP  190

Query  608  NVWNAVLANPELQEFLVSQK  667
            NVWNA++ N  +++F+ SQK
Sbjct  191  NVWNAMIENSAVKQFMESQK  210



>ref|XP_010448280.1| PREDICTED: uncharacterized protein LOC104730767 [Camelina sativa]
Length=305

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 94/155 (61%), Gaps = 21/155 (14%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  70   DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  119

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsn------sssenAIAHGAPKHAIRAFKFLYENA  568
            Y MS+P S   +  G+    ND    S       SS   A+    P+ A++AF FL EN 
Sbjct  120  Y-MSSPNSSSAAIEGS----NDGGSVSKMLSGFQSSENRAVESAVPQVALKAFAFLSENT  174

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            AAQTVVASIASDP VW+AV+ N +L +FL +  T+
Sbjct  175  AAQTVVASIASDPKVWDAVMENKDLMKFLQTNSTA  209



>ref|NP_200265.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09333.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25598.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AAM19986.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AED96508.1| uncharacterized protein AT5G54540 [Arabidopsis thaliana]
Length=297

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 95/153 (62%), Gaps = 17/153 (11%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  +Q P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  64   DGMIMQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINLV  112

Query  407  YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
            Y MS+P S     GS +G +   +       SS   A+    P+ A++AF FL EN AAQ
Sbjct  113  Y-MSSPKSSAAMEGSNDGGSV--SKMLSGFQSSENRAVESAVPQVALQAFAFLSENTAAQ  169

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
            TVVASIASDP VW+AV+ N +L +FL + KT++
Sbjct  170  TVVASIASDPKVWDAVMENKDLMKFLQTNKTAV  202



>ref|XP_010062936.1| PREDICTED: uncharacterized protein LOC104450186 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70085.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=322

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 93/157 (59%), Gaps = 13/157 (8%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            G   Q    E+D W+F GG EE++V  G+P+ R++FGG PS +EAK AT DLKDA+ KVY
Sbjct  66   GKAAQMAAWEVDDWDF-GGLEEKLV--GQPMGRVVFGGVPSFEEAKAATDDLKDAIDKVY  122

Query  410  NMSTP--------PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
              ST         P+D  S  G   + N     S+   E       PKHA+ AFK L ++
Sbjct  123  LSSTNITGWEGQLPADQAS--GLPVLTNSVETQSSVIGEALATFPVPKHAVEAFKLLTQS  180

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
              AQTVVASIASD +VW+A L N  LQ+FL SQ +S+
Sbjct  181  PEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSSI  217



>ref|XP_008226793.1| PREDICTED: uncharacterized protein LOC103326356 [Prunus mume]
Length=313

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 11/145 (8%)
 Frame = +2

Query  269  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD----  433
            W+  G  +EE+V +AGEP+PR++F  APS +EA+EAT +LKDAL KVY +S+P S     
Sbjct  75   WQVVGAADEELVMSAGEPMPRVVFDAAPSFKEAREATTELKDALDKVY-LSSPKSTEFGK  133

Query  434  ---CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  604
                   +G +Q+ N       S      +   PKHA +AF+ L  +  AQ VVASIASD
Sbjct  134  QSAADKVSGLSQITNPEPEEVESLILTRTS--VPKHAFQAFEMLSRSTEAQNVVASIASD  191

Query  605  PNVWNAVLANPELQEFLVSQKTSML  679
            PN+WNA++ N  +++FL S K   L
Sbjct  192  PNIWNAMMENSAVKQFLESNKNYKL  216



>ref|XP_010443028.1| PREDICTED: uncharacterized protein LOC104725975 [Camelina sativa]
Length=305

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 92/155 (59%), Gaps = 21/155 (14%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  70   DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  119

Query  407  YNMSTPPSDCGSTNGAAQVNND------HsppsnsssenAIAHGAPKHAIRAFKFLYENA  568
            Y MS+P S   +  G+    ND            SS   A+    P+ A++AF FL EN 
Sbjct  120  Y-MSSPNSSSAAIEGS----NDGGSVSKMLSGLQSSENRAVESAVPQAALQAFAFLSENT  174

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  175  AAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTA  209



>ref|XP_010062934.1| PREDICTED: uncharacterized protein LOC104450186 isoform X1 [Eucalyptus 
grandis]
Length=323

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            G   Q    E+D W+F GG EE++V  G+P+ R++FGG PS +EAK AT DLKDA+ KVY
Sbjct  66   GKAAQMAAWEVDDWDF-GGLEEKLV--GQPMGRVVFGGVPSFEEAKAATDDLKDAIDKVY  122

Query  410  NMSTP--------PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
              ST         P+D  S  G   + N     S+   E       PKHA+ AFK L ++
Sbjct  123  LSSTNITGWEGQLPADQAS--GLPVLTNSVETQSSVIGEALATFPVPKHAVEAFKLLTQS  180

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
              AQTVVASIASD +VW+A L N  LQ+FL SQ ++
Sbjct  181  PEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNST  216



>ref|XP_008454597.1| PREDICTED: uncharacterized protein LOC103494971 isoform X1 [Cucumis 
melo]
Length=315

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            V  P  E D WEFA  + +  + +    PR++FG  PS  EAKEAT ++K+AL KVY   
Sbjct  67   VHKPTWEFDDWEFANFENDMGMDSVGLKPRIVFGAVPSFDEAKEATMEVKEALDKVYLSP  126

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIA--HGAPKHAIRAFKFLYENAAAQTVVAS  592
            +P SD   +N    +N      S  S+E ++   +  P+HAI+AFK L E+A AQTVVAS
Sbjct  127  SPESD--GSNLIVPLNRKIESVSCLSNETSLQSQNSVPQHAIQAFKLLKESAEAQTVVAS  184

Query  593  IASDPNVWNAVLANPELQEFLVS  661
            IASDPNVWNA+L N  L+ FL S
Sbjct  185  IASDPNVWNAMLGNEALKSFLQS  207



>ref|XP_008813171.1| PREDICTED: uncharacterized protein LOC103723874 [Phoenix dactylifera]
Length=342

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 92/154 (60%), Gaps = 10/154 (6%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            +Q P  E+D W FAG +EE+++ +  P PRL+FG  P+L+EAK AT +LKDA+ KVY  S
Sbjct  100  IQLPAWEIDDWVFAG-EEEDLLDSLHPAPRLVFGPVPTLEEAKAATAELKDAVEKVYFSS  158

Query  419  TPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
            +  + C ST G    +               + S+N+     P H I+ F  L  N  AQ
Sbjct  159  S--TTCDSTVGGLGASLQSPVCLEGSETKGCTMSKNSTLFSTPNHVIQMFSLLQGNPEAQ  216

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
             VVASIASD NVWNAV+ NP+++EF  +Q++ +L
Sbjct  217  NVVASIASDENVWNAVMNNPKVKEFYKTQQSVVL  250



>ref|XP_010482859.1| PREDICTED: uncharacterized protein LOC104761470 [Camelina sativa]
Length=306

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 94/155 (61%), Gaps = 21/155 (14%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  +Q P    D WEFA   EEE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  71   DGMVMQRPV--WDDWEFA---EEE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  120

Query  407  YNMSTPPSDCGSTNGAAQVNND------HsppsnsssenAIAHGAPKHAIRAFKFLYENA  568
            Y MS+P     S++ A + +ND            SS   A+    P+ A++AF FL EN 
Sbjct  121  Y-MSSP----NSSSAAIERSNDGGSVSKMISGLQSSENRAVESPVPQVALQAFAFLSENT  175

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  176  AAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTA  210



>ref|XP_002864339.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40598.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 92/152 (61%), Gaps = 17/152 (11%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  +Q P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  64   DGMIMQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  112

Query  407  YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
            Y MS+P S     GS +G A   +       SS   A+    P+ A++AF FL EN AAQ
Sbjct  113  Y-MSSPKSSAAMEGSNDGGAV--SKMLSGFQSSENRAVESAVPQVALQAFAFLSENTAAQ  169

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            TVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  170  TVVASIACDPKVWDAVMENKDLMKFLQTNNTA  201



>ref|XP_008359297.1| PREDICTED: uncharacterized protein LOC103423006 [Malus domestica]
Length=312

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 5/141 (4%)
 Frame = +2

Query  257  ELDGWEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  433
            E   W+  G   +++V + GEP+PR++F  APS +EAKEAT +LKDAL KVY  S   +D
Sbjct  73   EFVDWQVVGAGXDDLVMSGGEPMPRVVFDAAPSFKEAKEATAELKDALDKVYLSSPKSTD  132

Query  434  CGSTNGAAQVNN----DHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
             G  + A  V       +  P    S        PKHA+RAF+ L +++ AQ VVASIAS
Sbjct  133  FGEQSAADNVAGLSLITNPEPEEMESLLLTRTSVPKHALRAFEMLSQSSEAQNVVASIAS  192

