BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029D11

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    361   1e-121   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    358   1e-120   Nicotiana sylvestris
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    357   6e-120   Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             355   3e-119   Nicotiana benthamiana
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    355   3e-119   Nicotiana tomentosiformis
gb|AFH57997.1|  chloroplast PsbO1 precursor                             354   5e-119   Nicotiana benthamiana
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    354   6e-119   Populus euphratica
gb|AFH58000.1|  chloroplast PsbO4 precursor                             353   8e-119   Nicotiana benthamiana
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      353   8e-119   Litchi chinensis [litchi]
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    353   9e-119   Nicotiana sylvestris
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         353   1e-118   Jatropha curcas
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    353   1e-118   Sesamum indicum [beniseed]
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            353   2e-118   Populus trichocarpa [western balsam poplar]
gb|ABK96748.1|  unknown                                                 351   6e-118   Populus trichocarpa x Populus deltoides
ref|XP_007047093.1|  Photosystem II subunit O-2                         351   9e-118   
gb|AFH57999.1|  chloroplast PsbO3 precursor                             350   2e-117   Nicotiana benthamiana
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    350   2e-117   Sesamum indicum [beniseed]
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    350   3e-117   Malus domestica [apple tree]
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    350   3e-117   Pyrus x bretschneideri [bai li]
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    348   1e-116   Pyrus x bretschneideri [bai li]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          348   1e-116   Dimocarpus longan [longan]
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    348   2e-116   Vitis vinifera
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    347   3e-116   Pyrus x bretschneideri [bai li]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    347   4e-116   Prunus mume [ume]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    346   6e-116   
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    346   7e-116   Solanum tuberosum [potatoes]
ref|NP_001239736.1|  uncharacterized protein LOC100798485               345   2e-115   Glycine max [soybeans]
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    345   3e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    344   4e-115   Nelumbo nucifera [Indian lotus]
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             344   5e-115   Prunus persica
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            344   6e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    343   7e-115   Populus euphratica
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    343   8e-115   Ricinus communis
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    343   2e-114   Solanum tuberosum [potatoes]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    342   2e-114   Gossypium raimondii
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               341   9e-114   Gossypium arboreum [tree cotton]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     340   2e-113   Solanum tuberosum [potatoes]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          340   2e-113   Amborella trichopoda
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    340   2e-113   Solanum tuberosum [potatoes]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    339   4e-113   Fragaria vesca subsp. vesca
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           339   5e-113   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    338   5e-113   Nicotiana sylvestris
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    338   6e-113   
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    338   7e-113   Elaeis guineensis
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   335   1e-112   
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    337   2e-112   Nelumbo nucifera [Indian lotus]
emb|CDP02430.1|  unnamed protein product                                336   4e-112   Coffea canephora [robusta coffee]
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             336   5e-112   Phaseolus vulgaris [French bean]
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                336   5e-112   Erythranthe guttata [common monkey flower]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   336   5e-112   Citrus sinensis [apfelsine]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               335   1e-111   Solanum tuberosum [potatoes]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   1e-111   Brassica rapa
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             335   2e-111   Citrus clementina [clementine]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   335   2e-111   
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   2e-111   Tarenaya hassleriana [spider flower]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    334   3e-111   Arabis alpina [alpine rockcress]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             333   6e-111   Capsella rubella
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    333   6e-111   Eucalyptus grandis [rose gum]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               333   6e-111   Glycine max [soybeans]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             333   1e-110   Eutrema salsugineum [saltwater cress]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      333   1e-110   Phaseolus vulgaris [French bean]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             333   1e-110   Phaseolus vulgaris [French bean]
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    332   2e-110   Brassica rapa
gb|AAT65501.1|  photosystem II protein                                  333   2e-110   Brassica oleracea
emb|CDX81388.1|  BnaC09g07990D                                          332   2e-110   
ref|XP_002877774.1|  photosystem II subunit O-2                         332   2e-110   Arabidopsis lyrata subsp. lyrata
emb|CDY30764.1|  BnaC07g16640D                                          332   2e-110   Brassica napus [oilseed rape]
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 332   2e-110   Morus notabilis
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             333   3e-110   
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    331   5e-110   Camelina sativa [gold-of-pleasure]
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  331   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    331   6e-110   Glycine max [soybeans]
emb|CBI19622.3|  unnamed protein product                                328   7e-110   Vitis vinifera
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    330   9e-110   Brassica rapa
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        330   1e-109   Arabidopsis lyrata subsp. lyrata
ref|NP_001043134.1|  Os01g0501800                                       330   2e-109   
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    330   2e-109   Arabis alpina [alpine rockcress]
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             330   2e-109   Eutrema salsugineum [saltwater cress]
ref|NP_001240871.1|  uncharacterized protein LOC100811386               330   2e-109   Glycine max [soybeans]
emb|CDY50981.1|  BnaC02g48890D                                          330   2e-109   Brassica napus [oilseed rape]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    329   2e-109   Camelina sativa [gold-of-pleasure]
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    328   7e-109   Pisum sativum [garden pea]
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    328   8e-109   Vitis vinifera
emb|CAN79166.1|  hypothetical protein VITISV_019248                     328   9e-109   Vitis vinifera
gb|EEC70714.1|  hypothetical protein OsI_02088                          328   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    328   1e-108   Phoenix dactylifera
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    327   2e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            325   6e-108   Solanum tuberosum [potatoes]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            326   7e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       325   8e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            324   8e-108   Solanum tuberosum [potatoes]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    325   1e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    325   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    325   2e-107   
gb|AAL08257.1|  AT5g66570/K1F13_25                                      325   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    324   3e-107   Cucumis melo [Oriental melon]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   323   5e-107   Medicago truncatula
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    323   6e-107   Brassica rapa
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    323   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    322   1e-106   Setaria italica
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    322   1e-106   Cucumis sativus [cucumbers]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           322   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    322   2e-106   Oryza brachyantha
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    322   2e-106   Phoenix dactylifera
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    322   2e-106   Elaeis guineensis
emb|CDY33308.1|  BnaA01g19750D                                          323   2e-106   Brassica napus [oilseed rape]
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    321   4e-106   
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    321   4e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    321   4e-106   Camelina sativa [gold-of-pleasure]
emb|CDY26519.1|  BnaC01g23800D                                          323   4e-106   Brassica napus [oilseed rape]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         320   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      315   1e-105   Nicotiana tabacum [American tobacco]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       320   1e-105   Genlisea aurea
gb|AEN02470.1|  oxygen-evolving enhancer protein                        319   2e-105   Camellia sinensis [black tea]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    319   3e-105   Camelina sativa [gold-of-pleasure]
gb|ADB07372.1|  chloroplast managanese stabilizing protein              317   5e-105   Capsicum annuum
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      319   1e-104   
ref|NP_001130585.1|  uncharacterized protein LOC100191684               317   2e-104   Zea mays [maize]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    314   2e-103   Fritillaria agrestis
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       314   2e-103   Triticum urartu
dbj|BAJ89638.1|  predicted protein                                      313   4e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             312   9e-103   Arabidopsis lyrata subsp. lyrata
gb|AFK43771.1|  unknown                                                 312   1e-102   Lotus japonicus
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          312   1e-102   Leymus chinensis
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          312   2e-102   Saccharum hybrid cultivar [sugarcane]
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    311   2e-102   Salicornia europaea [chicken-claws]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    311   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         311   3e-102   
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    311   3e-102   Helianthus annuus
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      305   4e-102   Solanum lycopersicum
emb|CAA29062.1|  unnamed protein product                                309   2e-101   Spinacia oleracea
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    309   2e-101   Spinacia oleracea
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    309   2e-101   
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    309   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   4e-101   
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    305   1e-99    Brachypodium distachyon [annual false brome]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    303   4e-99    Gossypium raimondii
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    303   5e-99    Triticum aestivum [Canadian hard winter wheat]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     301   2e-98    Vitis vinifera
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             298   2e-97    Eutrema salsugineum [saltwater cress]
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    296   4e-97    Morus nigra
gb|AAS55410.1|  photosystem II protein                                  293   2e-96    Brassica rapa
emb|CDX72613.1|  BnaC07g46350D                                          284   1e-91    
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    281   2e-91    Brassica napus [oilseed rape]
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        277   3e-90    Allium cepa
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    280   4e-90    
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      278   6e-89    Pinus sylvestris [Scotch pine]
emb|CDY42709.1|  BnaA03g53620D                                          275   5e-88    Brassica napus [oilseed rape]
gb|ACN40581.1|  unknown                                                 268   2e-85    Picea sitchensis
gb|ABK23365.1|  unknown                                                 268   3e-85    Picea sitchensis
gb|ABK24541.1|  unknown                                                 268   3e-85    Picea sitchensis
gb|ABR17376.1|  unknown                                                 268   3e-85    Picea sitchensis
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    250   2e-80    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   252   1e-79    Citrus sinensis [apfelsine]
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             251   1e-79    Phaseolus vulgaris [French bean]
gb|ACE98011.1|  putative protein                                        245   1e-78    Populus tremula [European aspen]
gb|AIS72812.1|  oxygen evolving activity                                244   2e-78    Rhizophora apiculata
prf||2002393A  oxygen-evolving complex protein 1                        244   5e-77 
prf||1204192A  photosystem II protein 33kD                              233   2e-72 
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     229   4e-71    Eucalyptus grandis [rose gum]
ref|XP_001756893.1|  predicted protein                                  224   2e-68    
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    216   2e-66    
gb|KJB43587.1|  hypothetical protein B456_007G208000                    215   1e-65    Gossypium raimondii
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    213   4e-65    Tarenaya hassleriana [spider flower]
gb|ABV57472.1|  chloroplast PsbO                                        207   7e-64    Phyllostachys edulis [kikko-chiku]
ref|XP_001763258.1|  predicted protein                                  211   2e-63    
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        209   2e-62    Chara braunii
ref|XP_001781590.1|  predicted protein                                  208   4e-62    
ref|NP_001140815.1|  hypothetical protein                               200   5e-60    
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    194   7e-59    Lemna minor
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             195   7e-57    Selaginella moellendorffii
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             192   7e-56    
ref|XP_001784751.1|  predicted protein                                  189   4e-55    
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             186   1e-54    
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        189   1e-54    Closterium peracerosum-strigosum-littorale complex
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    167   2e-46    Coccomyxa subellipsoidea C-169
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             166   4e-46    Ostreococcus tauri
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              164   1e-45    Chlorella variabilis
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    164   1e-45    Ostreococcus lucimarinus CCE9901
gb|ADC54902.1|  oxygen-evolving enhancer protein                        159   4e-45    Klebsormidium flaccidum
gb|ADC54897.1|  oxygen-evolving enhancer protein                        161   7e-45    Cladophora coelothrix
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      159   2e-44    Oryza sativa Indica Group [Indian rice]
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   5e-44    Solanum lycopersicum
gb|AGI15739.1|  collinsiaXIII-like protein                              156   6e-44    Collinsia rattanii
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    160   8e-44    Micromonas pusilla CCMP1545
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        159   9e-44    Oedogonium obesum
gb|AGI15740.1|  collinsiaXIII-like protein                              154   2e-43    Collinsia rattanii
gb|AGI15756.1|  collinsiaXIII-like protein                              154   3e-43    Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                              154   3e-43    Collinsia rattanii
gb|AGI15761.1|  collinsiaXIII-like protein                              154   3e-43    Collinsia linearis
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          158   3e-43    Chlamydomonas incerta
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    157   6e-43    Chlamydomonas reinhardtii
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    157   6e-43    Chlamydomonas reinhardtii
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        156   2e-42    Hafniomonas montana
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    156   3e-42    Auxenochlorella protothecoides
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                    149   3e-42    Pinus radiata
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        155   5e-42    Pyramimonas parkeae
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                    149   6e-42    Abies alba [abete-blanco]
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        153   9e-42    Nephroselmis olivacea
gb|ADC54900.1|  oxygen-evolving enhancer protein                        149   2e-41    Entransia fimbriata
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    152   7e-41    Micromonas commoda
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    150   3e-40    Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    150   3e-40    Volvox carteri
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      150   5e-40    Monoraphidium neglectum
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        149   2e-39    Tetraselmis cordiformis
gb|ADC54905.1|  oxygen-evolving enhancer protein                        143   5e-39    Ostreococcus tauri
ref|XP_007513615.1|  predicted protein                                  148   5e-39    Bathycoccus prasinos
gb|ADC54906.1|  oxygen-evolving enhancer protein                        142   1e-38    Phyllodictyon orientale
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        147   2e-38    Lepidodinium chlorophorum
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    144   3e-38    Euglena stellata
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    144   3e-38    Euglena pseudostellata
gb|ADC54893.1|  oxygen-evolving enhancer protein                        140   5e-38    Boodlea composita
emb|CCI69514.1|  oxygen-evolving enhancer protein                       141   5e-38    Scotinosphaera sp. CAUP H5307
gb|AGI15762.1|  collinsiaXIII-like protein                              140   7e-38    Collinsia linearis
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    143   7e-38    Monomorphina pyrum
gb|ADC54913.1|  oxygen-evolving enhancer protein                        139   1e-37    Valonia utricularis
emb|CCI69513.1|  oxygen-evolving enhancer protein                       137   7e-37    Chlorochytrium lemnae
gb|ADC54904.1|  oxygen-evolving enhancer protein                        137   1e-36    Nephroselmis olivacea
gb|ADC54908.1|  oxygen-evolving enhancer protein                        137   1e-36    Siphonocladus tropicus
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       141   2e-36    Gymnochlora stellata
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    138   3e-36    Cryptoglena skujai
gb|ADC54894.1|  oxygen-evolving enhancer protein                        135   5e-36    Bornetella sphaerica
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           141   6e-36    Euglena gracilis
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    140   8e-36    Euglena gracilis
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        139   8e-36    Chlorarachnion reptans
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        139   1e-35    Bryopsis plumosa
gb|ADC54903.1|  oxygen-evolving enhancer protein                        134   2e-35    Mesostigma viride
gb|AAP79149.1|  photosystem II protein PsbO                             138   2e-35    Bigelowiella natans
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    136   3e-35    Discoplastis spathirhyncha
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    135   4e-35    Euglena archaeoplastidiata
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    133   3e-34    Euglena granulata
gb|ADC54890.1|  oxygen-evolving enhancer protein                        130   4e-34    Acetabularia acetabulum