Query  602  DPNVWNAVLANPELQEFLVSQ  664
            DPN+WNA++ N E+++F+ ++
Sbjct  193  DPNIWNAMMENSEVKQFMANK  213



>ref|XP_006280901.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
 gb|EOA13799.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
Length=291

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 21/152 (14%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            DG  VQ P    D WEFA    EE     EP+PR++F   PSL+EAKEAT DLK+A++ V
Sbjct  65   DGMAVQRPV--WDDWEFA----EE-----EPIPRVVFSKPPSLEEAKEATEDLKEAINMV  113

Query  407  YNMSTPPSDC---GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
            Y M++P S     GS+N    V+         S   +     P+ A++AF FL EN AAQ
Sbjct  114  Y-MTSPKSSAAMEGSSNDGGSVSK------MLSGFQSSEKAVPQVALQAFSFLSENTAAQ  166

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            TVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  167  TVVASIACDPKVWDAVMENKDLMKFLQTNNTA  198



>ref|XP_007211764.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
 gb|EMJ12963.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
Length=285

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 11/141 (8%)
 Frame = +2

Query  269  WEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD----  433
            W+  G   EE+V +AGEP+PR++F  APS +EA+EAT +LKDAL K+Y +S+P S     
Sbjct  75   WQVVGAAGEELVMSAGEPMPRVVFDAAPSFKEAREATTELKDALDKIY-LSSPKSTEFGE  133

Query  434  ---CGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  604
                   +G +Q+ N       S      +   PKHA +AF+ L  +  AQ VVASIASD
Sbjct  134  QSATDKVSGLSQIMNPEPEEVESLLLTRTS--VPKHAFQAFEMLSRSTEAQNVVASIASD  191

Query  605  PNVWNAVLANPELQEFLVSQK  667
            PN+WNA++ N  +++FL S K
Sbjct  192  PNIWNAMMENSAVKQFLKSNK  212



>gb|KJB45631.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=315

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 11/145 (8%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAG--------EPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNM  415
            +D WEFAG  E+E    G        EP+ R++F GAPSL+EAKEAT DLKDAL KVY  
Sbjct  78   VDDWEFAGDFEQEAALEGSIAASGRPEPIARVLFSGAPSLEEAKEATNDLKDALDKVYLS  137

Query  416  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            S   S+     G + ++N        +     A   PK AI+AFK L E+ A  +VVASI
Sbjct  138  SPQYSEMVQVTGVSSLSNTEETKDCVAYNIE-ATSVPKPAIQAFKLLNESPA--SVVASI  194

Query  596  ASDPNVWNAVLANPELQEFLVSQKT  670
            ASDP+VW+AVL N    +F+ SQ+T
Sbjct  195  ASDPHVWDAVLNNSAYMDFIKSQQT  219



>gb|KFK27065.1| hypothetical protein AALP_AA8G329900 [Arabis alpina]
Length=296

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 86/136 (63%), Gaps = 12/136 (9%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WEFA    EE     EP+PR++F   P+LQEAKEAT DLK+A++ VY + +P S   S
Sbjct  78   DDWEFA----EE-----EPIPRVVFSKPPTLQEAKEATEDLKEAINMVY-IKSPTSKEDS  127

Query  443  TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  622
              G++   +   P   SS   AI    P+ A++AF FL EN AAQTVVASIASDP VW+A
Sbjct  128  NEGSSV--SKMFPSFQSSENRAIESAVPQVALQAFAFLSENTAAQTVVASIASDPKVWDA  185

Query  623  VLANPELQEFLVSQKT  670
            V+ N +L +FL S  T
Sbjct  186  VMENKDLMKFLESNNT  201



>gb|AFK40544.1| unknown [Lotus japonicus]
Length=324

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 10/145 (7%)
 Frame = +2

Query  257  ELDGWEFA-GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  433
            +L  WEFA  GD   +++AGEP+PR++FG  PS QEAKEAT +LKDA+ K+Y +S+  S 
Sbjct  72   DLSDWEFADAGDL--VISAGEPMPRVVFGEVPSFQEAKEATIELKDAIEKMY-LSSDSSQ  128

Query  434  CGSTNGAAQVNNDHsppsnsssenAIAHGA------PKHAIRAFKFLYENAAAQTVVASI  595
               +    Q++          +++    GA      PKHAI+AF+ L  ++  QTVVASI
Sbjct  129  YEESFPDNQISVLPHTLFEPVNKSCDVEGAISNLSVPKHAIQAFELLSASSEVQTVVASI  188

Query  596  ASDPNVWNAVLANPELQEFLVSQKT  670
            ASD NVW AV+ NP +  F  SQ+T
Sbjct  189  ASDSNVWKAVMQNPAVNSFFQSQQT  213



>gb|AFK40032.1| unknown [Lotus japonicus]
Length=324

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 10/145 (7%)
 Frame = +2

Query  257  ELDGWEFA-GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  433
            +L  WEFA  GD   +++AGEP+PR++FG  PS QEAKEAT +LKDA+ K+Y +S+  S 
Sbjct  72   DLSDWEFADAGDL--VISAGEPMPRVVFGEVPSFQEAKEATIELKDAIEKMY-LSSDSSQ  128

Query  434  CGSTNGAAQVNNDHsppsnsssenAIAHGA------PKHAIRAFKFLYENAAAQTVVASI  595
               +    Q++          +++    GA      PKHAI+AF+ L  ++  QTVVASI
Sbjct  129  YEESFPDNQISVLPHTLFEPVNKSCDVEGAISNLSVPKHAIQAFELLSASSEVQTVVASI  188

Query  596  ASDPNVWNAVLANPELQEFLVSQKT  670
            ASD NVW AV+ NP +  F  SQ+T
Sbjct  189  ASDSNVWKAVMQNPAVSSFFQSQQT  213



>ref|XP_003539571.1| PREDICTED: uncharacterized protein LOC100795500 isoform X1 [Glycine 
max]
Length=274

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 10/142 (7%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WE A G EE+    GE   R++ G  PS+QEAK AT +LK A+HKVY +S+  S+C  
Sbjct  37   DDWEVADGGEED----GEGAARVVLGDVPSIQEAKAATAELKHAIHKVY-LSSNSSECDG  91

Query  443  TNGAAQVN----NDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDP  607
             + + QV+    +     + S    AI +  AP  A++AF+ L E+  AQ+VVASIA DP
Sbjct  92   CSLSGQVSVVSPSHTELENKSHFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIACDP  151

Query  608  NVWNAVLANPELQEFLVSQKTS  673
            N+WNA+  NP LQ+F  S +T+
Sbjct  152  NIWNAIAQNPTLQDFFQSHQTA  173



>ref|XP_009355556.1| PREDICTED: uncharacterized protein LOC103946557 [Pyrus x bretschneideri]
Length=312

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  257  ELDGWEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSD  433
            E   W+  G  E+++V + GEP PR++F  APS +EAKEAT +LKDAL KVY  S   +D
Sbjct  73   EFVDWQVVGAGEDDLVMSGGEPTPRVVFDAAPSFKEAKEATAELKDALDKVYLSSPKSTD  132

Query  434  CGSTNGAAQVNN----DHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
             G  + A  V       +  P    S        PKHA+ AF+ L  ++ AQ VVASIAS
Sbjct  133  FGEVSAADNVAGLSLITNPEPEEMESLLLTRTSVPKHALHAFEMLSRSSEAQNVVASIAS  192

Query  602  DPNVWNAVLANPELQEFLVSQ  664
            DPN+WNA++ N  +++F+ ++
Sbjct  193  DPNIWNAMMENSAVKQFMANK  213



>ref|XP_008454598.1| PREDICTED: uncharacterized protein LOC103494971 isoform X2 [Cucumis 
melo]
Length=295

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 77/141 (55%), Gaps = 20/141 (14%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            V  P  E D WEFA  + +  + +    PR++FG  PS  EAKEAT ++K+AL K     
Sbjct  67   VHKPTWEFDDWEFANFENDMGMDSVGLKPRIVFGAVPSFDEAKEATMEVKEALDKKIESV  126

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIA  598
            +    C S   + Q  N                  P+HAI+AFK L E+A AQTVVASIA
Sbjct  127  S----CLSNETSLQSQNS----------------VPQHAIQAFKLLKESAEAQTVVASIA  166

Query  599  SDPNVWNAVLANPELQEFLVS  661
            SDPNVWNA+L N  L+ FL S
Sbjct  167  SDPNVWNAMLGNEALKSFLQS  187



>ref|XP_004151973.1| PREDICTED: uncharacterized protein LOC101218021 isoform 2 [Cucumis 
sativus]
Length=297

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 84/148 (57%), Gaps = 22/148 (15%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDAL-HKVYNM  415
            V  P  E D WEFA  + +  + +    PR++FG  PS +EAKEAT ++K+AL  K+ ++
Sbjct  69   VHKPTWEFDDWEFANFENDMGMDSVGFKPRIVFGAVPSFEEAKEATTEVKEALDKKIESV  128