gb|ADC54901.1|  oxygen-evolving enhancer protein                        129   1e-33    Ignatius tetrasporus
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II        132   5e-33    Eutreptiella gymnastica
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                     131   1e-32    Cyanophora paradoxa
gb|ADC54912.1|  oxygen-evolving enhancer protein                        126   2e-32    Ulva intestinalis
gb|ADC54891.1|  oxygen-evolving enhancer protein                        125   4e-32    Ulvella repens
gb|ADC54907.1|  oxygen-evolving enhancer protein                        123   2e-31    Tetradesmus obliquus
gb|ADC54898.1|  oxygen-evolving enhancer protein                        121   1e-30    Codium sp. HEC 15711
gb|ADC54899.1|  oxygen-evolving enhancer protein                        120   2e-30    Derbesia sp. 2773-1
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                       123   6e-30    Porphyridium purpureum
gb|EWM24380.1|  oxygen-evolving enhancer protein                        122   7e-30    Nannochloropsis gaditana
gb|ADC54895.1|  oxygen-evolving enhancer protein                        118   1e-29    Bryopsis sp. EE4
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                       122   3e-29    Pyrenomonas helgolandii
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...    121   3e-29    Nannochloropsis gaditana CCMP526
ref|XP_002894679.1|  predicted protein                                  115   4e-29    
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...    121   5e-29    Guillardia theta
gb|ADC54909.1|  oxygen-evolving enhancer protein                        117   5e-29    Tetraselmis striata
gb|EWM24379.1|  oxygen-evolving enhancer protein                        121   5e-29    Nannochloropsis gaditana
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111              121   7e-29    Guillardia theta CCMP2712
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II    119   1e-28    Coccomyxa subellipsoidea C-169
emb|CAH25340.1|  oxygen-evolving enhancer                               119   1e-28    Guillardia theta
gb|ADC54896.1|  oxygen-evolving enhancer protein                        115   2e-28    Parachlorella kessleri
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                      115   4e-28    Oryza sativa Indica Group [Indian rice]
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                       118   6e-28    Botrydium granulatum
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...    117   9e-28    Emiliania huxleyi CCMP1516
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...    115   3e-27    Synechococcus sp. PCC 6312
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                       115   5e-27    Vaucheria frigida
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...    115   5e-27    Fischerella muscicola
gb|ABF59672.1|  photosystem II extrinsic protein O                      115   6e-27    Vaucheria litorea
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1                 113   1e-26    Chondrus crispus [carageen]
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...    114   2e-26    Nostoc sp. PCC 7107
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...    114   2e-26    Hapalosiphonaceae
ref|XP_010550781.1|  PREDICTED: oxygen-evolving enhancer protein ...    111   2e-26    Tarenaya hassleriana [spider flower]
gb|ADC54911.1|  oxygen-evolving enhancer protein                        109   3e-26    Ulva sp. EE2
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...    112   5e-26    Fischerella muscicola
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                       110   5e-26    Rhodosorus marinus
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide        112   6e-26    Tolypothrix bouteillei VB521301
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...    112   6e-26    Oscillatoria sp. PCC 10802
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...    109   7e-26    
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...    112   7e-26    cyanobacterium PCC 7702
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                       112   7e-26    Chroomonas caudata
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...    112   8e-26    Fischerella sp. PCC 9605
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...    112   9e-26    Nostoc
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...    111   9e-26    Gloeocapsa sp. PCC 7428
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...    111   1e-25    Cyanobacteria [blue-green bacteria]
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...    111   1e-25    
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...    111   1e-25    Neosynechococcus sphagnicola
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...    110   2e-25    
ref|WP_017286598.1|  hypothetical protein                               110   2e-25    
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...    110   2e-25    
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...    110   3e-25    
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                       110   4e-25    
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                       110   4e-25    
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...    109   5e-25    
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...    109   5e-25    
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...    109   5e-25    
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...    109   6e-25    
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...    109   6e-25    
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...    109   6e-25    
gb|ADC54910.1|  oxygen-evolving enhancer protein                        105   7e-25    
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...    109   7e-25    
gb|KEI69285.1|  PsbO                                                    109   7e-25    
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...    109   8e-25    
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                       110   8e-25    
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...    109   8e-25    
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                    109   8e-25    
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...    108   1e-24    
ref|XP_005536430.1|  manganese-stabilzing protein precursor             109   1e-24    
gb|AFK37254.1|  unknown                                                 103   1e-24    
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...    108   1e-24    
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor            108   2e-24    
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...    108   2e-24    
gb|ACU65446.1|  putative oxygen-evolving enhancer                       103   2e-24    
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...    108   2e-24    
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor           107   4e-24    
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...    107   4e-24    
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...    107   4e-24    
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...    107   4e-24    
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...    107   4e-24    
gb|ADC54892.1|  oxygen-evolving enhancer protein                        103   4e-24    
ref|XP_005706438.1|  photosystem II PsbO protein                        107   5e-24    
ref|WP_010997995.1|  manganese-stabilzing protein                       107   5e-24    
dbj|BAG85210.1|  extrinsic protein in photosystem II                    106   9e-24    
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...    106   9e-24    
gb|ACU65447.1|  putative oxygen-evolving enhancer                       100   1e-23    
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor            106   1e-23    
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...    105   1e-23    
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor       106   1e-23    
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...    105   1e-23    
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                       105   2e-23    
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...    104   3e-23    
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...    103   4e-23    
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...    103   4e-23    
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...    103   4e-23    
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...    104   4e-23    
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...    104   5e-23    
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...    104   5e-23    
gb|AAN11311.1|  oxygen-evolving enhancer 1                              104   5e-23    
gb|ACU19823.1|  unknown                                                 102   5e-23    
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...    104   5e-23    
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...    104   5e-23    
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...    103   6e-23    
gb|ABK95838.1|  unknown                                                 101   1e-22    
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...    102   1e-22    
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...    102   1e-22    
ref|WP_019500685.1|  hypothetical protein                               102   2e-22    
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...    102   2e-22    
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...    102   2e-22    
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...    102   2e-22    
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II        102   2e-22    
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein            102   3e-22    
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...    102   3e-22    
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...    101   4e-22    
gb|ACJ84218.1|  unknown                                               99.4    4e-22    
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...    101   5e-22    
gb|KIY92168.1|  Oxygen-evolving enhancer protein 1,chloroplastic      98.6    7e-22    
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...    100   9e-22    
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...    100   9e-22    
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678              100   2e-21    
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...    100   2e-21    
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                     100   2e-21    
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                    100   2e-21    
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...  99.4    3e-21    
gb|ABQ85434.1|  33 kDa OEC protein                                    97.1    3e-21    
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...  99.0    4e-21    
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...  98.6    5e-21    
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide      98.6    6e-21    
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...  98.2    7e-21    
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...  98.2    8e-21    
gb|AFK46831.1|  unknown                                               95.9    9e-21    
ref|WP_016922728.1|  hypothetical protein                             98.2    9e-21    
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...  97.8    9e-21    
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...  97.8    1e-20    
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)  97.8    1e-20    
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide      97.4    2e-20    
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...  97.4    2e-20    
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...  97.4    2e-20    
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...  97.1    2e-20    
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...  97.1    2e-20    
ref|WP_017662186.1|  hypothetical protein                             96.7    2e-20    
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  96.3    3e-20    
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   96.3    3e-20    
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...  96.3    4e-20    
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO     95.9    5e-20    
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...  95.9    5e-20    
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...  95.5    6e-20    
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...  95.5    6e-20    
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...  95.5    7e-20    
gb|AAF13997.1|  photosystem II manganese stabilizing protein          95.5    7e-20    
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...  95.1    8e-20    
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...  94.7    1e-19    
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...  94.7    1e-19    
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...  94.7    1e-19    
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...  94.4    2e-19    
gb|EJK75097.1|  hypothetical protein THAOC_03193                      94.0    2e-19    
ref|WP_018399127.1|  hypothetical protein                             93.6    3e-19    
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...  92.8    5e-19    
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        92.8    6e-19    
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...  92.4    7e-19    
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...  92.4    7e-19    
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...  92.4    7e-19    
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  92.4    8e-19    
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     92.4    9e-19    
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  92.8    9e-19    
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  92.4    9e-19    
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...  92.0    1e-18    
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     92.0    1e-18    
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...  91.3    2e-18    
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...  91.3    2e-18    
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor     91.3    2e-18    
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     90.9    3e-18    
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  90.9    3e-18    
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        90.9    3e-18    
gb|ADE06500.1|  oxygen-evolving enhancer                              85.9    3e-18    
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            90.5    3e-18    
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...  90.5    4e-18    
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...  90.5    4e-18    
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...  90.5    4e-18    
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  90.1    5e-18    
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...  89.7    6e-18    
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  89.7    6e-18    
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)   89.0    7e-18    
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...  89.4    8e-18    
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  89.7    9e-18    
emb|CBN78902.1|  manganese stabilising protein                        89.7    1e-17    
ref|WP_019506429.1|  hypothetical protein                             89.0    1e-17    
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     89.0    2e-17    
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  88.6    2e-17    
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...  87.8    3e-17    
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...  87.8    3e-17    
ref|WP_035985606.1|  hypothetical protein                             87.8    3e-17    
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  87.4    4e-17    
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  87.0    5e-17    
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  86.7    8e-17    
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...  86.3    1e-16    
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  86.3    1e-16    
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...  86.3    1e-16    
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...  85.9    1e-16    
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...  85.9    2e-16    
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     85.5    2e-16    
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  85.5    2e-16    
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...  85.5    2e-16    
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...  85.5    2e-16    
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...  84.7    3e-16    
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...  84.7    3e-16    
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...  84.7    4e-16    
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...  84.3    4e-16    
gb|ABO47876.1|  plastid oxygen-evolving enhancer 1-2 precursor        84.3    5e-16    
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...  84.0    6e-16    
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     83.2    1e-15    
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  83.2    1e-15    
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  83.2    1e-15    
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  82.8    2e-15    
gb|AAR20846.1|  oxygen-evolving enhancer protein 1                    81.3    2e-15    
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...  82.4    2e-15    
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    82.4    2e-15    
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  82.0    3e-15    
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...  82.0    3e-15    
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  81.6    3e-15    
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...  81.6    3e-15    
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  81.3    5e-15    
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  81.3    6e-15    
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  80.9    6e-15    
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  80.9    7e-15    
gb|ABH09263.1|  photosystem II manganese-stabilizing protein          80.5    9e-15    
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...  80.5    9e-15    
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...  79.3    1e-14    
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     79.7    1e-14    
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  79.0    3e-14    
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...  79.0    3e-14    
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...  78.6    4e-14    
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...  78.6    5e-14    
ref|WP_006529097.1|  Manganese-stabilising protein / photosystem ...  77.8    7e-14    
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...  77.8    9e-14    
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...  77.4    1e-13    
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  77.4    1e-13    
gb|AIR09396.1|  psbO                                                  75.1    2e-13    
emb|CCH65457.1|  Photosystem II manganese-stabilizing protein (PsbO)  75.9    2e-13    
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...  75.9    3e-13    
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide      75.1    7e-13    
gb|AHF62713.1|  photosystem II manganese-stabilizing polypeptide      75.1    7e-13    
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...  74.7    8e-13    
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...  74.3    1e-12    
ref|WP_017293645.1|  hypothetical protein                             73.9    2e-12    
sp|P83504.1|PSBO_BRACM  RecName: Full=Oxygen-evolving enhancer pr...  64.7    8e-11    
sp|P84989.1|PSBO_POPEU  RecName: Full=Oxygen-evolving enhancer pr...  66.2    8e-11    
gb|ADJ93800.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  67.4    1e-10    
gb|ACN35184.1|  unknown                                               66.2    3e-10    
gb|ACF95815.1|  oxygen evolving enhancer protein 1                    66.2    3e-10    
emb|CDX73783.1|  BnaC08g22200D                                        60.8    1e-08    
gb|ACF28703.1|  oxygen evolving complex protein variant               60.8    2e-08    
ref|WP_026032523.1|  Photosystem II manganese-stabilizing polypep...  62.0    3e-08    
ref|WP_019474069.1|  MULTISPECIES: Photosystem II manganese-stabi...  62.0    3e-08    
ref|WP_041484654.1|  Photosystem II manganese-stabilizing polypep...  61.2    5e-08    
gb|ABO16873.1|  Photosystem II manganese-stabilizing protein          61.6    6e-08    
ref|WP_026032868.1|  Photosystem II manganese-stabilizing polypep...  61.2    6e-08    
ref|WP_042849726.1|  Photosystem II manganese-stabilizing polypep...  60.8    7e-08    
ref|WP_025979193.1|  MULTISPECIES: Photosystem II manganese-stabi...  60.8    7e-08    
ref|WP_025952314.1|  Photosystem II manganese-stabilizing polypep...  60.8    7e-08    
ref|WP_025890347.1|  MULTISPECIES: Photosystem II manganese-stabi...  60.8    8e-08    
ref|WP_025937984.1|  Photosystem II manganese-stabilizing polypep...  60.8    8e-08    
ref|WP_002806175.1|  photosystem II manganese-stabilizing protein     60.8    8e-08    
ref|WP_025925905.1|  Photosystem II manganese-stabilizing polypep...  60.8    8e-08    
gb|ABM69537.1|  Photosystem II manganese-stabilizing protein          60.8    8e-08    
gb|ABV49867.1|  Photosystem II manganese-stabilizing protein          60.8    9e-08    
gb|ACF28689.1|  oxygen evolving complex protein variant               58.5    1e-07    
gb|ACF28695.1|  oxygen evolving complex protein variant               58.5    1e-07    
ref|WP_025906083.1|  Photosystem II manganese-stabilizing polypep...  60.5    1e-07    



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   361 bits (926),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
             F+DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 193/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   357 bits (915),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 192/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   355 bits (910),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MATSLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   355 bits (910),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV         RS Q+V KA GV+P+ A++TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   354 bits (908),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAVSLQAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   354 bits (908),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTIKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   353 bits (907),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV         R  Q+V KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   353 bits (907),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 188/211 (89%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+P       RS Q+V KA GVD +  RITCSLQS  K++A 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++FAFKPGKY AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   353 bits (907),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV         RS Q++ KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 188/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  RI    RS Q V KA G++PS ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            + FA KPGKY+AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+
Sbjct  121  DKFAIKPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVA  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 192/210 (91%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQPTKVGV+ R     RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  QDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTIKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   351 bits (901),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 189/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTIKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   351 bits (900),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 188/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P  AR+TCSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY AKKFCLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 187/211 (89%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV         RS Q V KA GV+P+ AR+ CS QS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAVKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   350 bits (897),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = +2

Query  59   ASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  238
            +SLQ AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAA
Sbjct  4    SSLQAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAA  63

Query  239  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  418
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  64   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  123

Query  419  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  598
            K GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPF VS DG+V
Sbjct  124  KAGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFVVSEDGTV  183

Query  599  KFEEKDGIDYAAVTVQLPGGERVPF  673
            KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  184  KFEEKDGIDYAAVTVQLPGGERVPF  208



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  TEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            + DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  APDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            + DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  APDGTIKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            + DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  APDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 186/211 (88%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+P       RS+Q+V KA G D +  RITCSLQ   K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DA K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCADATKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++FAFKPGKY AKKFCLEPTSFTVKAE V+KN+PPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   348 bits (892),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K+LAH 
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   347 bits (890),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD+IEGPFEV
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDQIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            + DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  APDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   347 bits (889),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 188/211 (89%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVG   R     RS Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTLKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   346 bits (888),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAASLQ AATLMQPTKVGV   +  RS Q+V KA GV+    R+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCT  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS D
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   346 bits (887),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 187/208 (90%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAASLQ AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCT  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS D
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   345 bits (884),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++TCSLQ  +KE A    D
Sbjct  1    MAASLQAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVD  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            AFKPGKY+A+K CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDG
Sbjct  121  AFKPGKYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVTSDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 190/212 (90%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR-IG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQP+KVGV  R IG    RS   + +A G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
            H  SDAAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   HKCSDAAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY+AKKFCLEPTSFTVKAE VSKNAP EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPDGAVKFEEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   344 bits (883),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 187/210 (89%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV+ R G   RS Q+V KA G + S AR+TCSLQS +K+ A  
Sbjct  1    MAASLQAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+
Sbjct  61   CVDASKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGI  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++F FK GKY+ KKFCLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFGFKSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 187/211 (89%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVG   R     R  Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTLKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   344 bits (882),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGNIKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   343 bits (881),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 190/210 (90%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGTIKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 187/212 (88%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQPTKVG  P        RS Q+V KA G++P+ ARITCSLQS +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            G++ F+FK GKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GLDKFSFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            V  DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VGPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  212



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   341 bits (874),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 189/210 (90%), Gaps = 4/210 (2%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            AASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A  
Sbjct  1    AASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTK+G + R G   RS   + KA G +PS AR+TCS+Q  ++ELAH 
Sbjct  1    MAASLQAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV
Sbjct  61   CVDATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            + FAFKPGKY+ KKFCLEPTSFTVKAES++KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DKFAFKPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 189/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFAFKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   339 bits (869),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 184/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQT--VGKALGVDPSPA-RITCSLQSQIKELAHN  223
            MAAS+Q AATLMQPTK+GV  R     ++  V KA G++P+ + R+TCSLQ+ +KE AH 
Sbjct  1    MAASMQAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG 
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E FAFKPGKY AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  EAFAFKPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQP KVGV  R G   RS Q V +A G++P+ ARITCS Q+  K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+ KK CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFVEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   338 bits (868),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 183/211 (87%), Gaps = 9/211 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATL     +GV P       RS   V KA GV+PS AR+TCSLQ+  K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQ  55

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  115

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PPEFQ TKLMTRLTYTLDEIEGPFEV
Sbjct  116  VETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLDEIEGPFEV  175

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  176  SSDGNVKFEEKDGIDYAAVTVQLPGGERVPF  206



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 190/211 (90%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATLMQPTKVG V+ R     RS Q++ KA G++PS ++++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQ  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            V++F+FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEV
Sbjct  121  VDSFSFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   338 bits (868),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 185/212 (87%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQP KVG T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
            H  +DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   HKCADATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY  KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS +GSV FEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPNGSVTFEEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   335 bits (859),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATL QPTKVGV  + G   RS  TV K  G DPS AR+TCSLQS +KELA  
Sbjct  1    MAASLQAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK GKY+ KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  PDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   336 bits (862),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQP KVGV PR   + RS   + KA GV+ S AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            + FAFKPGKY AKK CLEPTSFTVKAE  +KN+PPEFQ TKLMTRLTYTLDEIEGPFEV+
Sbjct  121  DKFAFKPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLDEIEGPFEVN  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG++KF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TDGTIKFVEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TVKFEEKDGIDYAAVTVQLPGGERVPF  207



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 185/210 (88%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQPTKVGV+ R     RS Q V ++ G +P+ +R+TCSLQS +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG 
Sbjct  61   CTDAAKIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+P EFQ TKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  QDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   336 bits (862),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 187/212 (88%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+CSL + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS DG++KF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPDGTIKFVEKDGIDYAAVTVQLPGGERVPF  212



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = +2

Query  74   AATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  250
            AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2    AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  251  FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  430
            FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62   FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  431  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  610
            Y+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEE
Sbjct  122  YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEE  181

Query  611  KDGIDYAAVTVQLPGGERVPF  673
            KDGIDYAAVTVQLPGGERVPF
Sbjct  182  KDGIDYAAVTVQLPGGERVPF  202



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   335 bits (859),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 187/212 (88%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+C+L + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS DG++KF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPDGTIKFVEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKV-GVTPRIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASL +AAT +QPTK+   T R G  RS  +V K  G++ S AR+TCS+QS +++ A  
Sbjct  1    MAASLHSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CTDAAKIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   334 bits (857),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D SPAR+TCSL S  K+    
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGSVKFKEEDGIDYAAVTVQLPGGERVPF  210



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   333 bits (855),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   333 bits (855),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 186/209 (89%), Gaps = 2/209 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVG-VTPRIGRSYQTVGKALGVD-PSPARITCSLQSQIKELAHNF  226
            MAASLQ AATLMQPTKVG ++    RS Q V K  G++  + +R+TCSLQ+ +K+LA   
Sbjct  1    MAASLQAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKC  60

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
            +DA K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG++
Sbjct  61   ADATKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLD  120

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
            +FAFKPGKY+AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS 
Sbjct  121  SFAFKPGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSP  180

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  DGTVKFEEKDGIDYAAVTVQLPGGERVPF  209



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   333 bits (854),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++ CSL+  +K+ A    D
Sbjct  1    MAASLQAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVD  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            AFK GKY A+K CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG
Sbjct  121  AFKAGKYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 183/211 (87%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SEIFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV+F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVQFKEEDGIDYAAVTVQLPGGERVPF  211



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  TVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAASLQ AAT MQPTK+G T  +  +S Q++ KA G++P+ A+I+CSL + +K+ A    
Sbjct  1    MAASLQAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCV  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSD
Sbjct  121  FAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   333 bits (853),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 186/224 (83%), Gaps = 4/224 (2%)
 Frame = +2

Query  14   REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  181
            R++ EL+      MAASLQ+AAT  Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3    RKKLELSERHSVAMAASLQSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARL  62

Query  182  TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  361
            TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63   TCSYQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  362  SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
            +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123  TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  542  TYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            T TLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  183  TCTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  226



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 181/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 182/210 (87%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             S+AAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSEAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121  ETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGSVKFKEEDGIDYAAVTVQLPGGERVPF  210



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 181/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +   K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 186/213 (87%), Gaps = 8/213 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  214
            MAASLQTAATL   TKVG+  R G      RS Q V KA GV+P+ AR+TCSLQS  K+L
Sbjct  1    MAASLQTAATLT--TKVGMPARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKDL  58

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
            A    DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+
Sbjct  59   AQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTID  118

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
            GGV++FAFK GKY+ KK CLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPF
Sbjct  119  GGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPF  178

Query  575  EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EV++DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  179  EVANDGTVKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   333 bits (854),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 186/229 (81%), Gaps = 5/229 (2%)
 Frame = +2

Query  2    IGTHREREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDP  166
            + T  +   L L+    MA SL  AAT +QP K+  +    R     S QTVGK+ G++ 
Sbjct  27   LSTQHKHRHLRLVCLVVMATSLHAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLES  86

Query  167  SPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTY  346
            S AR+TCSLQS +K+ A   SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTY
Sbjct  87   SSARLTCSLQSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTY  146

Query  347  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
            MEVKG+GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTK
Sbjct  147  MEVKGTGTANQCPTIDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTK  206

Query  527  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            LMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  207  LMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  255



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   331 bits (849),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 181/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+  TP  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   331 bits (849),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 180/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121  ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGSVKFKEEDGIDYAAVTVQLPGGERVPF  210



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   331 bits (848),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 187/209 (89%), Gaps = 2/209 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNF  226
            MAASLQ AAT MQPTK+  +  +  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH  
Sbjct  1    MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKC  60

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG++
Sbjct  61   VDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLD  120

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
            +FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSS
Sbjct  121  SFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSS  180

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  DGTVKFEEKDGIDYAAVTVQLPGGERVPF  209



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   328 bits (842),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SD +VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDRTVKFIEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   330 bits (847),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q+VGK+ G+D S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  217
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
            +  +DAAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VSSDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSSDGTIKFEEKDGIDYAAVTVQLPGGERVPF  212



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCSDAVKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S+DGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SADGSVKFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 180/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ A T +QP K+  +P      RS QTV K+ G++ SPAR+TCSL S  K+ A  
Sbjct  1    MATSLQAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGSVKFKEEDGIDYAAVTVQLPGGERVPF  210



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 184/208 (88%), Gaps = 5/208 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  229
            MA+SLQ AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   
Sbjct  1    MASSLQAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCV  56

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+
Sbjct  57   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLES  116

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFK GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD
Sbjct  117  FAFKQGKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  176

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  177  GTVKFEEKDGIDYAAVTVQLPGGERVPF  204