Query  416  STPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            S     C S   + Q                     P+HAI+AFK L E+A AQTVVASI
Sbjct  129  S-----CLSNETSLQSQTS----------------VPQHAIQAFKLLKESAEAQTVVASI  167

Query  596  ASDPNVWNAVLANPELQEFLVSQKTSML  679
            ASDPNVWNA+L N  L+ FL S +T+ +
Sbjct  168  ASDPNVWNAMLGNEALKSFLQSYQTNKI  195



>gb|AFK42977.1| unknown [Medicago truncatula]
Length=241

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 109/201 (54%), Gaps = 18/201 (9%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            I VA SGFRG    +P   A ++  R  + S     S   K++          D  P+  
Sbjct  16   IGVARSGFRGTTVTYP---AEKQWSRNRASSPTRVISQGTKTA----------DVKPLHT  62

Query  248  PCRE-LDGWEFAGGDEEEM-VAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  421
               E L+ WEFA  DE ++ +++GEP PR++FG  P+L+EA+EAT +LKDA+ ++Y +S 
Sbjct  63   SVSEDLNDWEFA--DEGDLFMSSGEPTPRMVFGEVPTLKEAEEATAELKDAIDQIY-LSP  119

Query  422  PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
              S   +++  ++V+       +   E        KHAI AF+ L  +  AQTVV SIA 
Sbjct  120  ANSQIENSSPGSEVSVLSPYSKDCLVEAISNPSVSKHAIHAFQLLSSSVEAQTVVQSIAC  179

Query  602  DPNVWNAVLANPELQEFLVSQ  664
            DPN+WNAV+ NP +  F  SQ
Sbjct  180  DPNIWNAVMQNPAVTSFFESQ  200



>ref|XP_008365896.1| PREDICTED: uncharacterized protein LOC103429531 [Malus domestica]
Length=307

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 87/156 (56%), Gaps = 9/156 (6%)
 Frame = +2

Query  230  GAPVQWPCRELDGWEFAGGDEEEMV-AAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            G P      +   W+  G  E+++V + GEP+PR++F  APS +EAKEAT +LKDAL KV
Sbjct  59   GKPASDAVDDFVDWQVVGAGEDDLVMSGGEPMPRVVFDAAPSFKEAKEATAELKDALDKV  118

Query  407  YNMSTPPSDCGSTNGAAQ------VNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  568
            Y  S   +D G  + AA       + N       S      +   PKHA+ AF+ L   +
Sbjct  119  YLSSPKSTDLGEPSAAADAAGLPLIKNPEPEEMESLLLTRTS--VPKHALHAFEMLSRCS  176

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
             AQ VVASI SDPN+W A++ N  +++F+ ++  ++
Sbjct  177  EAQNVVASITSDPNIWXAMMENSAVKQFMANKNYNL  212



>gb|KEH30768.1| transmembrane protein, putative [Medicago truncatula]
Length=305

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 109/201 (54%), Gaps = 18/201 (9%)
 Frame = +2

Query  68   ITVANSGFRGIASEHPVSSAARKvvrpvsvsgissssDHLKssavsasqstavDGAPVQW  247
            I VA SGFRG    +P   A ++  R  + S     S   K++          D  P+  
Sbjct  16   IGVARSGFRGTTVTYP---AEKQWSRNRASSPTRVISQGTKTA----------DVKPLHT  62

Query  248  PCRE-LDGWEFAGGDEEEM-VAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  421
               E L+ WEFA  DE ++ +++GEP PR++FG  P+L+EA+EAT +LKDA+ ++Y +S 
Sbjct  63   SVSEDLNDWEFA--DEGDLFMSSGEPTPRMVFGEVPTLKEAEEATAELKDAIDQIY-LSP  119

Query  422  PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
              S   +++  ++V+       +   E        KHAI AF+ L  +  AQTVV SIA 
Sbjct  120  ANSQIENSSPGSEVSVLSPYSKDCLVEAISNPSVSKHAIHAFQLLSSSVEAQTVVQSIAC  179

Query  602  DPNVWNAVLANPELQEFLVSQ  664
            DPN+WNAV+ NP +  F  SQ
Sbjct  180  DPNIWNAVMQNPAVTSFFESQ  200



>ref|XP_009385062.1| PREDICTED: uncharacterized protein LOC103972444 [Musa acuminata 
subsp. malaccensis]
Length=297

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 87/155 (56%), Gaps = 14/155 (9%)
 Frame = +2

Query  227  DGAP-VQWPCRELDGWEFAGGDEEE---MVAAGEPLPRLIFGGAPSLQEAKEATFDLKDA  394
            + AP +Q    E D WE A  +EEE    + +  P PRL+FG   SL+EAKEAT DLKDA
Sbjct  61   EAAPEIQGLAWEFDDWEVADWEEEEKDVTLDSLHPAPRLVFGPVASLEEAKEATSDLKDA  120

Query  395  LHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  574
            L  VY  STP ++  +     +  +  +         +I   AP+H ++AF  L  +   
Sbjct  121  LDMVY--STPDTNESTVQSPQESTHSEAS--------SIVPSAPRHVVQAFSLLRGSPEV  170

Query  575  QTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            Q VVAS+ASD NVWNAV+ N ++ EF V+ ++  L
Sbjct  171  QDVVASLASDENVWNAVMKNEKVMEFYVTHQSIAL  205



>gb|KJB45632.1| hypothetical protein B456_007G317300 [Gossypium raimondii]
Length=368

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 77/144 (53%), Gaps = 16/144 (11%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVA---------AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYN  412
            +D WE +GG  E  VA          GEP+  ++FGG PSL+EAKEA  DLKDAL  VY 
Sbjct  70   VDDWELSGGIVEHEVALEGSSDASGQGEPIAGVLFGGVPSLEEAKEAIADLKDALDMVYL  129

Query  413  MSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  592
               P  D    +  + V+N                 APK AI+AFK L E+A  Q+VV+S
Sbjct  130  SPPPYGDTARDSAVSLVSNPEETSKG-------CASAPKPAIQAFKLLSESADVQSVVSS  182

Query  593  IASDPNVWNAVLANPELQEFLVSQ  664
            I +DPNV NAVL N    +F+  Q
Sbjct  183  IVADPNVRNAVLNNSAYMDFIQYQ  206



>ref|XP_006401561.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
 gb|ESQ43014.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
Length=292

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 17/136 (13%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WEFA   EEE       +PR++F   PSLQEAKEAT DLK+A++ VY         GS
Sbjct  77   DDWEFA---EEE-----PTIPRVVFSKPPSLQEAKEATEDLKEAINLVYIE-------GS  121

Query  443  TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  622
              G +   +       +S   A+    P+ A++AF FL ENAAAQ+VVASIASDP VW+A
Sbjct  122  NEGGSV--SKMLSSFQASENRAVESAVPQVALQAFAFLSENAAAQSVVASIASDPKVWDA  179

Query  623  VLANPELQEFLVSQKT  670
            V+ N +L +FL +  T
Sbjct  180  VMENKDLMKFLETNNT  195



>ref|XP_006594801.1| PREDICTED: uncharacterized protein LOC100779229 [Glycine max]
Length=282

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 82/144 (57%), Gaps = 14/144 (10%)
 Frame = +2

Query  257  ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  436
            ++D WE A G        GE  PR++ GG PS QEA  AT +LK A+ K+Y +S+  S+C
Sbjct  47   DVDDWEVADG--------GEGTPRVVLGGVPSFQEATSATTELKHAIDKIY-LSSNSSEC  97

Query  437  GSTNGAAQVN-----NDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
               + +  V+     +      +  +E  +       A++AF+ L E   AQ+VVASIA 
Sbjct  98   DGCSLSGHVSVMSPSHSELENKSRVTEAILNPSESNRALQAFQLLSECPEAQSVVASIAC  157

Query  602  DPNVWNAVLANPELQEFLVSQKTS  673
            DPN+WNA++ NP LQ+F  SQ+T+
Sbjct  158  DPNIWNAIVQNPALQDFFQSQQTA  181



>gb|KHN27993.1| hypothetical protein glysoja_007725 [Glycine soja]
Length=275

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 87/144 (60%), Gaps = 10/144 (7%)
 Frame = +2

Query  257  ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  436
            E+   + A  D+E+    GE   R++ G  PS+QEAK AT +LK A+HKVY +S+  S+C
Sbjct  36   EVSPLQAAAWDDED----GEGAARVVLGDVPSIQEAKAATAELKHAIHKVY-LSSNSSEC  90

Query  437  GSTNGAAQVN----NDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIAS  601
               + + QV+    +     + S    AI +  AP  A++AF+ L E+  AQ+VVASIA 
Sbjct  91   DGCSLSGQVSVVSPSHTELENKSHFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIAC  150