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 181/211 (86%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  SSDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 180/211 (85%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   328 bits (841),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVE  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            +FKPGKY+AKK CLEPTSFTVK+E V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS+DG
Sbjct  121  SFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   328 bits (841),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SD +VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDRTVKFIEKDGIDYAAVTVQLPGGERVPF  210



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   328 bits (840),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 181/210 (86%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVS  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SD +VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDRTVKFIEKDGIDYAAVTVQLPGGERVPF  210



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 181/212 (85%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  217
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
            +  +DAAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VSSDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSSDGTIKFEEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 180/212 (85%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQP KV  T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               +DA KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV+ FAFKPGKY  KK CLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDEFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS  G+V F EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPSGTVNFVEKDGIDYAAVTVQLPGGERVPF  212



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKYS KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   325 bits (832),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPF  673
            DGIDYAAVTVQLPGGERVPF
Sbjct  181  DGIDYAAVTVQLPGGERVPF  200



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   326 bits (835),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   325 bits (834),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   324 bits (831),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPF  673
            DGIDYAAVTVQLPGGERVPF
Sbjct  181  DGIDYAAVTVQLPGGERVPF  200



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAASLQ + T +QPTKV     +  RS   V KA GV+P+  R+  SLQS +KELA+   
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCV  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DA KLAG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ 
Sbjct  61   DATKLAGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDT  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFK GKY+AKKFCLEPT F VKAE VSKNAPP+FQNTKLMTRLTYTLDE+EGPFEVSSD
Sbjct  121  FAFKAGKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLDEMEGPFEVSSD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   325 bits (833),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 177/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K    
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVE  60

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            A K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSF  120

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
            AFK GKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG
Sbjct  121  AFKAGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSPDG  180

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SVKFEEKDGIDYAAVTVQLPGGERVPF  207



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   325 bits (832),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 178/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 186/210 (89%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQ-TAATLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAAS+  TAATLMQP+K+    T    RS Q++ KA G++ + AR+TCSL S +K+++  
Sbjct  1    MAASVHATAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
            F+DAAK+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   FADAAKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK GKY AKKFCLEPTSFTVKAE VSKN+PPEFQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  121  DSFAFKAGKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLDEIEGPFEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DGS+KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  ADGSIKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   323 bits (829),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 185/211 (88%), Gaps = 8/211 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MA SLQ AATLMQPTK+G+  R      +S Q++ KA G++ + A++TCSLQ    ++AH
Sbjct  1    MAVSLQAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAH  56

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
             F+D+AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG
Sbjct  57   RFADSAKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGG  116

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             ++F+FK GKY+AKKFCLEPTSFTVK+E ++KN+P +FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  117  SDSFSFKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLDEIEGPFEV  176

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  177  SPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   323 bits (829),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  212



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  119

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  120  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  179

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  180  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  210



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 175/210 (83%), Gaps = 3/210 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQP K+G         R    V +A GVD    RI+CSLQS ++E+A  
Sbjct  1    MAASLQAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CIDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV 
Sbjct  121  DSFPFKAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVG  180

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  SDGTLKFEEKDGIDYAAVTVQLPGGERVPF  210



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 177/200 (89%), Gaps = 2/200 (1%)
 Frame = +2

Query  80   TLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            TLMQP+K+    T    RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11   TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71   ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
             AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV +DGS+KFEEK
Sbjct  131  QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVGADGSIKFEEK  190

Query  614  DGIDYAAVTVQLPGGERVPF  673
            DGIDYAAVTVQLPGGERVPF
Sbjct  191  DGIDYAAVTVQLPGGERVPF  210



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 177/211 (84%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPG ERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGCERVPF  211



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 179/212 (84%), Gaps = 6/212 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQP K+G  P        R    V +A GVD +  R++CSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVA  59

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++G
Sbjct  60   SKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDG  119

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV+ F FK GKY+ KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  120  GVDTFPFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  179

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS+DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  VSADGNIKFEEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR--IG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AA LMQP K+G T R   G   R++  + KA G +P+ A +TCSLQ+ +++LA
Sbjct  1    MAASLQAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               +DA KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   LKCADATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY  K+FCLEPTSFTVKAE ++KN+P EFQ TKLMTRLTYTLDEIEGPFE
Sbjct  121  GVDSFAFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VS DG+V+F+EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  VSPDGAVRFQEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 180/211 (85%), Gaps = 5/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  217
            MAASLQ AATLMQP+ VG T R   G+  +T   + K  G +P+ AR+TCSLQ+ +++L 
Sbjct  1    MAASLQAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLV  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               +DA KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++FAFKPGKY  KKFCLEPTSFTVKAESV+KNAPPEFQ TKLMT LTYTLDEIEGP E
Sbjct  121  GVDSFAFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLDEIEGPLE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            VS DG+VKFEEKDGIDYAAVTV+LPGGERVP
Sbjct  181  VSPDGTVKFEEKDGIDYAAVTVRLPGGERVP  211



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  212



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 11/211 (5%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ AATL     +GV P       RS Q+V KA GV+P+  R+TCSLQ   K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQ  55

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDAAK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  113

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PP FQ TKLMTRLTYTLDEIEGP EV
Sbjct  114  FETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLDEIEGPLEV  173

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  174  SSDGNVKFEEKDGIDYAAVTVQLPGGERVPF  204



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 178/215 (83%), Gaps = 8/215 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG--------RSYQTVGKALGVDPSPARITCSLQSQIK  208
            MA SLQ AAT +QP K+  +            RS QTV K+ G++ S AR TCSLQS +K
Sbjct  1    MATSLQAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLK  60

Query  209  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  388
            + A   S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPT
Sbjct  61   DFAGKCSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPT  120

Query  389  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  568
            I+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEG
Sbjct  121  IDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEG  180

Query  569  PFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            PFEV SDGSVKF+E DGIDYAAVTVQLPGGERVPF
Sbjct  181  PFEVGSDGSVKFKEADGIDYAAVTVQLPGGERVPF  215



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   321 bits (823),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 179/213 (84%), Gaps = 6/213 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  214
            MA SLQ AAT +QP K+  +          RS QT+GK+ G++ S AR+TCSL S +K+ 
Sbjct  1    MATSLQAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDF  60

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
            A   S+ AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AGKCSEVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
            GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPF
Sbjct  121  GGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPF  180

Query  575  EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EV  DGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  EVGPDGSVKFKEEDGIDYAAVTVQLPGGERVPF  213



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFV  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            VSSDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  VSSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  212



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   320 bits (820),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 176/211 (83%), Gaps = 4/211 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +SDGSV F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  ASDGSVNFKEEDGIDYAAVTVQLPGGERVPF  211



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   315 bits (806),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +2

Query  125  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            SV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPG
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPG  179



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   320 bits (820),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MA S+Q  ATLMQP ++  T  +  RS    GK+LG++    R TCSL + +K+LA   +
Sbjct  1    MATSMQAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLA  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DAAK+AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DAAKIAGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFK GKY+AKK CLEPTSFTVKAE V+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSD
Sbjct  121  FAFKAGKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            GSVKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GSVKFVEKDGIDYAAVTVQLPGGERVPF  208



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   319 bits (818),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 183/213 (86%), Gaps = 7/213 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPR-----IGRSYQTVGKALGVDPS-PARITCSLQSQIKEL  214
            MAASLQ AAT+MQPTKVGV  R     + RS Q+V K  GV+ +  AR+TCS+ +  K+L
Sbjct  1    MAASLQAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDL  59

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
            A   + AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIE
Sbjct  60   AQKCAVAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIE  119

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
            GGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNA PEFQ TKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLDEIEGPF  179

Query  575  EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EVS DGSVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  EVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 178/212 (84%), Gaps = 5/212 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MA SL  AAT +QP K+  +    R     S QTVGK+ G++ S  R+TCSL S +KE A
Sbjct  1    MATSLHAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFA  60

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
               S++AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSESAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            G E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFE  180

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            V SDGSVKF+E+DGIDYAAVTVQLPGGERVPF
Sbjct  181  VGSDGSVKFKEEDGIDYAAVTVQLPGGERVPF  212



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   317 bits (811),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 4/200 (2%)
 Frame = +2

Query  86   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  253
            MQPTK+G V+ R     RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  254  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  433
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  434  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  613
            +AKK CLEPTSFTVKAE V+KN+ PEFQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  614  DGIDYAAVTVQLPGGERVPF  673
            DGIDYAAVTVQLPGGERVPF
Sbjct  181  DGIDYAAVTVQLPGGERVPF  200



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 179/215 (83%), Gaps = 7/215 (3%)
 Frame = +2

Query  50   TMAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIK  208
            TMAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++
Sbjct  38   TMAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVR  97

Query  209  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  388
            ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPT
Sbjct  98   DVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPT  157

Query  389  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  568
            I+GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEG
Sbjct  158  IDGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  217

Query  569  PFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            P EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  218  PLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPF  252



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 178/214 (83%), Gaps = 7/214 (3%)
 Frame = +2

Query  53   MAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKE  211
            MAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS +++
Sbjct  1    MAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRD  60

Query  212  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
            +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  61   VASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTI  120

Query  392  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
            +GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP
Sbjct  121  DGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGP  180

Query  572  FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  LEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPF  214



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNF  226
            MA+SLQ AATL+ P KVG   R   RS   + KA G D S A R+TCS+ S ++++A   
Sbjct  1    MASSLQAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKC  59

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
            +DAAKLAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E
Sbjct  60   TDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTE  119

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
            +F +K GKY+ KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGPFEV+ 
Sbjct  120  SFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAP  179

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  DGTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 174/207 (84%), Gaps = 2/207 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            ++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  179  TLKFEEKDGIDYAAVTVQLPGGERVPF  205



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 174/207 (84%), Gaps = 2/207 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCAD  58

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            ++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  179  TLKFEEKDGIDYAAVTVQLPGGERVPF  205



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   312 bits (800),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 171/208 (82%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQ-TVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAA LQ A T +QP +V   PR     +  V K  GV+P  +R++CSL   +K L   F 
Sbjct  1    MAAFLQAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFV  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            D  K+AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  61   DTTKIAGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLES  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  121  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GKVKFLEKDGIDYAAVTVQLPGGERVPF  208



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 179/214 (84%), Gaps = 11/214 (5%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSY-------QTVGKALGVDPSPARITCSLQSQIKE  211
            MA SLQ AATLMQPTKV        S        Q++ KA G++ + A++TC+LQ    +
Sbjct  1    MATSLQAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----D  56

Query  212  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
             A+  ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI
Sbjct  57   FANKCAETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTI  116

Query  392  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
            EGGV++FAFK GKYSAKK CLEPTSFTVKAE V+KN+P +FQNTKLMTRLTYTLDEIEGP
Sbjct  117  EGGVDSFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLDEIEGP  176

Query  572  FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            FEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  177  FEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPF  210



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 174/207 (84%), Gaps = 2/207 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   ++
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAE  58

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADG  178

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            ++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  179  TLKFEEKDGIDYAAVTVQLPGGERVPF  205



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 173/216 (80%), Gaps = 14/216 (6%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRS---------YQTVGKALGVDPSPARITCSLQSQI  205
            MAASLQ AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDF  55

Query  206  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  385
            + +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCP
Sbjct  56   RGVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCP  115

Query  386  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIE  565
            T +GGVE F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIE
Sbjct  116  TTDGGVEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIE  175

Query  566  GPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            GP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  176  GPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPF  211



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MA SLQ + T +QPTKV     +  RS   V KA GVDP+  R++ SLQS +K+LA    
Sbjct  1    MATSLQASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCV  60

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DA KLAG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+
Sbjct  61   DATKLAGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLES  120

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            F FK GKY+AKKFCLEPT FTVKAE +SKNAPP+FQ+TKLMTRLTYTLDE+EGPFEVSSD
Sbjct  121  FGFKAGKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLDEMEGPFEVSSD  180

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  181  GTVKFEEKDGIDYAAVTVQLPGGERVPF  208



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 170/207 (82%), Gaps = 11/207 (5%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AAT +  +K+   P  G   ++           +RITCS+QS +K+ A   SD
Sbjct  1    MAASLQAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSD  49

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
             AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  50   TAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETF  109

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             FK G+YS KKFC EPTSFTVKAE +SKNAPPEFQNTKLMTRLTYTLDEIEGPF+VSSDG
Sbjct  110  EFKAGQYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLDEIEGPFDVSSDG  169

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  170  TVKFVEKDGIDYAAVTVQLPGGERVPF  196



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 174/217 (80%), Gaps = 19/217 (9%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGR----------SYQTVGKALGVDPSPARITCSLQSQ  202
            MAASLQ AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ--  53

Query  203  IKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQC  382
              ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQC
Sbjct  54   --DVASRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQC  111

Query  383  PTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEI  562
            PTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEI
Sbjct  112  PTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEI  171

Query  563  EGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  172  EGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPF  208



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 178/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            MAASLQ AAT M PT      R+  +S  ++ KA G++ + ++++CSLQ+ +K+ A   +
Sbjct  1    MAASLQAAATFMTPTS-----RVQLKSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCT  55

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  
Sbjct  56   DAAKIAGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNG  115

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FA KPGKY+A+KFCLEPTSFTVKAE +SKN+ PEFQ TKLMTRLTYTLDEIEGP EVSSD
Sbjct  116  FAVKPGKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLDEIEGPLEVSSD  175

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  176  GTIKFEEKDGIDYAAVTVQLPGGERVPF  203



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   305 bits (782),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = +2

Query  125  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKAE
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
             VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPG
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPG  179



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 177/210 (84%), Gaps = 4/210 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  223
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  SDGTVKFEEKDGIDYAAVTVQLPGGERVPF  209



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 177/210 (84%), Gaps = 4/210 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  223
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVS  179

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  SDGTVKFEEKDGIDYAAVTVQLPGGERVPF  209



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 178/212 (84%), Gaps = 6/212 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            V+SDG VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  180  VASDGKVKFIEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 178/212 (84%), Gaps = 6/212 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  217
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  218  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  397
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  398  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  577
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFE
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFE  179

Query  578  VSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            V+SDG VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  180  VASDGKVKFIEKDGIDYAAVTVQLPGGERVPF  211



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 179/213 (84%), Gaps = 7/213 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  214
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  575  EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EV+SDG VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  180  EVASDGKVKFIEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 179/213 (84%), Gaps = 7/213 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  214
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPF  574
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPF
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPF  179

Query  575  EVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            EV+SDG VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  180  EVASDGKVKFIEKDGIDYAAVTVQLPGGERVPF  212



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 175/215 (81%), Gaps = 16/215 (7%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPAR--------ITCSLQSQIK  208
            MAASLQ AATLMQP K+G   R   S   V     + PS AR        I+CSL S ++
Sbjct  1    MAASLQAAATLMQPAKMG---RSASSSSAV-----LLPSSARPSSHAARTISCSLTSDLR  52

Query  209  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  388
            E+A   +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT
Sbjct  53   EVATKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPT  112

Query  389  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEG  568
            I+GGV+ F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEG
Sbjct  113  IDGGVDAFPFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEG  172

Query  569  PFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            P EV++DG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  173  PLEVAADGTLKFEEKDGIDYAAVTVQLPGGERVPF  207



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 170/210 (81%), Gaps = 19/210 (9%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFKPGKY AKKFCLEPTSFTV                KLMTRLTYTLDEIEGPFEVS
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTV----------------KLMTRLTYTLDEIEGPFEVS  164

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            +DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  165  TDGTVKFEEKDGIDYAAVTVQLPGGERVPF  194



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  232
            MAASLQ AAT+M P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  233  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  412
            AAK+AGFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  413  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  592
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV    
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRR  178

Query  593  SVKFEEKDGIDYAAVTVQLPGGERVPF  673
            ++KFEEKDGIDYAAVTVQLPGGERV F
Sbjct  179  TLKFEEKDGIDYAAVTVQLPGGERVAF  205



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 167/210 (80%), Gaps = 23/210 (11%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K L   
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
                                GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   --------------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  100

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  583
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS
Sbjct  101  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  160

Query  584  SDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            SDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  161  SDGTVKFEEKDGIDYAAVTVQLPGGERVPF  190



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 169/208 (81%), Gaps = 3/208 (1%)
 Frame = +2

Query  53   MAASLQTAATLMQ-PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            M ASLQ A T +  P++     R    +Q V K+ GV+   +R+ CSL   +K LA    
Sbjct  1    MVASLQAAVTTVALPSRAAANLR--PPFQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCV  58

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            +  K+AG ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++
Sbjct  59   ETTKIAGLALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDS  118

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  119  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  178

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G VKF EKDGIDYAAVTVQLPGGERVPF
Sbjct  179  GKVKFIEKDGIDYAAVTVQLPGGERVPF  206



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  173  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  352
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  353  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKAESV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTYTLDEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  128  TRLTYTLDEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPF  174



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 166/204 (81%), Gaps = 4/204 (2%)
 Frame = +2

Query  14   REREELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARI  181
            R++ EL+      MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+
Sbjct  3    RKKLELSERHSVAMAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARL  62

Query  182  TCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG  361
            TCS QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG
Sbjct  63   TCSFQSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKG  122

Query  362  SGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
            +GTANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRL
Sbjct  123  TGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRL  182

Query  542  TYTLDEIEGPFEVSSDGSVKFEEK  613
            TYTLDEIEGPFEVSSDG  + +E+
Sbjct  183  TYTLDEIEGPFEVSSDGKRELQER  206



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 166/208 (80%), Gaps = 14/208 (7%)
 Frame = +2

Query  50   TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            T+A    TAA L  P+            Q+V K+    P   R++CSL   +K L+ N  
Sbjct  6    TVALQSLTAAKLHPPS------------QSVSKSF--KPVTRRVSCSLHDDLKNLSLNCV  51

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            +A K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  52   EATKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGLES  111

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FA KPGKY AKK CLEPTSFTVKAE VSKNA P FQNTKLMTRLTYTLDEIEGPF+V+SD
Sbjct  112  FAIKPGKYYAKKVCLEPTSFTVKAEGVSKNAKPVFQNTKLMTRLTYTLDEIEGPFDVASD  171

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+V+F EKDGIDYAAVTVQLPGGERVPF
Sbjct  172  GTVRFLEKDGIDYAAVTVQLPGGERVPF  199



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 4/185 (2%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  220
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEV  180

Query  581  SSDGS  595
            SSDGS
Sbjct  181  SSDGS  185



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +2

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
            +FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYT+DEIEGPFEVS 
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMDEIEGPFEVSP  121

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            D +VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  122  DSTVKFEEKDGIDYAAVTVQLPGGERVPF  150



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 155/183 (85%), Gaps = 2/183 (1%)
 Frame = +2

Query  125  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  304
            RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14   RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE
Sbjct  72   PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGER  664
             VS+NA P FQNTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG DYA VTVQLPGGER
Sbjct  132  DVSRNATPVFQNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDGSDYATVTVQLPGGER  191

Query  665  VPF  673
            +PF
Sbjct  192  IPF  194



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   278 bits (710),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = +2

Query  59   ASLQTAATLMQPTKVGVTPRIGRSYQTVGK---ALGVDP-SPARITCSLQSQIKELAHNF  226
            ++LQ AATL+QPTK+ VT    R   +      A G +P + AR++CSLQ  +KE A   
Sbjct  9    SALQAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEKC  68

Query  227  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  406
            + A K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE
Sbjct  69   AGATKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVE  128

Query  407  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  586
             F FK GKY  KK C+EPTSFTVKAES +KN PP+FQ T+LMTRLTYTLDEIEGP EVSS
Sbjct  129  GFPFKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSS  188

Query  587  DGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            DG +KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  189  DGKLKFEEKDGIDYAAVTVQLPGGERVPF  217



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 162/208 (78%), Gaps = 14/208 (7%)
 Frame = +2

Query  50   TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            T+A    TAA L  P+            Q+V K+    P   R++CSL   +K L  N  
Sbjct  6    TVALQSLTAAKLHPPS------------QSVSKSF--KPVTRRVSCSLHDDLKNLTLNCV  51

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            +A K+AGFALATSAL+VSGA+AEGVPKRLT+ +IQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  52   EATKIAGFALATSALVVSGASAEGVPKRLTYKDIQSKTYMEVKGTGTANQCPTIEGGLES  111

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FA KPGKY AKK CLEPTSFTVKAE VS+NA P F NTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  112  FAIKPGKYYAKKVCLEPTSFTVKAEGVSRNATPFFLNTKLMTRLTYTLDEIEGPFEVASD  171

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            G+V+F EKDG DYAAVTVQLPGGER+PF
Sbjct  172  GTVRFLEKDGSDYAAVTVQLPGGERIPF  199



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  220
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG +KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  188  SHDGKLKFEEKDGIDYAAVTVQLPGGERVPF  218



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  220
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG +KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  188  SQDGKLKFEEKDGIDYAAVTVQLPGGERVPF  218



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  220
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG +KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  188  SHDGKLKFEEKDGIDYAAVTVQLPGGERVPF  218



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  220
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  221  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  400
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  401  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  580
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EV
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEV  187

Query  581  SSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            S DG +KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  188  SQDGKLKFEEKDGIDYAAVTVQLPGGERVPF  218



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKEL  214
            MAASLQ AATLMQP KVG T R       RS   + KA G++P+  AR+TCSLQS ++E+
Sbjct  1    MAASLQAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREM  60

Query  215  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  394
            A   +D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AQKCADGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  395  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  544
            GGVE+FAFKPGKY+ KK CLEPTSFTVKAE+VSKNAPPEFQ TKLMTRLT
Sbjct  121  GGVESFAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  281  SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  460
            SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19   SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  461  TSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVT  640
            TSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVT
Sbjct  79   TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVT  138

Query  641  VQLPGGERVPF  673
            VQLPGGERVPF
Sbjct  139  VQLPGGERVPF  149



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 133/141 (94%), Gaps = 2/141 (1%)
 Frame = +2

Query  257  LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  430
            + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2    VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  431  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  610
            Y+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEE
Sbjct  62   YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEE  121

Query  611  KDGIDYAAVTVQLPGGERVPF  673
            KDGIDYAAVTVQLPGGERVPF
Sbjct  122  KDGIDYAAVTVQLPGGERVPF  142



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  296  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  475
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPG
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPG  120

Query  656  GERVPF  673
            GERVPF
Sbjct  121  GERVPF  126



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  287  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  466
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  467  FTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQ  646
            FTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKF EKDGIDYAAVTVQ
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFVEKDGIDYAAVTVQ  120

Query  647  LPGGERVPF  673
            LPGGERVPF
Sbjct  121  LPGGERVPF  129



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  296  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  475
            EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1    EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            KAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPG
Sbjct  61   KAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTVKFEEKDGIDYAAVTVQLPG  120

Query  656  GERVPF  673
            GERVPF
Sbjct  121  GERVPF  126



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  308  KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAES  487
            KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKAE 
Sbjct  4    KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  488  VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERV  667
            +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERV
Sbjct  64   ISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERV  123

Query  668  PF  673
            PF
Sbjct  124  PF  125



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   229 bits (583),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  275  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  454
            L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9    LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  455  EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAA  634
            EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAA
Sbjct  69   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAA  128

Query  635  VTVQLPGGERVPF  673
            VT  +  G+   F
Sbjct  129  VTQLVASGKPESF  141



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 135/179 (75%), Gaps = 5/179 (3%)
 Frame = +2

Query  137  TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  316
            ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  317  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  496
            TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKAES  K
Sbjct  88   TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  497  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
                 FQ TKLMTRLTYTLDEIEGP  V  +G+++FEE DGIDYAAVTVQLPGGERVPF
Sbjct  148  GGNEGFQPTKLMTRLTYTLDEIEGPLTV-QNGNLRFEEVDGIDYAAVTVQLPGGERVPF  205



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
            TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNAPPEFQ 
Sbjct  1    TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  521  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   TKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPF  111



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +2

Query  53   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  223
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  224  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  403
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  404  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
            ++FAFKPGKY AKKFCLEPTSFTVK + V+   P  F
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVK-QLVASGKPDSF  156



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +2

Query  347  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
            MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTK
Sbjct  1    MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  527  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            LMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   LMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPF  109



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   207 bits (527),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +2

Query  335  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKAE V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  515  QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            Q TKLMTRLTYTLDEIEGP EV +DG++KF EKDGIDYAAVTVQLPGGERVPF
Sbjct  61   QKTKLMTRLTYTLDEIEGPLEVGADGTIKFVEKDGIDYAAVTVQLPGGERVPF  113



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +2

Query  140  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  319
            V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+RLT
Sbjct  33   VNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQRLT  88

Query  320  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  499
            FDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKAES  K 
Sbjct  89   FDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESPFKG  148

Query  500  APPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
                FQNTKLMTRLTYTLDEIEGP  V S+G+++FEEKDGIDYAAVTVQLPGGERVPF
Sbjct  149  GSEGFQNTKLMTRLTYTLDEIEGPLTV-SNGNLRFEEKDGIDYAAVTVQLPGGERVPF  205



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = +2

Query  152  LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  331
             G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45   FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  332  QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  511
             SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKAES  K    E
Sbjct  103  NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  512  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            F  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  163  FTKTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  216



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 146/206 (71%), Gaps = 7/206 (3%)
 Frame = +2

Query  56   AASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  235
            +AS +T+  L   +K+     I  +  ++  A G+ P+ AR++C+L+  ++ +     D 
Sbjct  7    SASCKTSVALASNSKLEKVQTIKSA--SLSSAFGLTPAAARVSCNLEENVRSVV----DG  60