Query  602  DPNVWNAVLANPELQEFLVSQKTS  673
            DPN+WNA+  NP LQ+F  S +T+
Sbjct  151  DPNIWNAIAQNPTLQDFFQSHQTA  174



>ref|XP_009127082.1| PREDICTED: uncharacterized protein LOC103851954 [Brassica rapa]
Length=296

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 81/137 (59%), Gaps = 15/137 (11%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WEFA       V     +PR +F   PSL+EAKEAT DLKDA++ VY   +  ++ GS
Sbjct  77   DDWEFAE------VETTTTIPRFVFSKPPSLEEAKEATDDLKDAINMVYTEGS--NEAGS  128

Query  443  TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  622
             +    +++ H          A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  129  VS--RMLSSFHLSDKR-----AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDA  181

Query  623  VLANPELQEFLVSQKTS  673
            V+ N +L +FL +  T+
Sbjct  182  VMENSDLMKFLDTNTTA  198



>emb|CDY42460.1| BnaA10g08360D [Brassica napus]
Length=293

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 81/143 (57%), Gaps = 17/143 (12%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL+  
Sbjct  63   DAVVMRKPVWE-DEWEFAEVETK-------TIPRVVFDKPPSLQEAKEATDDLKDALNMA  114

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  586
            Y   +  ++ GS +               S   A+    P+ A++AF FL EN AAQ+VV
Sbjct  115  YMEGS--NEVGSVS-------RMFSSFQPSENRAVESAVPQVALKAFAFLSENTAAQSVV  165

Query  587  ASIASDPNVWNAVLANPELQEFL  655
            ASIASDP VW+AV+ N +L +FL
Sbjct  166  ASIASDPKVWDAVMENKDLMKFL  188



>ref|XP_009119980.1| PREDICTED: uncharacterized protein LOC103844909 [Brassica rapa]
Length=289

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 84/143 (59%), Gaps = 17/143 (12%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL+  
Sbjct  63   DAVVMRKPVWE-DEWEFAEVETK-------TIPRVVFDKPPSLQEAKEATDDLKDALNMA  114

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  586
            Y   +  ++ GS   +   ++ H   +      A+    P+ A++AF FL EN AAQ+VV
Sbjct  115  YMEGS--NEVGSV--SRMFSSFHPSENR-----AVESAVPQVALKAFAFLSENTAAQSVV  165

Query  587  ASIASDPNVWNAVLANPELQEFL  655
            ASIASDP VW+AV+ N +L +FL
Sbjct  166  ASIASDPKVWDAVMENKDLMKFL  188



>ref|XP_010520882.1| PREDICTED: uncharacterized protein LOC104799894 [Tarenaya hassleriana]
Length=320

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 10/154 (6%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            D A VQ P    D WEFAG +EE      EP+ R++F G P+LQEAK+AT DLK+A+  V
Sbjct  65   DVAVVQKPV--WDDWEFAGVEEELGGGG-EPIARVVFSGPPTLQEAKDATEDLKEAIDMV  121

Query  407  Y---NMSTP---PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENA  568
            Y     ++P   P   G  +G  +             ++ ++   PK A++AF FL E+ 
Sbjct  122  YLSSQKTSPMEGPVAAGPVSGILRSVQSSENDVFKGVQSRVSP-VPKVALQAFAFLSESP  180

Query  569  AAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
            AAQ+VVASIASDP VW+AV+ N +L EFL S KT
Sbjct  181  AAQSVVASIASDPKVWDAVMENKDLVEFLESNKT  214



>ref|XP_007021147.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
 gb|EOY12672.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
Length=355

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 87/178 (49%), Gaps = 42/178 (24%)
 Frame = +2

Query  260  LDGWEFAGGDEEE--MVAA-----GEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
             D WEFAGG EEE  MV +     GEP+ R++FGG PS +EAKEAT DLKDAL KVY +S
Sbjct  75   FDDWEFAGGVEEEVAMVGSTASGGGEPMARVLFGGVPSHEEAKEATADLKDALDKVY-LS  133

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQT------  580
            +P S   +      + +      +  + N  A   PK AI+AFK   E+   QT      
Sbjct  134  SPNSADTAQACPLTLLSYPEETKDCVACNVKATSVPKPAIQAFKLFNESPQVQTSRRVSF  193

Query  581  ----------------------------VVASIASDPNVWNAVLANPELQEFLVSQKT  670
                                        VV S+A+D NVWNAVL N    EF+ SQKT
Sbjct  194  LDSCALGNVRCVFAIISCPPVGFLHIVSVVTSLAADQNVWNAVLNNSAYMEFVQSQKT  251



>emb|CDY68666.1| BnaAnng27970D [Brassica napus]
Length=228

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 16/137 (12%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WEFA  +          +PR++F   PSLQEAKEAT DLKDA++ VY   +   + GS
Sbjct  10   DDWEFAEVE-------TTTIPRVVFSKPPSLQEAKEATDDLKDAINLVYTEGS--YEAGS  60

Query  443  TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  622
             +    +++ H          A+    P+ ++ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  61   VSR--MLSSFHLSDKR-----AVESAVPQVSLNAFAFLSESSAAQSVVASIASDPKVWDA  113

Query  623  VLANPELQEFLVSQKTS  673
            V+ N +L +FL +  T+
Sbjct  114  VMENNDLMKFLDTNTTA  130



>emb|CDY63696.1| BnaCnng42470D [Brassica napus]
Length=358

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 13/137 (9%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WEFA    E        +PR++F   PSL+EAKEAT DLKDA++ VY   +  ++ GS
Sbjct  137  DDWEFA----EVETTTTTTIPRVVFSKPPSLEEAKEATDDLKDAINMVYTEGS--NEAGS  190

Query  443  TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNA  622
               +  +++ H          A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+A
Sbjct  191  V--SRMLSSFHLSDKR-----AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDA  243

Query  623  VLANPELQEFLVSQKTS  673
            V+ N +L +FL +  T+
Sbjct  244  VMENNDLMKFLDTNTTA  260



>gb|AGV54826.1| hypothetical protein [Phaseolus vulgaris]
Length=309

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 85/142 (60%), Gaps = 17/142 (12%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY-----NMSTPP  427
            D W+FA  ++ ++V     +PR++FG AP+ +EAKEAT +LKDA+ +VY     +  + P
Sbjct  67   DDWDFA--EDGDLV-----VPRMVFGSAPTFEEAKEATTELKDAIDQVYLSPDSSKYSSP  119

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASD  604
             D  ST         + P + S   + I++   P HAI+AF  L  +  AQ VVAS+ASD
Sbjct  120  GDEVSTLSPTL----YEPVNRSCVFDTISNPSVPNHAIQAFNLLSTSHEAQAVVASLASD  175

Query  605  PNVWNAVLANPELQEFLVSQKT  670
            PNVWNAV+ NP +  F  SQ+T
Sbjct  176  PNVWNAVMENPAVYRFFQSQQT  197



>ref|XP_011048251.1| PREDICTED: uncharacterized protein LOC105142358 isoform X3 [Populus 
euphratica]
Length=279

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = +2

Query  233  APVQWPCRELDGWEFAGGDEEEMVA-AGEPLPRLIFGGAP-SLQEAKEATFDLKDALHKV  406
            A VQ P  ELD WEFAGG EEE V  + EP+ R++FGGAP SLQEA+ ATF+LKDAL KV
Sbjct  60   ATVQRPSWELDEWEFAGGVEEETVVHSAEPVARVVFGGAPPSLQEAEAATFELKDALQKV  119

Query  407  YNMSTPPSDCGSTNGAAQVN-------NDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            Y +S+P S   S+ G +Q++       +D     +    +      PK+A++AF  L E+
Sbjct  120  Y-LSSPNSGTASSVGGSQLSGLPLLRKSDSLETKDCIPCDPTGAPVPKYAMQAFSLLNES  178

Query  566  AAAQTVV  586
               Q ++
Sbjct  179  PKIQVLI  185



>ref|XP_007133044.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
 gb|ESW05038.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
Length=309

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 85/142 (60%), Gaps = 17/142 (12%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY-----NMSTPP  427
            D W+FA  ++ ++V     +PR++FG AP+ +EAKEAT +LKDA+ +VY     +  + P
Sbjct  67   DDWDFA--EDGDLV-----VPRMVFGSAPTFEEAKEATTELKDAIDQVYLSPDSSKYSSP  119

Query  428  SDCGSTNGAAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASD  604
             D  ST         + P + S   + I++   P HAI+AF  L  +  AQ VVAS+ASD
Sbjct  120  GDEVSTLSPTL----YEPVNRSCVFDTISNPSVPNHAIQAFNLLSTSHEAQAVVASLASD  175

Query  605  PNVWNAVLANPELQEFLVSQKT  670
            PNVWNAV+ NP +  F  SQ+T
Sbjct  176  PNVWNAVMENPVVYRFFQSQQT  197



>ref|XP_006592890.1| PREDICTED: uncharacterized protein LOC100795500 isoform X2 [Glycine 
max]
Length=258

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 74/138 (54%), Gaps = 18/138 (13%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D WE A G EE+    GE   R++ G  PS+QEAK AT +LK A+H        PS    
Sbjct  37   DDWEVADGGEED----GEGAARVVLGDVPSIQEAKAATAELKHAIHNGQVSVVSPSHTEL  92

Query  443  TNGAAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDPNVWN  619
             N +                 AI +  AP  A++AF+ L E+  AQ+VVASIA DPN+WN
Sbjct  93   ENKS-------------HFTEAITYPSAPNRALQAFQLLSESPEAQSVVASIACDPNIWN  139

Query  620  AVLANPELQEFLVSQKTS  673
            A+  NP LQ+F  S +T+
Sbjct  140  AIAQNPTLQDFFQSHQTA  157



>emb|CDY64929.1| BnaCnng45510D [Brassica napus]
Length=289

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 17/149 (11%)
 Frame = +2

Query  227  DGAPVQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKV  406
            D   ++ P  E D WEFA  + +        +PR++F   PSLQEAKEAT DLKDAL   
Sbjct  63   DAVVMRKPVWE-DEWEFAEVETK-------TIPRVVFDKPPSLQEAKEATDDLKDAL---  111

Query  407  YNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVV  586
             NM+     C   +      +        S   A+    P+ A++AF FL EN AAQ+VV
Sbjct  112  -NMA-----CMEGSNEVGSVSRMFSSFQPSENRAVESAVPQVALKAFAFLSENTAAQSVV  165

Query  587  ASIASDPNVWNAVLANPELQEFLVSQKTS  673
             SIASDP VW+AV+ N +L +FL +   S
Sbjct  166  TSIASDPKVWDAVMENKDLMKFLETNTAS  194



>ref|XP_003527303.2| PREDICTED: uncharacterized protein LOC100782462 [Glycine max]
Length=316

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 11/139 (8%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGS  442
            D W+FA  ++ E+V     +PR++FG  P+L EAKEAT +LKDA+ +VY +    S   S
Sbjct  66   DDWDFA--EDGELV-----VPRMVFGSVPTLDEAKEATAELKDAIDQVY-LCPETSQYSS  117

Query  443  TNG--AAQVNNDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVASIASDPNV  613
              G  +A     + P + S   +AI+   APKHAI+AF  L  +  AQ VVAS+A DPNV
Sbjct  118  PGGQVSALSPTLYGPVNRSCVIDAISDPTAPKHAIQAFHLLSTSREAQAVVASLACDPNV  177

Query  614  WNAVLANPELQEFLVSQKT  670
            WNAV+ N  +  F  SQ++
Sbjct  178  WNAVMENSAVSSFFQSQQS  196



>ref|XP_009402588.1| PREDICTED: uncharacterized protein LOC103986335 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402589.1| PREDICTED: uncharacterized protein LOC103986335 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=308

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 13/150 (9%)
 Frame = +2

Query  239  VQWPCRELDGWEFAG-GDEEEMVA--AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            +  P  ++  WEF+G G EE+ V   +  P PRL+ G  PSL+EAKEAT DLKDAL KV 
Sbjct  67   IHGPAGDIHDWEFSGWGREEQEVVLDSLHPAPRLVCGPVPSLEEAKEATSDLKDALEKV-  125

Query  410  NMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVA  589
            N ST      STN +A         S     + +    P+  ++AF  L  +  AQ VVA
Sbjct  126  NFST------STNESAI---KVPFESTCYEASYVIPSMPRRVVQAFSLLQGSPEAQDVVA  176

Query  590  SIASDPNVWNAVLANPELQEFLVSQKTSML  679
            S+ASD NVW+AV+ N ++ EF  + ++ +L
Sbjct  177  SLASDKNVWDAVMRNEKVMEFFRTHQSIVL  206



>ref|XP_010928579.1| PREDICTED: uncharacterized protein LOC105050305 isoform X2 [Elaeis 
guineensis]
Length=308

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 79/148 (53%), Gaps = 29/148 (20%)
 Frame = +2

Query  287  DEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY----------------NMS  418
            +++E+  +  P PRL+FG  P+L+EAK AT +LKDAL KVY                ++ 
Sbjct  72   EKKELFDSLYPAPRLVFGRVPTLEEAKAATAELKDALEKVYFSSSTTSDSTRSGLGASLQ  131

Query  419  TPPSDCGS-TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            +P    GS T G     N            +     P +AI+ F  L  N  AQ VVASI
Sbjct  132  SPVCLEGSETKGCTMSKN------------STLSSTPNYAIQMFSLLQGNPKAQNVVASI  179

Query  596  ASDPNVWNAVLANPELQEFLVSQKTSML  679
            ASD NVWNAV+ NP++++F  +Q++ +L
Sbjct  180  ASDENVWNAVMNNPKVKQFYETQQSMVL  207



>ref|XP_009393345.1| PREDICTED: uncharacterized protein LOC103979052 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 69/132 (52%), Gaps = 15/132 (11%)
 Frame = +2

Query  260  LDGW-EFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  436
             DGW E+  G   + V   +P PRL+FG  P+L+EAKEAT DL DA  KVY    PPS  
Sbjct  91   FDGWAEYEQGITLDPV---QPAPRLVFGSIPTLEEAKEATSDLIDAFDKVY----PPSHN  143

Query  437  GSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVW  616
                  A  +  H          +I    P+H +  F  L  +   QTVVASIASD NVW
Sbjct  144  VPAIEVAHKSAHHEAS-------SIIPSMPRHVVETFSLLQRSPEVQTVVASIASDENVW  196

Query  617  NAVLANPELQEF  652
            NAV  N ++ EF
Sbjct  197  NAVTKNEKVMEF  208



>ref|XP_009402591.1| PREDICTED: uncharacterized protein LOC103986335 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 84/149 (56%), Gaps = 13/149 (9%)
 Frame = +2

Query  239  VQWPCRELDGWEFAG-GDEEEMVA--AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            +  P  ++  WEF+G G EE+ V   +  P PRL+ G  PSL+EAKEAT DLKDAL KV 
Sbjct  67   IHGPAGDIHDWEFSGWGREEQEVVLDSLHPAPRLVCGPVPSLEEAKEATSDLKDALEKV-  125

Query  410  NMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVA  589
            N ST      STN +A         S     + +    P+  ++AF  L  +  AQ VVA
Sbjct  126  NFST------STNESAI---KVPFESTCYEASYVIPSMPRRVVQAFSLLQGSPEAQDVVA  176

Query  590  SIASDPNVWNAVLANPELQEFLVSQKTSM  676
            S+ASD NVW+AV+ N ++ EF  + ++ +
Sbjct  177  SLASDKNVWDAVMRNEKVMEFFRTHQSIL  205



>ref|XP_010928571.1| PREDICTED: uncharacterized protein LOC105050305 isoform X1 [Elaeis 
guineensis]
Length=312

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 77/145 (53%), Gaps = 29/145 (20%)
 Frame = +2

Query  287  DEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY----------------NMS  418
            +++E+  +  P PRL+FG  P+L+EAK AT +LKDAL KVY                ++ 
Sbjct  72   EKKELFDSLYPAPRLVFGRVPTLEEAKAATAELKDALEKVYFSSSTTSDSTRSGLGASLQ  131

Query  419  TPPSDCGS-TNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASI  595
            +P    GS T G     N            +     P +AI+ F  L  N  AQ VVASI
Sbjct  132  SPVCLEGSETKGCTMSKN------------STLSSTPNYAIQMFSLLQGNPKAQNVVASI  179

Query  596  ASDPNVWNAVLANPELQEFLVSQKT  670
            ASD NVWNAV+ NP++++F  +Q++
Sbjct  180  ASDENVWNAVMNNPKVKQFYETQQS  204



>ref|XP_006659890.1| PREDICTED: uncharacterized protein LOC102713016 [Oryza brachyantha]
Length=236

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (54%), Gaps = 18/145 (12%)
 Frame = +2

Query  260  LDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTP  424
            +D WEFA     G  E E+ AAG+P  RL+F   PS +EA+ AT +L+DA+ +VY    P
Sbjct  1    MDDWEFADWRDVGAAEPEVTAAGKP--RLVFA-PPSREEAEVATTELRDAIDRVYFNEAP  57

Query  425  PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  604
                       +V  +     +    +AI    P H ++AF  L  +  AQ VVAS+ASD
Sbjct  58   ----------VEVVKEQDKDLSKLGADAIIPAMPGHVVQAFTLLKSSPEAQGVVASLASD  107

Query  605  PNVWNAVLANPELQEFLVSQKTSML  679
             NVW AVL N ++ EF  + + S++
Sbjct  108  KNVWEAVLKNEKVMEFYKTHQQSLV  132



>ref|XP_003573409.1| PREDICTED: uncharacterized protein LOC100845511 [Brachypodium 
distachyon]
Length=313