Query  236  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  415
            AK A   LA+SAL+   A AEGVP+RLTFDEI ++TYM+VKGSGTANQCP +  G   F+
Sbjct  61   AKAAALVLASSALMAGAALAEGVPQRLTFDEINAQTYMDVKGSGTANQCPIVAEGSGQFS  120

Query  416  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  595
            FK G+Y+ +K CLEPTSFTVKAES  K     +Q TKLMTRLTYTLDEIEGP  V   G+
Sbjct  121  FKDGEYTMRKLCLEPTSFTVKAESPFKGGSEGYQQTKLMTRLTYTLDEIEGPLTVKG-GN  179

Query  596  VKFEEKDGIDYAAVTVQLPGGERVPF  673
            ++FEEKDGIDYAAVTVQLPGGERVPF
Sbjct  180  LRFEEKDGIDYAAVTVQLPGGERVPF  205



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +2

Query  347  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
            MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TK
Sbjct  1    MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  527  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            LMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   LMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPF  109



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  353  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKAE VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   TRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPF  107



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 143/214 (67%), Gaps = 14/214 (7%)
 Frame = +2

Query  53   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  211
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  212  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  392  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
             GG E F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE  
Sbjct  114  SGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIEAD  173

Query  572  FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
              V   G++K  EKDGIDYAAVTVQLPGGERVPF
Sbjct  174  LSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 142/214 (66%), Gaps = 14/214 (7%)
 Frame = +2

Query  53   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  211
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  212  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  391
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  392  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGP  571
             GG   F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLDEIE  
Sbjct  114  SGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLDEIEAD  173

Query  572  FEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
              V   G++K  EKDGIDYAAVTVQLPGGERVPF
Sbjct  174  LSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPF  207



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 104/127 (82%), Gaps = 1/127 (1%)
 Frame = +2

Query  293  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  472
            AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28   AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  473  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
            VKAES  K    ++Q TKLMTRLTYTLDEIEGP  + S+G++KFEEKDGIDYAAVTVQLP
Sbjct  88   VKAESQFKQGGEDYQPTKLMTRLTYTLDEIEGPLTI-SNGNLKFEEKDGIDYAAVTVQLP  146

Query  653  GGERVPF  673
            GGERVPF
Sbjct  147  GGERVPF  153



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  305  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  484
            PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK E
Sbjct  1    PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  485  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGER  664
            S  K    ++ +TKLMTRLTYTLDEIE    V   G++K  EKDGIDYAAVTVQLPGGER
Sbjct  61   SPFKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGER  120

Query  665  VPF  673
            VPF
Sbjct  121  VPF  123



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 141/208 (68%), Gaps = 7/208 (3%)
 Frame = +2

Query  50   TMAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  229
            T A++   A+T +QP     + +       V +A G+  + A+++CS +  ++      +
Sbjct  4    TAASASLKASTFVQPKVNAASLKAA----PVSQAFGLKTASAKVSCSAEENVRGFVQKCA  59

Query  230  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  409
            DA K A  ALA++AL+ S A A  VP RL FDE+QS TY EVKGSG ANQCP I GGV+ 
Sbjct  60   DAGKAAALALASTALVASSAQA-AVP-RLNFDELQSLTYSEVKGSGIANQCPIIAGGVDG  117

Query  410  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  589
            FAFK GKY   K CLEPT+FTVKAES  K    EFQ TKLMTRLTYTLDEIEGP EV+ +
Sbjct  118  FAFKSGKYQVSKMCLEPTAFTVKAESQFKGQGEEFQKTKLMTRLTYTLDEIEGPLEVNGN  177

Query  590  GSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             ++KF E DGIDYAAVTVQL GGERVPF
Sbjct  178  -NLKFTEVDGIDYAAVTVQLAGGERVPF  204



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 110/167 (66%), Gaps = 9/167 (5%)
 Frame = +2

Query  179  ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  355
            + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37   VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  356  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK ES  K    +F  TKLM
Sbjct  90   KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTYTLDEI G F V   G+V F+E+DGIDYA VTVQLPGGERVPF
Sbjct  150  TRLTYTLDEISGKFSVDGSGNVNFKEEDGIDYAPVTVQLPGGERVPF  196



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 99/138 (72%), Gaps = 0/138 (0%)
 Frame = +2

Query  260  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  439
            AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45   ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  440  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  619
            ++FC+EPTSFTVK ES  K    EFQ T+LMTRLTYTLD + G F+V SDGSV+ +E DG
Sbjct  105  ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDG  164

Query  620  IDYAAVTVQLPGGERVPF  673
            +DYA VTVQLPGGERVPF
Sbjct  165  LDYAPVTVQLPGGERVPF  182



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53   GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ES  K    +F +TKLMTRLTYTLDE+ G F+V   G+V+ +E+DGIDYA VTVQLPG
Sbjct  113  KEESQFKGGDSDFVSTKLMTRLTYTLDEMSGSFKVDGSGNVELKEEDGIDYAPVTVQLPG  172

Query  656  GERVPF  673
            GERVPF
Sbjct  173  GERVPF  178



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = +2

Query  260  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  439
            A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44   ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  440  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  619
            ++FC+EPTSFTVK ES  K    EF  T+LMTRLTYTLD + G F+V SDGSV  +E DG
Sbjct  104  ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFKVGSDGSVNVQENDG  163

Query  620  IDYAAVTVQLPGGERVPF  673
            +DYA VTVQLPGGERVPF
Sbjct  164  LDYAPVTVQLPGGERVPF  181



>gb|ADC54902.1| oxygen-evolving enhancer protein, partial [Klebsormidium flaccidum]
Length=142

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  365  GTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  544
            G AN C  I GG + F  K GKY+ KK CLEPTSFTVKAES  K+   +FQ TKLMTRLT
Sbjct  1    GVANTCAIIAGGEDGFKVKAGKYTLKKLCLEPTSFTVKAESQFKDKKEDFQKTKLMTRLT  60

Query  545  YTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            YTLDEIEGP EV +DGS+KFEEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   YTLDEIEGPLEVGNDGSLKFEEKDGIDYAAVTVQLPGGERVPF  103



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ ES+
Sbjct  1    LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             + AP  F +TKL+TRLTYTLDE+EG F V SDGS++  E++G+D+AAVTVQ+PGGERVP
Sbjct  61   QRGAPSFFSDTKLLTRLTYTLDEMEGKFVVGSDGSLRVTEEEGLDFAAVTVQMPGGERVP  120

Query  671  F  673
            F
Sbjct  121  F  121



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  428  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  607
            KY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG++KFE
Sbjct  1    KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFE  60

Query  608  EKDGIDYAAVTVQLPGGERVPF  673
            EKDGIDYAAVTVQLPGGERVPF
Sbjct  61   EKDGIDYAAVTVQLPGGERVPF  82



>ref|XP_004243178.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=177

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  173  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  352
            +R++ SL++ +K+ +H   D + +AGF+LATS+L+VSGANAE VPKRLT DEIQ+KTYME
Sbjct  64   SRLSFSLEADLKDFSHKCIDTSMIAGFSLATSSLVVSGANAERVPKRLTLDEIQTKTYME  123

Query  353  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  514
            VKG+ TANQCPTI+GGV NFAFK GKY+AKKF LE T F VK E VSKN+  EF
Sbjct  124  VKGTVTANQCPTIDGGVNNFAFKLGKYNAKKFYLETTPFIVKEEGVSKNSALEF  177



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  443  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGI  622
            KFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGI
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGI  60

Query  623  DYAAVTVQLPGGERVPF  673
            DYAAVTVQLPGGERVPF
Sbjct  61   DYAAVTVQLPGGERVPF  77



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
            +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK +S  
Sbjct  65   VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPF
Sbjct  125  KAGESEFTKTKLMTRLTYTLDGMTGSFKVGSDGSVAIQERDGLDYAPVTVQLPGGERVPF  184



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK E+ 
Sbjct  54   LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
               +  EF +TKLMTRLTYTLDEI G   V S+GSV+ +E+DGIDYA VTVQLPGGERVP
Sbjct  114  KGES--EFVSTKLMTRLTYTLDEISGKLTVGSNGSVELKEEDGIDYAPVTVQLPGGERVP  171

Query  671  F  673
            F
Sbjct  172  F  172



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPF  673
            YAAVTVQLPGGERVPF
Sbjct  61   YAAVTVQLPGGERVPF  76



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPF  673
            YAAVTVQLPGGERVPF
Sbjct  61   YAAVTVQLPGGERVPF  76



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPF  673
            YAAVTVQLPGGERVPF
Sbjct  61   YAAVTVQLPGGERVPF  76



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/76 (97%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +2

Query  446  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGID
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGID  60

Query  626  YAAVTVQLPGGERVPF  673
            YAAVTVQLPGGERVPF
Sbjct  61   YAAVTVQLPGGERVPF  76



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107  KEESQFKGGDSEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656  GERVPF  673
            GERV F
Sbjct  167  GERVAF  172



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656  GERVPF  673
            GERV F
Sbjct  167  GERVAF  172



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPG  166

Query  656  GERVPF  673
            GERV F
Sbjct  167  GERVAF  172



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  475
            G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45   GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ES  +    EF  TKLMTRLTYTLDE+ G F+V   G V+ +E+DGIDYAA TVQLPG
Sbjct  105  KEESQFRGGDSEFVKTKLMTRLTYTLDEMSGTFKVDGSGKVELQEEDGIDYAATTVQLPG  164

Query  656  GERVPF  673
            GERVPF
Sbjct  165  GERVPF  170



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = +2

Query  317  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVS  493
            TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK E+  
Sbjct  65   TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            KN   +F  TKL+TRLTYTLDEI G  ++   G V+F+E+DGIDYAAVTVQLPGGERVPF
Sbjct  125  KNGEADFVPTKLVTRLTYTLDEISGQMKIDGSGGVEFKEEDGIDYAAVTVQLPGGERVPF  184



>gb|AEW08532.1| hypothetical protein CL304Contig1_01, partial [Pinus radiata]
 gb|AFG43487.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43488.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43489.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
Length=87

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  425  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  604
            GKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVSSDG +KF
Sbjct  1    GKYEMKKLCMEPTSFTVKAEGTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSSDGKLKF  60

Query  605  EEKDGIDYAAVTVQLPGGERVPF  673
            EEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   EEKDGIDYAAVTVQLPGGERVPF  83



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 89/130 (68%), Gaps = 6/130 (5%)
 Frame = +2

Query  284  GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  463
            GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61   GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  464  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTV  643
            SFTVK ES  K    E+  TKLMTRLTYTLDEI G   V + G V F E+DGIDYA VTV
Sbjct  115  SFTVKEESQFKGGADEYVQTKLMTRLTYTLDEISGALTVGAAGDVTFVEEDGIDYAPVTV  174

Query  644  QLPGGERVPF  673
            QLPGGERVPF
Sbjct  175  QLPGGERVPF  184



>gb|AFB34200.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
 gb|AFB34201.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
Length=87

 Score =   149 bits (375),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  425  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  604
            GKY  KK C+EPTSFTVKAES +KN PP+FQ TKLMTRLTYTLDEIEGP +VS DG +KF
Sbjct  1    GKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTKLMTRLTYTLDEIEGPLDVSPDGKLKF  60

Query  605  EEKDGIDYAAVTVQLPGGERVPF  673
            EEKDGIDYAAVTVQLPGGERVPF
Sbjct  61   EEKDGIDYAAVTVQLPGGERVPF  83



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
            L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK ES  
Sbjct  23   LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            K    EF  TKL+TRLTYTLD+I G F+V +DGSV F E+DGIDYAA TVQLPGGERVPF
Sbjct  82   KAGEAEFVKTKLLTRLTYTLDDISGKFKVGADGSVTFTEEDGIDYAATTVQLPGGERVPF  141



>gb|ADC54900.1| oxygen-evolving enhancer protein, partial [Entransia fimbriata]
Length=151

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
            TY +VKG+G ANQCP +         KPGKY+ +K CLEPTSFTVKA    K++P  FQ 
Sbjct  1    TYXQVKGTGIANQCPKLGSAEPGLKVKPGKYAVEKLCLEPTSFTVKAPGPLKDSPVAFQK  60

Query  521  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEE-KDGIDYAAVTVQLPGGERVPF  673
            TKLMTRLTYTLDE EG  +V SDGS+KFE+  DGIDYAAVTVQ+PGGERVPF
Sbjct  61   TKLMTRLTYTLDENEGTLDVGSDGSLKFEKAADGIDYAAVTVQIPGGERVPF  112



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   152 bits (385),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  293  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  472
            A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57   AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  473  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
            VK ES  K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLP
Sbjct  117  VKEESAFKAGESEFVKTKLMTRLTYTLDGMTGSFKVGSDGSVAVQERDGLDYAPVTVQLP  176

Query  653  GGERVPF  673
            GGERVPF
Sbjct  177  GGERVPF  183



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPG
Sbjct  112  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPG  171