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 18/146 (12%)
 Frame = +2

Query  257  ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  421
            E+D WEFA        E E  A G P  RL+F   PS +EA+EAT +L++A+ +VY   T
Sbjct  73   EVDDWEFADWRDVAVSEAEETAVGRP--RLVFA-PPSQEEAQEATTELREAIDRVYFNET  129

Query  422  PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
            P           ++  +     N    +AI    P H ++AF  L  ++ AQ+VVAS+AS
Sbjct  130  P----------IEIVKEQDKELNKLGVDAIIPAMPGHVVQAFTLLKSSSEAQSVVASLAS  179

Query  602  DPNVWNAVLANPELQEFLVSQKTSML  679
            D NVW+AVL N  + EF  + + +++
Sbjct  180  DKNVWDAVLKNERVMEFYKNHQQTLV  205



>gb|KDO74400.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=219

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 16/153 (10%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST------  421
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  S+      
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  422  --PPSDCGSTNGAAQV-NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVAS  592
               P   G  +    + N++H+   +  + +  +   PK AI+AFK L E+ AAQ     
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQMTCFK  185

Query  593  IASDPNVWNAVLANPELQEFLVSQKTSMLGIIV  691
            I +     +  L    +Q  LV+ KT +L + V
Sbjct  186  IRN----LSKFLKQHLIQANLVTLKTKVLTLEV  214



>gb|KHN38595.1| hypothetical protein glysoja_040149 [Glycine soja]
Length=246

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 74/128 (58%), Gaps = 16/128 (13%)
 Frame = +2

Query  329  LIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNG---------AAQVN----N  469
            ++FG  P+  EAKEAT +LKDA+ +VY   +P S   S+ G           QV+     
Sbjct  1    MVFGSVPTFAEAKEATAELKDAIDQVY--LSPESSQYSSRGGQVSALSPTGGQVSALSPT  58

Query  470  DHsppsnsssenAIA-HGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQ  646
             + P + S   +AI+   APKHAI+AF  L  +  AQ VVAS+A DPNVWNAV+ NP + 
Sbjct  59   LYEPVNRSCVVDAISDSSAPKHAIQAFHLLSTSREAQAVVASLACDPNVWNAVMENPAVS  118

Query  647  EFLVSQKT  670
             F  SQ++
Sbjct  119  SFFQSQQS  126



>ref|XP_002443952.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
 gb|EES13447.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
Length=313

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 82/160 (51%), Gaps = 22/160 (14%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAGGDEEEMVAAGEPL----------PRLIFGGAPSLQEAKEATF  379
            A  QW    ELD WEFA   ++   AA              PRL+F   PS +EA+EAT 
Sbjct  60   ATAQWAASWELDDWEFADWRDDSAAAAVVVAEREATAAAAKPRLVFA-PPSREEAEEATS  118

Query  380  DLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLY  559
            +L+DA+ + Y   TP           +V  +     N  + +AI    P H ++AF  L 
Sbjct  119  ELRDAIERAYFNETP----------VEVVKEQDKEFNKQATDAIIPSMPGHVVQAFTLLK  168

Query  560  ENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
             +  AQ+VVAS+ASD NVW AVL N ++ EF  + +T+++
Sbjct  169  SSPEAQSVVASLASDRNVWEAVLKNEKVMEFYKNHQTTLV  208



>ref|XP_006452121.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|ESR65361.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74402.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=181

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = +2

Query  260  LDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVY--NMSTPPSD  433
            +D WEFAGG ++      EP+PR++FGGAPSL+E KEAT +LKDAL KVY  + ++  S+
Sbjct  69   VDDWEFAGGVDD---LPAEPMPRVVFGGAPSLEETKEATAELKDALDKVYLSSSNSNTSE  125

Query  434  CGSTNGAAQV-------NNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQ  577
             G      +V       N++H+   +  + +  +   PK AI+AFK L E+ AAQ
Sbjct  126  HGDPFVVGEVSSMPLLANSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQ  180



>ref|XP_006851190.1| hypothetical protein AMTR_s00043p00195000 [Amborella trichopoda]
 gb|ERN12771.1| hypothetical protein AMTR_s00043p00195000 [Amborella trichopoda]
Length=317

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 76/141 (54%), Gaps = 15/141 (11%)
 Frame = +2

Query  257  ELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDC  436
            E++ WEFAG +EE       PLPR++FG AP+ +E +EA  DLKDA  K Y  ++     
Sbjct  80   EVEDWEFAGVEEEY------PLPRVVFGSAPTQKEVEEAASDLKDAFEKAYLSTSTTVSS  133

Query  437  GS-------TNGAAQVN-NDHsppsnsssenAIAH-GAPKHAIRAFKFLYENAAAQTVVA  589
                      N +   N  D    +  +S+NA+A      + ++AF  L EN+  Q +V 
Sbjct  134  EVSSDFMHGVNSSMPFNLEDSETKACVTSQNAVAFPSMQSNVMQAFSLLKENSDVQNIVT  193

Query  590  SIASDPNVWNAVLANPELQEF  652
            S+A+D +VW AVL N ++ EF
Sbjct  194  SLATDKSVWEAVLKNEKVVEF  214



>gb|EAZ05807.1| hypothetical protein OsI_28043 [Oryza sativa Indica Group]
Length=240

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 18/146 (12%)
 Frame = +2

Query  257  ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMST  421
            E+D WEFA      G E E+ AAG+P  RL+F   PS +EA+EAT +L+DA+ +VY    
Sbjct  18   EVDDWEFADWRDVAGAEPEVTAAGKP--RLVFA-PPSREEAEEATTELRDAIDRVYFSEA  74

Query  422  PPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIAS  601
            P           +V  +     +    +AI    P H ++AF  L  +  AQ VVAS+AS
Sbjct  75   P----------IEVVKEQDKDLSKLGADAIIPAMPGHVMQAFTLLKSSPEAQGVVASLAS  124

Query  602  DPNVWNAVLANPELQEFLVSQKTSML  679
            D NVW+AVL N ++ EF  + + S++
Sbjct  125  DKNVWDAVLKNEKVMEFYKTHQQSLV  150



>ref|NP_001061135.1| Os08g0179900 [Oryza sativa Japonica Group]
 dbj|BAD17035.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23049.1| Os08g0179900 [Oryza sativa Japonica Group]
Length=300

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 82/152 (54%), Gaps = 19/152 (13%)
 Frame = +2

Query  242  QWPCR-ELDGWEFA-----GGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHK  403
            QW    E+D WEFA        E E+ AAG+P  RL+F   PS +EA+EAT +L+DA+ +
Sbjct  72   QWASSWEVDDWEFADWRDVAAAEPEVTAAGKP--RLVFA-PPSREEAEEATTELRDAIDR  128

Query  404  VYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTV  583
            VY    P           +V  +     +    +AI    P H ++AF  L  +  AQ V
Sbjct  129  VYFSEAP----------IEVVKEQDKDLSKLGADAIIPAMPGHVMQAFTLLKSSPEAQGV  178

Query  584  VASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            VAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  179  VASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  210



>gb|EPS66227.1| hypothetical protein M569_08551, partial [Genlisea aurea]
Length=299

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 76/172 (44%), Gaps = 62/172 (36%)
 Frame = +2

Query  239  VQWPCRELDGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMS  418
            V  P  E+D W  +G +EE  V   EP+PR++FGG P+LQEA+EAT +L        ++S
Sbjct  53   VATPAPEIDDWILSG-EEEIPVTNSEPMPRVVFGGVPTLQEAEEATSELS-------SLS  104

Query  419  TPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQT------  580
                    T+G+                       P  A+ AF+FL E+ A Q       
Sbjct  105  I------GTSGSL---------------------LPAPALMAFRFLNESPAVQVRALTKF  137

Query  581  ---------------------VVASIASDPNVWNAVLANPELQEFLVSQKTS  673
                                 VVASIASDPNVW AVL N   Q++L S  T+
Sbjct  138  QILEFFCCLLEINFKFSIFQNVVASIASDPNVWQAVLQNSVFQDYLKSSDTA  189



>ref|XP_008452336.1| PREDICTED: uncharacterized protein LOC103493396 [Cucumis melo]
Length=326

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +2

Query  275  FAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGA  454
            F   + E ++ AGEP+PRL+F   P+L+E+KEAT DLK+ L  +Y  S PP         
Sbjct  57   FFTYETELVMEAGEPVPRLVFDRVPNLEESKEATADLKEVLDAMYLESEPP---------  107

Query  455  AQVNNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVL  628
                   S   +    + I    P  KH  +AF+ L  +   Q  VAS A+D  V+ AVL
Sbjct  108  ------FSSEISLPLHSEIVGDGPGVKHVHQAFRLLCNSPEIQNAVASAAADQKVYEAVL  161

Query  629  ANPELQEFLVSQKTS  673
             N E+++ + S + S
Sbjct  162  ENSEVKKLIQSYQIS  176



>ref|XP_004972711.1| PREDICTED: uncharacterized protein LOC101763830 [Setaria italica]
Length=310

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 83/158 (53%), Gaps = 20/158 (13%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAGGDEE--------EMVAAGEPLPRLIFGGAPSLQEAKEATFDL  385
            A  QW    ELD WEFA   ++           AA    PRL+F   PS +EA+EAT +L
Sbjct  63   AAAQWAASWELDDWEFADWRDDAASVVVAEREAAAAAAKPRLVFA-PPSREEAEEATTEL  121

Query  386  KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  122  RDAIERAYFNESP----------VEVVKEQDKELNKLATDAIIPSMPGHVVQAFTLLKSS  171

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
              AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+++
Sbjct  172  PEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTLV  209



>dbj|BAJ88294.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00328.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05236.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 79/150 (53%), Gaps = 15/150 (10%)
 Frame = +2

Query  242  QWPCRELDGWEFAGGDEEEMVAAGEPL----PRLIFGGAPSLQEAKEATFDLKDALHKVY  409
            QW   E+D WEFA    E   +  +      PRL+F   PS +EA+EAT +L++A+ +VY
Sbjct  62   QWASWEVDDWEFADWRSESATSEADVAVVGGPRLVFA-PPSREEAEEATAELREAIDRVY  120

Query  410  NMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVA  589
               TP           +   +H    +    +A+    P H ++AF  L  +  AQ+VVA
Sbjct  121  FPETP----------VEAVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEAQSVVA  170

Query  590  SIASDPNVWNAVLANPELQEFLVSQKTSML  679
            S+ASD NVW+AVL N  + EF  S + +++
Sbjct  171  SLASDKNVWDAVLKNERVMEFYRSHQQTLI  200



>ref|XP_004149934.1| PREDICTED: uncharacterized protein LOC101211780 [Cucumis sativus]
 gb|KGN56181.1| hypothetical protein Csa_3G094000 [Cucumis sativus]
Length=320

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (55%), Gaps = 18/128 (14%)
 Frame = +2

Query  287  DEEEMVA-AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQV  463
            DE E+V  AGEP+PRL+F    +L+E+KE+T DLK+AL  +Y  S  P    S+  +  +
Sbjct  54   DETELVMEAGEPVPRLVFDRFINLEESKESTADLKEALDAMYLESEFP---FSSEISLPL  110

Query  464  NNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANP  637
            N++            I H  P  KH  +AF  L      Q VVAS A+D  V  AV  NP
Sbjct  111  NSE------------IVHNRPGVKHVHQAFHLLCNFPEVQNVVASAAADLKVQEAVFENP  158

Query  638  ELQEFLVS  661
            ++++F+ S
Sbjct  159  DVKKFIQS  166



>ref|XP_008678238.1| PREDICTED: uncharacterized protein LOC103653035 [Zea mays]
 gb|AFW61103.1| hypothetical protein ZEAMMB73_425084 [Zea mays]
Length=314

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 81/159 (51%), Gaps = 21/159 (13%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAG---------GDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFD  382
            A  QW    ELD WEFA             E    A    PRL+F   PS +EA+EAT +
Sbjct  58   AAAQWAASWELDDWEFADWRDDAAAAAAVVEREATAAAAKPRLVFA-PPSREEAEEATTE  116

Query  383  LKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYE  562
            L+DA+ + Y   +P           +V  +     N  + +A+    P H ++AF  L  
Sbjct  117  LRDAVERAYFNESP----------VEVVKEQDKEFNKLATDAMIPSMPGHVVQAFTLLKS  166

Query  563  NAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+++
Sbjct  167  STEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTLV  205



>ref|NP_001144178.1| uncharacterized protein LOC100277035 [Zea mays]
 gb|ACG38484.1| hypothetical protein [Zea mays]
Length=315

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 82/156 (53%), Gaps = 20/156 (13%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  385
            A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61   AAAQWAASWELDDWEFADCGDVTPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  386  KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            +DA+ + Y   +P           +V  + +   N  + +AI    P H ++AF  L  +
Sbjct  120  RDAIGRAYFNESP----------VEVVKEQNKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
              AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  170  TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  205



>gb|KDP39008.1| hypothetical protein JCGZ_00765 [Jatropha curcas]
Length=134

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 18/121 (15%)
 Frame = +2

Query  320  LPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsss  499
            +P ++F   PSL+EA+ AT D KDAL KVY   +P +   S       + +         
Sbjct  1    MPMVVFAPPPSLKEAEAATSDSKDALEKVYLSLSPRAKTESGGSFGIGSGET--------  52

Query  500  enAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
                      HA+ A  FL E++ AQ+VVA + SDP +W+A   N  +Q+F+ S+KT+  
Sbjct  53   ----------HAMAAIVFLNESSDAQSVVAFLVSDPKLWDAFRNNVAVQKFIKSRKTTAG  102

Query  680  G  682
            G
Sbjct  103  G  103



>gb|AFW56882.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=315

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 81/156 (52%), Gaps = 20/156 (13%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  385
            A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61   AAAQWAASWELDDWEFADCGDVAPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  386  KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  120  RDAIGRAYFNESP----------VEVVKEQDKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
              AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  170  TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  205



>gb|AFW56883.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=313

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 80/155 (52%), Gaps = 20/155 (13%)
 Frame = +2

Query  233  APVQWPCR-ELDGWEFAG-GD-------EEEMVAAGEPLPRLIFGGAPSLQEAKEATFDL  385
            A  QW    ELD WEFA  GD        E    A    PRL+F   PS +EA+EAT +L
Sbjct  61   AAAQWAASWELDDWEFADCGDVAPAAVVAEREATAAAAKPRLVFA-PPSREEAEEATTEL  119

Query  386  KDALHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYEN  565
            +DA+ + Y   +P           +V  +     N  + +AI    P H ++AF  L  +
Sbjct  120  RDAIGRAYFNESP----------VEVVKEQDKEFNKLATDAIIPSMPGHVVQAFTLLKSS  169

Query  566  AAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  670
              AQ+VVAS+ASD NVW+AVL N ++ EF  + +T
Sbjct  170  TEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQT  204



>gb|KCW70086.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=194

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  524  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
            PKHA+ AFK L ++  AQTVVASIASD +VW+A L N  LQ+FL SQ +S+
Sbjct  39   PKHAVEAFKLLTQSPEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSSI  89



>ref|XP_004166181.1| PREDICTED: uncharacterized LOC101211780 [Cucumis sativus]
Length=320

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 18/128 (14%)
 Frame = +2

Query  287  DEEEMVA-AGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQV  463
            DE E+V  AGEP+PRL+F    +L+E+KE+T DLK+ L  +Y  S  P    S+  +  +
Sbjct  54   DETELVMEAGEPVPRLVFDRFINLEESKESTADLKEVLDAMYLESEFP---FSSEISLPL  110

Query  464  NNDHsppsnsssenAIAHGAP--KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANP  637
            N++            I H  P  KH  +AF  L      Q VVAS A+D  V  AV  NP
Sbjct  111  NSE------------IVHNRPGVKHVHQAFHLLCNFPEVQNVVASAAADLKVQEAVFENP  158

Query  638  ELQEFLVS  661
            ++++F+ S
Sbjct  159  DVKKFIQS  166



>gb|ABK21444.1| unknown [Picea sitchensis]
Length=314

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 68/158 (43%), Gaps = 30/158 (19%)
 Frame = +2

Query  248  PCRELDGWEFAGGDEE--EMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHK------  403
            PC  LD WEF G DEE  +     +   RLIFG  P+ +E +E   D +DAL +      
Sbjct  70   PCWLLDDWEFTG-DEEGFQRHYDDDHHDRLIFGSVPTQKEVQEVVSDFQDALTQGIVPVS  128

Query  404  --------------VYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAI-  538
                          VY  S   S CG+      VN D     +      I   A  + + 
Sbjct  129  GNFNDKTTLSSSSSVYKKSGNKS-CGTL-----VNLDQMERESHEDNYRIVQKAGHNNVC  182

Query  539  RAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
             AF  L  N A Q +V S+ASD  VW A+L N ++ EF
Sbjct  183  EAFNLLQSNPAVQEMVISLASDKTVWEALLKNEKVTEF  220



>gb|EEE58521.1| hypothetical protein OsJ_09808 [Oryza sativa Japonica Group]
Length=279

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 65/119 (55%), Gaps = 2/119 (2%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQ--VNNDHsppsnsss  499
            R +FG  P+ +EA  AT DLK++     +    P   G  +   +  +++  S   ++  
Sbjct  63   REVFGPVPTHEEAMAATLDLKESFQFAKSAQLEPLPSGDLDVPTKGLIHSKTSEHEDNHE  122

Query  500  enAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
             + ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  123  ISLVSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  181