Query  656  GERVPF  673
            GERV F
Sbjct  172  GERVAF  177



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  475
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  476  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPG  655
            K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPG
Sbjct  108  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPG  167

Query  656  GERVPF  673
            GERV F
Sbjct  168  GERVAF  173



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 93/137 (68%), Gaps = 7/137 (5%)
 Frame = +2

Query  266  SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  442
            +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40   TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  443  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGI  622
            +FC+EPT+F+VK ES  K     F  TKLMTRLTYTLD + G F+V   G+V+ +E DGI
Sbjct  94   RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLDGMTGTFKVDGSGNVELKEDDGI  153

Query  623  DYAAVTVQLPGGERVPF  673
            DYA VTVQLPGGERVPF
Sbjct  154  DYAPVTVQLPGGERVPF  170



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  490
            LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK +S 
Sbjct  67   LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    E   TKLMTRLTYTLD++ G   + SDG V F+E+DGIDYA VTVQLPGGERVP
Sbjct  127  FKAGESELVKTKLMTRLTYTLDDMSGKMTIGSDGKVTFKEEDGIDYAPVTVQLPGGERVP  186

Query  671  F  673
            F
Sbjct  187  F  187



>gb|ADC54905.1| oxygen-evolving enhancer protein, partial [Ostreococcus tauri]
Length=148

 Score =   143 bits (360),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
            T  + KG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  K    EFQ 
Sbjct  2    TXXQXKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQFKAGESEFQK  61

Query  521  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            T+LMTRLTYTLD + G F+V SDGSV+ +E DG+DYA VTVQLPGGERVPF
Sbjct  62   TRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDGLDYAPVTVQLPGGERVPF  112



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
            +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK E   
Sbjct  95   VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             +   EF  TKLMTRLTYTLD + G F+V SDGSV   EKDGIDYA  TVQL GGERVPF
Sbjct  154  -DGSTEFAKTKLMTRLTYTLDAMSGDFKVGSDGSVNVVEKDGIDYAPTTVQLAGGERVPF  212



>gb|ADC54906.1| oxygen-evolving enhancer protein, partial [Phyllodictyon orientale]
Length=148

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ + A PE+  TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGNYSMYKFCMEPTSFKVKEESIIRGAAPEYSKTKLL  61

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTY+LDE+EG F V SDGSV+ +E++G+D+AAVTVQ+PGGERVPF
Sbjct  62   TRLTYSLDEMEGKFIVGSDGSVRVQEEEGLDFAAVTVQMPGGERVPF  108



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  490
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK ES 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    +F +TKLMTRLTYTLD+I G  ++ SDG V FEE+DGIDYA  T+QLPGGERV 
Sbjct  175  FKGGAADFVDTKLMTRLTYTLDDISGKLKLGSDGKVTFEEEDGIDYAPTTIQLPGGERVA  234

Query  671  F  673
            F
Sbjct  235  F  235



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVP
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVP  148

Query  671  F  673
            F
Sbjct  149  F  149



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 79/121 (65%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVP
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVP  149

Query  671  F  673
            F
Sbjct  150  F  150



>gb|ADC54893.1| oxygen-evolving enhancer protein, partial [Boodlea composita]
Length=148

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQ  517
            T  + KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ +   PE+ 
Sbjct  2    TXXQXKGTGLANTCPIIDGGSDNPKDLKAGTYSMYKFCMEPTSFQVKEESIIRGGAPEYS  61

Query  518  NTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
             TKL+TRLTY+LDE+EG F V SDGSV+  E++G+D+AAVTVQ+PGGERVPF
Sbjct  62   KTKLLTRLTYSLDEMEGKFVVGSDGSVRIVEEEGLDFAAVTVQMPGGERVPF  113



>emb|CCI69514.1| oxygen-evolving enhancer protein, partial [Scotinosphaera sp. 
CAUP H5307]
Length=173

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  529
            + SG AN C  IEGG  N   A KPG Y  ++FCLEPTSFTVK ES  K   PEF  TKL
Sbjct  11   RDSGVANTCAVIEGGSSNVRSALKPGSYKLERFCLEPTSFTVKEESSFKGGEPEFVKTKL  70

Query  530  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            MTRLTYTLD I G  +V+SDG+V  +E+DGIDYA VTVQLPGGERVPF
Sbjct  71   MTRLTYTLDSISGSLKVNSDGTVALKEEDGIDYAPVTVQLPGGERVPF  118



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  464  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTV  643
            SFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTV
Sbjct  1    SFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTV  60

Query  644  QLPGGERVPF  673
            QLPGGERVPF
Sbjct  61   QLPGGERVPF  70



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS K +E DGIDYAA TVQL GGERVP
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLDGIRADLQVGGDGSWKIKEIDGIDYAATTVQLAGGERVP  138

Query  671  F  673
            F
Sbjct  139  F  139



>gb|ADC54913.1| oxygen-evolving enhancer protein, partial [Valonia utricularis]
Length=147

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ESV++   P + +TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGSYSMYKFCMEPTSFKVKEESVARGGAPSYSSTKLL  61

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTY+LDE+EG F V SDGSV+  E++G+D+AAVTVQ+PGGERVPF
Sbjct  62   TRLTYSLDEMEGKFIVGSDGSVRMTEEEGLDFAAVTVQMPGGERVPF  108



>emb|CCI69513.1| oxygen-evolving enhancer protein, partial [Chlorochytrium lemnae]
Length=143

 Score =   137 bits (345),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            KGSG AN CP IEGG  N    KPG Y+  K C+EPTSFTVK +S  K    EF  TKLM
Sbjct  1    KGSGIANTCPVIEGGSTNLKDLKPGXYTFDKLCMEPTSFTVKEDSQFKGGETEFVKTKLM  60

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTYTLD + G  +V   G+V+F+E+DGIDYAA TVQLPGGERVPF
Sbjct  61   TRLTYTLDAMSGTMKVDGSGNVEFKEEDGIDYAATTVQLPGGERVPF  107



>gb|ADC54904.1| oxygen-evolving enhancer protein, partial [Nephroselmis olivacea]
Length=142

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +2

Query  350  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  529
            + KG+G AN CP IE  V +   K G Y+ ++ CLEPTSFTVK ES  K+   EF  TKL
Sbjct  1    QXKGTGIANTCPVIEKDVSD-KIKGGDYAMEQLCLEPTSFTVKEESQFKDGKSEFVKTKL  59

Query  530  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            MTRLTYTLD+I G F+V +DGSV F E+DG+DYAA TVQLPGGERVPF
Sbjct  60   MTRLTYTLDDITGKFKVGADGSVTFTEEDGLDYAATTVQLPGGERVPF  107



>gb|ADC54908.1| oxygen-evolving enhancer protein, partial [Siphonocladus tropicus]
Length=145

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +2

Query  350  EVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
            + KG+G AN CP I+GG +N    KPG Y+  KFC+EPTSFTVK +++ +   P +  TK
Sbjct  1    QXKGTGLANTCPIIDGGSDNPKDIKPGSYAMYKFCMEPTSFTVKEQALIRGGEPFYSKTK  60

Query  527  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            L+TRLTY+LDE+EG F V SDGS++  E++G+D+AAVTVQ+PGGERVPF
Sbjct  61   LLTRLTYSLDEMEGKFIVGSDGSIRITEEEGLDFAAVTVQMPGGERVPF  109



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 4/121 (3%)
 Frame = +2

Query  317  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESV  490
            TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK E V
Sbjct  91   TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    EF NTKLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVP
Sbjct  150  GK-GKKEFINTKLMTRLTYTLDAMSGTMKVGSGGAIEFKEEDGIDYAPTTVQLPGGSRVP  208

Query  671  F  673
            F
Sbjct  209  F  209



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DGIDYA  TVQL GGERVP
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLDGIRADLQVGGDGSWSIKEIDGIDYAPTTVQLAGGERVP  137

Query  671  F  673
            F
Sbjct  138  F  138



>gb|ADC54894.1| oxygen-evolving enhancer protein, partial [Bornetella sphaerica]
Length=142

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  532
            KG+G AN CPTIE G  +  A   G Y   KFC+EPTSFTVK ES  K    EF NTKLM
Sbjct  1    KGTGIANTCPTIETGTTDLSALXAGDYKFSKFCMEPTSFTVKEESQFKGGETEFVNTKLM  60

Query  533  TRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TRLTYTLD++ G F+V SD  V F E++GIDYA VTVQLPGGERVPF
Sbjct  61   TRLTYTLDDMSGTFKVGSDRKVSFVEEEGIDYAPVTVQLPGGERVPF  107



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142  LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVP
Sbjct  202  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVP  261

Query  671  F  673
            F
Sbjct  262  F  262



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
             K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVP
Sbjct  156  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVP  215

Query  671  F  673
            F
Sbjct  216  F  216



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = +2

Query  299  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  472
            G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81   GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  473  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLP  652
            VK E V K    EF +TKLMTRLTYTLD + G  +V S G+++F E+DGID A  TVQLP
Sbjct  141  VK-EDVGK-GKKEFIDTKLMTRLTYTLDAMSGSMKVGSGGAIEFAEEDGIDNAPTTVQLP  198

Query  653  GGERVPF  673
            GG RVPF
Sbjct  199  GGSRVPF  205



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  493
            +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK ES  
Sbjct  63   VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF-EEKDGIDYAAVTVQLPGGERVP  670
            K    EF  TKLMTRLTYTLD + G   V SDGSV F ++ +GID+A  TVQLPGGERVP
Sbjct  123  KEGTSEFVKTKLMTRLTYTLDGLSGKMTVGSDGSVDFKKDNEGIDFAPTTVQLPGGERVP  182

Query  671  F  673
            F
Sbjct  183  F  183



>gb|ADC54903.1| oxygen-evolving enhancer protein, partial [Mesostigma viride]
Length=151

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
            T  + KG+G AN C  I+          GKY   K CLEPTS  VK ES+ K   P+F  
Sbjct  2    TXXQXKGTGLANTCAVIDNASTELKVAGGKYKVAKMCLEPTSVKVKEESILKGGAPQFVE  61

Query  521  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TKL+TR+TYTLDEI G   V +DGSV+F+E+DGIDYAA TVQLPGGERVPF
Sbjct  62   TKLLTRMTYTLDEISGSMTVGNDGSVQFKEEDGIDYAATTVQLPGGERVPF  112



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 100/174 (57%), Gaps = 17/174 (10%)
 Frame = +2

Query  158  VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  337
            V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47   VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  338  KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  511
             +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK E V K    E
Sbjct  94   LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGKG-KKE  151

Query  512  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            F + KLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPF
Sbjct  152  FIDVKLMTRLTYTLDAMSGSMKVGSGGAIEFKEEDGIDYAPTTVQLPGGARVPF  205



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +2

Query  320  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  496
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  497  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
                +F+ TKLMTRLTYTLD I     V  DGS   +E DGIDYAA TVQL GGERVPF
Sbjct  81   KTVTDFEKTKLMTRLTYTLDGIRADLTVGGDGSWTIKEIDGIDYAATTVQLAGGERVPF  139



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DGIDYAA TVQL GGERVP
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLDGIRANLKVGGDGSWSVKEIDGIDYAATTVQLAGGERVP  138

Query  671  F  673
            F
Sbjct  139  F  139



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 77/121 (64%), Gaps = 1/121 (1%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  490
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  491  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP  670
                 PEF+ TKLMTRLTYTLD I     V  DGS    EKDGIDYAA TVQL GGERVP
Sbjct  80   DVRPNPEFERTKLMTRLTYTLDGIRADLTVGGDGSWSIXEKDGIDYAATTVQLAGGERVP  139

Query  671  F  673
            F
Sbjct  140  F  140



>gb|ADC54890.1| oxygen-evolving enhancer protein, partial [Acetabularia acetabulum]
Length=143

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +2

Query  365  GTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
            G AN C  IE G  + +  KPG Y   KFC+EP+SFTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCAVIESGSTDLSVLKPGNYKFTKFCMEPSSFTVKEESQFKGGETEFVNTKLMTRL  60

Query  542  TYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TYTLD++ G F V+S+G V F E++GIDYA VTVQLPGGERVPF
Sbjct  61   TYTLDDMNGQFAVASNGQVDFIEEEGIDYAPVTVQLPGGERVPF  104



>gb|ADC54901.1| oxygen-evolving enhancer protein, partial [Ignatius tetrasporus]
Length=145

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  350  EVKGSGTANQCPTIEGGVEN--FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNT  523
            ++KGSG AN CP IEGG  N     K G Y    FC+EPTSF VK ES  K    EF NT
Sbjct  1    QIKGSGIANTCPVIEGGSSNPKSDLKSGTYKFDNFCMEPTSFQVKEESQFKGGNEEFVNT  60

Query  524  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            KLMTRLTYTLD + G   ++  G+V+F E+DGIDYA VTVQLPGGERVPF
Sbjct  61   KLMTRLTYTLDAMSGEIRING-GNVQFIEEDGIDYAPVTVQLPGGERVPF  109