>dbj|BAK00216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 9/118 (8%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALH----KVYNMSTPPSDCGSTNGAAQVNNDH-----s  478
            R +FG  PS  EA  AT DL+DA      + +      S  G T  A +   DH     S
Sbjct  61   REVFGPVPSHDEAMAATLDLRDAFEIAKTESHGARLDMSHDGPTKVAQETLQDHPHSEAS  120

Query  479  ppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
                 +   ++A G+    I AF  L ++  AQ VVAS+ASD NVW AV+ N +L EF
Sbjct  121  MHEEKNDNLSVASGSSARVIEAFTMLQDSPEAQDVVASLASDKNVWEAVMKNKKLVEF  178



>gb|ABF94497.1| expressed protein [Oryza sativa Japonica Group]
Length=288

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (51%), Gaps = 11/128 (9%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCG-----------STNGAAQVNND  472
            R +FG  P+ +EA  AT DLK++     +    P   G           S +    +++ 
Sbjct  63   REVFGPVPTHEEAMAATLDLKESFQFAKSAQLEPLPSGDLDVPTKGLVHSESSQGLIHSK  122

Query  473  HsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
             S   ++   + ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F
Sbjct  123  TSEHEDNHEISLVSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKF  182

Query  653  LVSQKTSM  676
              +  T +
Sbjct  183  YKTYATKL  190



>gb|KHN36752.1| hypothetical protein glysoja_001483 [Glycine soja]
Length=259

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  530  HAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
             A++AF+ L E   AQ+VVASIA DPN+WNA++ NP LQ+F  SQ+T+
Sbjct  111  RALQAFQLLSECPEAQSVVASIACDPNIWNAIVQNPALQDFFQSQQTA  158



>ref|XP_010229018.1| PREDICTED: uncharacterized protein LOC100829035 [Brachypodium 
distachyon]
Length=282

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 6/115 (5%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALH------KVYNMSTPPSDCGSTNGAAQVNNDHspps  487
            R +FG  P+ +EA  AT DL++A         V ++    +         +V+++     
Sbjct  59   REVFGPVPTYEEAMAATIDLREAFEIAKVESHVAHLEISKTKDAQETFQDRVHSESFKHE  118

Query  488  nsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
            +     +++ GA    I AF  L E+  AQ VVAS+ASD NVW AV+ N ++ +F
Sbjct  119  DKYENLSVSSGASGRVIEAFTMLQESPEAQDVVASLASDKNVWEAVMKNEKVLQF  173



>tpg|DAA43934.1| TPA: hypothetical protein ZEAMMB73_179991 [Zea mays]
Length=270

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPPSDCGSTNGAAQ-VNNDHsppsnssse  502
            R +FG  P+ +E+  AT DLKDA       S     C       + V    S   +++  
Sbjct  32   REVFGPVPTHEESMAATLDLKDAFEITMEASEAIMICPRNEWPKKYVVYGMSKKEDNNEN  91

Query  503  nAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLG  682
              ++ G     ++AF  L E+  AQ VVAS+ASD NVW+AV+ N ++ +F  + +++ L 
Sbjct  92   LVVSSGTSGRVVQAFTLLQESPEAQVVVASLASDKNVWDAVMKNEKVIKFYKTYESNYLS  151



>ref|XP_002966997.1| hypothetical protein SELMODRAFT_439861 [Selaginella moellendorffii]
 gb|EFJ31596.1| hypothetical protein SELMODRAFT_439861 [Selaginella moellendorffii]
Length=303

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 61/142 (43%), Gaps = 15/142 (11%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP-----  427
            D W FAG +E       +    L+FG APS  E +EAT DL++AL   +    P      
Sbjct  59   DDWVFAGDEERSEYFVRD---HLVFGAAPSRDEVEEATADLQNALGMCFGEGLPTPALQQ  115

Query  428  -SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIR------AFKFLYENAAAQTVV  586
             S   S  G + V+  H                     R      AF  L  +   Q VV
Sbjct  116  DSPVSSIRGPSSVHLGHPVVDWIEPHLVSHEPGNVQVCRRNEVAEAFSLLQNDPIVQGVV  175

Query  587  ASIASDPNVWNAVLANPELQEF  652
             S+ASD  VW+AVLAN +++EF
Sbjct  176  MSVASDKAVWDAVLANEKVKEF  197



>ref|XP_002961012.1| hypothetical protein SELMODRAFT_437468 [Selaginella moellendorffii]
 gb|EFJ38551.1| hypothetical protein SELMODRAFT_437468 [Selaginella moellendorffii]
Length=306

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 61/142 (43%), Gaps = 15/142 (11%)
 Frame = +2

Query  263  DGWEFAGGDEEEMVAAGEPLPRLIFGGAPSLQEAKEATFDLKDALHKVYNMSTPP-----  427
            D W FAG +E       +    L+FG APS  E +EAT DL++AL   +    P      
Sbjct  59   DDWVFAGDEERSEYFVRD---HLVFGAAPSRDEVEEATADLQNALGMCFGEGLPTPALQQ  115

Query  428  -SDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIR------AFKFLYENAAAQTVV  586
             S   S  G + V+  H                     R      AF  L  +   Q VV
Sbjct  116  DSPVSSIRGPSSVHLGHPVVDWIEPHLVSHEPGNVQVCRRNEVAEAFSLLQNDPIVQGVV  175

Query  587  ASIASDPNVWNAVLANPELQEF  652
             S+ASD  VW+AVLAN +++EF
Sbjct  176  MSVASDKAVWDAVLANEKVKEF  197



>ref|XP_004985312.1| PREDICTED: uncharacterized protein LOC101783230 [Setaria italica]
Length=310

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (45%), Gaps = 27/136 (20%)
 Frame = +2

Query  326  RLIFGGAPSLQEAKEATFDLKDALH------KVYNMSTP---------------------  424
            R +FG  P+ +EA  AT DL +A           ++ TP                     
Sbjct  59   REVFGPVPTHEEAMAATLDLSEAFEIAKAESHTADLDTPKKHFSITDQDNHAKVAQQIAL  118

Query  425  PSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAAQTVVASIASD  604
            P    S      V+++ S   ++      A G P   ++AF  L+EN  AQ VVAS+ASD
Sbjct  119  PQSVESETPQVVVHSETSKKEDNYENLLAASGTPGRVVQAFTLLHENPEAQDVVASLASD  178

Query  605  PNVWNAVLANPELQEF  652
             NVW+AV+ N ++ +F
Sbjct  179  KNVWDAVMKNEKVLKF  194



>gb|EMT06766.1| hypothetical protein F775_27558 [Aegilops tauschii]
Length=251

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +2

Query  395  LHKVYNMSTPPSDCGSTNGAAQVNNDHsppsnsssenAIAHGAPKHAIRAFKFLYENAAA  574
            + +VY   TP           +V  +H    +    +A+    P H ++AF  L  +  A
Sbjct  63   VQRVYFKETP----------VEVVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEA  112

Query  575  QTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            Q+VVAS+ASD NVW+AVL N  + EF  S + +++
Sbjct  113  QSVVASLASDKNVWDAVLKNERVMEFYKSHQQTLV  147



>gb|ACF82614.1| unknown [Zea mays]
Length=161

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  524  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  2    PGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  51



>ref|XP_004987122.1| PREDICTED: uncharacterized protein LOC101758268 [Setaria italica]
Length=224

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  512  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
            A G P   ++AF  L+EN  AQ VVAS+ASD NVW+AV+ N ++ +F
Sbjct  70   ASGTPGRVVQAFTLLHENPEAQDVVASLASDKNVWDAVMKNEKVLKF  116



>gb|ABR26041.1| unknown [Oryza sativa Indica Group]
Length=168

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  506  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            AI    P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  21   AIIPAMPGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  78



>gb|EAY88928.1| hypothetical protein OsI_10413 [Oryza sativa Indica Group]
Length=327

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  509  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  174  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  229



>ref|NP_001049294.1| Os03g0201000 [Oryza sativa Japonica Group]
 gb|ABF94496.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11208.1| Os03g0201000 [Oryza sativa Japonica Group]
 dbj|BAG91353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  509  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  676
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  174  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  229



>gb|EEE68150.1| hypothetical protein OsJ_26259 [Oryza sativa Japonica Group]
Length=143

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  524  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  679
            P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  2    PGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  53



>ref|XP_007149673.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
 gb|ESW21667.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
Length=87

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  578  TVVASIASDPNVWNAVLANPELQEFLVSQKTS  673
            +VVASIA DPN+WNA++ NP+LQ+F+ +Q+T+
Sbjct  1    SVVASIACDPNIWNAMVKNPKLQDFVDAQQTA  32



>gb|EMT30710.1| hypothetical protein F775_11491 [Aegilops tauschii]
Length=222

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  536  IRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  652
            I AF  L+E+  AQ VVAS+ASD NVW AV+ N +L EF
Sbjct  76   IEAFTMLHESPEAQDVVASLASDKNVWEAVMKNKKLVEF  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340