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 77/120 (64%), Gaps = 1/120 (1%)
 Frame = +2

Query  317  TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVS  493
            T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106  TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  494  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
                 +F+ TKLMTRLTYTLD I     V  DGS K +E DGIDYAA TVQL GGERVPF
Sbjct  166  GKTVTDFEKTKLMTRLTYTLDGIRADLAVGGDGSWKIKEIDGIDYAATTVQLAGGERVPF  225



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 88/134 (66%), Gaps = 6/134 (4%)
 Frame = +2

Query  278  VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  451
            VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86   VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  452  LEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYA  631
            ++PT   VKAES+ K    EFQ T+L+TR TYT+D++EGP  V SD  V F EKDG DY 
Sbjct  142  IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTIDKVEGPIFVDSDNQVTFVEKDGFDYQ  201

Query  632  AVTVQLPGGERVPF  673
            A+TV+LPGGE VP 
Sbjct  202  ALTVKLPGGELVPM  215



>gb|ADC54912.1| oxygen-evolving enhancer protein, partial [Ulva intestinalis]
Length=151

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIE---GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  511
            TY ++KG+G AN CPT+E   G V +   KPG Y   +FC+EP+  TVK ES  K    E
Sbjct  1    TYXQIKGTGRANACPTLEETNGSVSDL--KPGNYKLDRFCMEPSKITVKEESQFKGGVTE  58

Query  512  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            F NTKL+TRLTYTLD++ G   +   GS+  +E+DG+DY A TVQLPGGERVPF
Sbjct  59   FVNTKLVTRLTYTLDQMSGTVTIGPGGSISLKEEDGLDYQATTVQLPGGERVPF  112



>gb|ADC54891.1| oxygen-evolving enhancer protein, partial [Ulvella repens]
Length=140

 Score =   125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +2

Query  365  GTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  541
            G AN C T+ EG  E  A K G Y+  +FC+EPT FTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCATLDEGSAEGSALKQGTYALSQFCMEPTKFTVKEESQFKGGVTEFVNTKLMTRL  60

Query  542  TYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TYTLD++ G   V + GS+  +E+DG+DY A TVQLPGGERVPF
Sbjct  61   TYTLDQMSGTMTVGAGGSISLKEEDGLDYQATTVQLPGGERVPF  104



>gb|ADC54907.1| oxygen-evolving enhancer protein, partial [Acutodesmus obliquus]
Length=141

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +2

Query  371  ANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTY  547
            AN C  +E G  N    K G Y   KFC+EPTSFTVK ES  K    EF  TKLMTRLTY
Sbjct  1    ANTCAVLESGSTNLKDLKAGTYKVDKFCMEPTSFTVKDESQFKGGETEFVKTKLMTRLTY  60

Query  548  TLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            TLD++ G  +V   G+V+ +E DGIDYAA TVQLPGGERVPF
Sbjct  61   TLDQMSGILKVDGSGNVELQETDGIDYAATTVQLPGGERVPF  102



>gb|ADC54898.1| oxygen-evolving enhancer protein, partial [Codium sp. HEC 15711]
Length=151

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +2

Query  341  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  520
            TY ++KG+G AN CPT+  G +  A KPG Y+    C+EPTS  VK ES  K+   +F  
Sbjct  1    TYXQIKGTGLANTCPTLSTGDDAKALKPGSYAVSSMCIEPTSIQVKDESQFKDGVADFVK  60

Query  521  TKLMTRLTYTLDEIEGPFEVSSDGSVKFE-EKDGIDYAAVTVQLPGGERVPF  673
            TKLMTRLTYTLD + G   V   G + FE + +GID+A  TVQLPGGERVPF
Sbjct  61   TKLMTRLTYTLDGLGGKMTVGGSGDISFEKDNEGIDFAPTTVQLPGGERVPF  112



>gb|ADC54899.1| oxygen-evolving enhancer protein, partial [Derbesia sp. 2773-1]
Length=142

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +2

Query  356  KGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMT  535
            KG+G AN CPT+E G +  + K G Y+    C+EPT+F VK ES  ++ P  F +TKLMT
Sbjct  1    KGTGIANTCPTLETGEDGKSLKAGTYTVSGMCIEPTAFQVKEESEFRDQPAAFVDTKLMT  60

Query  536  RLTYTLDEIEGPFEVSSDGSVKF-EEKDGIDYAAVTVQLPGGERVPF  673
            RLTYTLD + G   V  DGSV F ++ DGID+A  TVQLPGGERVPF
Sbjct  61   RLTYTLDGLGGKMTVGGDGSVDFKKDNDGIDFAPTTVQLPGGERVPF  107



>dbj|BAJ61705.1| oxygen-evolving enhancer protein [Porphyridium purpureum]
Length=287

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 83/122 (68%), Gaps = 2/122 (2%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK-YSAKKFCLEPTSFTVKAE-S  487
             T ++ +  +Y +VKG+G AN+CP ++G   +   + GK Y     C+EP SF V+ E  
Sbjct  34   FTEEDFRQLSYEQVKGTGLANRCPEVDGTKGSIKIEKGKKYKIVDMCIEPKSFQVEDEVG  93

Query  488  VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERV  667
              K A  EF +TKLMTR TYTL  IEGP  V+++G ++F+EKDGIDYAA TVQLPGGERV
Sbjct  94   KGKQARKEFVDTKLMTRATYTLTGIEGPLTVNANGDLEFQEKDGIDYAATTVQLPGGERV  153

Query  668  PF  673
            PF
Sbjct  154  PF  155



>gb|EWM24380.1| oxygen-evolving enhancer protein [Nannochloropsis gaditana]
Length=238

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +2

Query  272  LLVSGAN--AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK-YSAK  442
            +LV G+   A  +   LT +++ S +Y++VKG+G AN+CP + G   + A + GK Y   
Sbjct  65   VLVGGSAFLAPSISNALTKEDLSSLSYLQVKGTGLANRCPEVVGE-GSIALQGGKTYQLS  123

Query  443  KFCLEPTSFTVKAESVSKNA--PPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  616
              CLEP ++ V+ E  +K       F NTKLMTR TY+LD + G   V   G +KFEEKD
Sbjct  124  DLCLEPKTWQVEEEVTNKRGETTKSFVNTKLMTRQTYSLDGVSGDISVGEGGKIKFEEKD  183

Query  617  GIDYAAVTVQLPGGERVPF  673
            GIDYAA TVQLPGGERVPF
Sbjct  184  GIDYAATTVQLPGGERVPF  202



>gb|ADC54895.1| oxygen-evolving enhancer protein, partial [Bryopsis sp. EE4]
Length=144

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +2

Query  350  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  529
            + KG+G AN CPT+  G +  + K G Y     C+EPTS TVK ES  K+   EF  TKL
Sbjct  1    QXKGTGVANTCPTLATGGDGSSLKAGSYQVTGMCIEPTSITVKEESQFKDGVSEFVKTKL  60

Query  530  MTRLTYTLDEIEGPFEVSSDGSVKF-EEKDGIDYAAVTVQLPGGERVPF  673
            MTRLTYTLD + G   V  DGSV F ++ +GID+A  TVQLPGGERVPF
Sbjct  61   MTRLTYTLDGLSGKMTVGGDGSVDFKKDNEGIDFAPTTVQLPGGERVPF  109



>dbj|BAJ61711.1| oxygen-evolving enhancer protein, partial [Pyrenomonas helgolandii]
Length=335

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  314  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG-KYSAKKFCLEPTSFTVKAESV  490
            L+  +++S TY ++KG+G AN+CP +E   ++   + G KY     CLEP SF ++ E V
Sbjct  73   LSSADVRSLTYQQIKGTGLANRCPEVEVNGDSIELQKGTKYKITDLCLEPKSFQIEEEIV  132

Query  491  SKNA---PPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGE  661
             K       EF +TKLMTR TYTL  +EGP     DGS+ F EK+GIDYAA TVQLPGGE
Sbjct  133  KKRTGETKKEFVDTKLMTRATYTLAGVEGPLFYDKDGSLTFLEKEGIDYAATTVQLPGGE  192

Query  662  RVPF  673
            RVPF
Sbjct  193  RVPF  196



>ref|XP_005853586.1| photosystem II oxygen-evolving enhancer protein 1 [Nannochloropsis 
gaditana CCMP526]
 ref|XP_005855446.1| photosystem II oxygen-evolving enhancer protein 1 [Nannochloropsis 
gaditana CCMP526]
 gb|EKU20905.1| photosystem II oxygen-evolving enhancer protein 1 [Nannochloropsis 
gaditana CCMP526]
 gb|EKU22771.1| photosystem II oxygen-evolving enhancer protein 1 [Nannochloropsis 
gaditana CCMP526]
Length=309

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +2

Query  272  LLVSGAN--AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK-YSAK  442
            +LV G+   A  +   LT +++ S +Y++VKG+G AN+CP + G   + A + GK Y   
Sbjct  40   VLVGGSAFLAPSISNALTKEDLSSLSYLQVKGTGLANRCPEVVG-EGSIALQGGKTYQLS  98

Query  443  KFCLEPTSFTVKAESVSKNAP--PEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  616
              CLEP ++ V+ E  +K       F NTKLMTR TY+LD + G   V   G +KFEEKD
Sbjct  99   DLCLEPKTWQVEEEVTNKRGETTKSFVNTKLMTRQTYSLDGVSGDISVGEGGKIKFEEKD  158

Query  617  GIDYAAVTVQLPGGERVPF  673
            GIDYAA TVQLPGGERVPF
Sbjct  159  GIDYAATTVQLPGGERVPF  177



>ref|XP_002894679.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=91

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 68/109 (62%), Gaps = 32/109 (29%)
 Frame = +2

Query  347  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  526
            MEVKG+GTAN CP                                +SVSKNA PEFQNTK
Sbjct  1    MEVKGTGTANTCP--------------------------------DSVSKNATPEFQNTK  28

Query  527  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            LMTRLTYTL EIEGPFEV  DGSV F+E+DGID AAVTVQLPGGE VP 
Sbjct  29   LMTRLTYTLVEIEGPFEVDLDGSVNFKEEDGIDCAAVTVQLPGGECVPL  77



>gb|ABD51936.1| chloroplast photosystem II 33 kDa oxygen evolving protein PsbO 
[Guillardia theta]
Length=314

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 85/136 (63%), Gaps = 6/136 (4%)
 Frame = +2

Query  275  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG-KYSAKKFC  451
            ++ GA+A      LT  +I + TY EVKG+G AN+CP +E   E+   +   KY     C
Sbjct  43   IIGGADAANA---LTSKDINNLTYEEVKGTGIANRCPEVESNGEDIVLQQNTKYKITDLC  99

Query  452  LEPTSFTVKAESVSKNAPP--EFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGID  625
            +EP SF ++ E   K      EF +TKL+TR TY+L  +EGP     DGS+ F+EK+G+D
Sbjct  100  IEPKSFQIETEVQKKRGESRREFVDTKLVTRATYSLAGVEGPLFYDKDGSLTFQEKEGLD  159

Query  626  YAAVTVQLPGGERVPF  673
            YAA TVQLPGGERVPF
Sbjct  160  YAATTVQLPGGERVPF  175



>gb|ADC54909.1| oxygen-evolving enhancer protein, partial [Tetraselmis striata]
Length=136

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +2

Query  374  NQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYT  550
            N C  I GG  N    P G Y   +FC+EPTSFTVK +S  +    EF  TKLMTRLTYT
Sbjct  1    NTCAVIAGGSTNPKDIPAGNYKFSEFCMEPTSFTVKEDSQFRAGETEFVKTKLMTRLTYT  60

Query  551  LDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPF  673
            LD++ G   + SDG V F+E+DGIDYA  TVQLPGGERVPF
Sbjct  61   LDDMSGKMSIGSDGKVSFKEEDGIDYAPTTVQLPGGERVPF  101



>gb|EWM24379.1| oxygen-evolving enhancer protein [Nannochloropsis gaditana]
Length=334

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +2

Query  272  LLVSGAN--AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK-YSAK  442
            +LV G+   A  +   LT +++ S +Y++VKG+G AN+CP + G   + A + GK Y   
Sbjct  65   VLVGGSAFLAPSISNALTKEDLSSLSYLQVKGTGLANRCPEVVG-EGSIALQGGKTYQLS  123

Query  443  KFCLEPTSFTVKAESVSKNAP--PEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  616
              CLEP ++ V+ E  +K       F NTKLMTR TY+LD + G   V   G +KFEEKD
Sbjct  124  DLCLEPKTWQVEEEVTNKRGETTKSFVNTKLMTRQTYSLDGVSGDISVGEGGKIKFEEKD  183

Query  617  GIDYAAVTVQLPGGERVPF  673
            GIDYAA TVQLPGGERVPF
Sbjct  184  GIDYAATTVQLPGGERVPF  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600