BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029C21

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    201   2e-57   Solanum tuberosum [potatoes]
ref|NP_001234010.1|  glutamate--cysteine ligase, chloroplastic          197   4e-56   
ref|XP_010325297.1|  PREDICTED: glutamate--cysteine ligase, chlor...    197   4e-56   
ref|XP_009617977.1|  PREDICTED: glutamate--cysteine ligase, chlor...    185   2e-51   Nicotiana tomentosiformis
gb|AFP93564.1|  GCS                                                     182   2e-50   Cestrum nocturnum [night jessamine]
gb|EYU23478.1|  hypothetical protein MIMGU_mgv1a004459mg                180   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_009766955.1|  PREDICTED: glutamate--cysteine ligase, chlor...    179   2e-49   Nicotiana sylvestris
dbj|BAP47506.1|  gamma-glutamylcysteine synthetase                      175   9e-48   Gentiana triflora
ref|XP_011080960.1|  PREDICTED: glutamate--cysteine ligase, chlor...    173   4e-47   Sesamum indicum [beniseed]
emb|CDP09740.1|  unnamed protein product                                174   5e-47   Coffea canephora [robusta coffee]
gb|ABK96626.1|  unknown                                                 172   9e-47   Populus trichocarpa x Populus deltoides
ref|XP_002304493.2|  hypothetical protein POPTR_0003s12700g             171   1e-46   
ref|XP_010089108.1|  Glutamate--cysteine ligase                         169   1e-45   
ref|XP_008351685.1|  PREDICTED: glutamate--cysteine ligase, chlor...    160   2e-45   
ref|XP_011029270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    169   2e-45   Populus euphratica
ref|XP_011022699.1|  PREDICTED: glutamate--cysteine ligase, chlor...    169   2e-45   Populus euphratica
ref|XP_007209899.1|  hypothetical protein PRUPE_ppa004151mg             167   5e-45   Prunus persica
ref|XP_009350439.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   7e-45   
ref|XP_002273626.1|  PREDICTED: glutamate--cysteine ligase, chlor...    167   7e-45   Vitis vinifera
ref|XP_009350438.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   7e-45   
ref|XP_009350437.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_009350436.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   2e-44   Pyrus x bretschneideri [bai li]
gb|AHJ60103.1|  gamma-glutamylcysteine synthetase                       166   2e-44   Pyrus betulifolia
ref|XP_008238836.1|  PREDICTED: glutamate--cysteine ligase, chlor...    166   2e-44   Prunus mume [ume]
ref|XP_011463882.1|  PREDICTED: glutamate--cysteine ligase, chlor...    165   3e-44   Fragaria vesca subsp. vesca
ref|XP_002298035.2|  hypothetical protein POPTR_0001s09340g             164   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007040225.1|  Glutamate-cysteine ligase isoform 1                164   8e-44   
ref|XP_006439555.1|  hypothetical protein CICLE_v10019696mg             163   1e-43   
ref|XP_010053261.1|  PREDICTED: glutamate--cysteine ligase, chlor...    163   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010053262.1|  PREDICTED: glutamate--cysteine ligase, chlor...    163   2e-43   Eucalyptus grandis [rose gum]
ref|XP_008341055.1|  PREDICTED: glutamate--cysteine ligase, chlor...    163   2e-43   Malus domestica [apple tree]
ref|XP_006439553.1|  hypothetical protein CICLE_v10019696mg             163   2e-43   Citrus clementina [clementine]
ref|XP_008341054.1|  PREDICTED: glutamate--cysteine ligase, chlor...    163   2e-43   Malus domestica [apple tree]
ref|XP_006439556.1|  hypothetical protein CICLE_v10019696mg             162   2e-43   
ref|XP_008341053.1|  PREDICTED: glutamate--cysteine ligase, chlor...    163   2e-43   Malus domestica [apple tree]
ref|XP_002509800.1|  Glutamate--cysteine ligase, chloroplast prec...    160   2e-42   Ricinus communis
ref|XP_011072645.1|  PREDICTED: glutamate--cysteine ligase, chlor...    160   4e-42   Sesamum indicum [beniseed]
ref|XP_009364919.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   4e-42   Pyrus x bretschneideri [bai li]
ref|XP_009364899.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_009364953.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_010540840.1|  PREDICTED: glutamate--cysteine ligase, chlor...    158   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010540831.1|  PREDICTED: glutamate--cysteine ligase, chlor...    158   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_006476577.1|  PREDICTED: glutamate--cysteine ligase, chlor...    158   1e-41   
dbj|BAD27390.1|  gamma-glutamylcysteine synthetase                      158   2e-41   Zinnia elegans [garden zinnia]
gb|KJB37542.1|  hypothetical protein B456_006G209400                    157   2e-41   Gossypium raimondii
ref|XP_008360718.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    156   2e-41   
gb|KJB37541.1|  hypothetical protein B456_006G209400                    157   3e-41   Gossypium raimondii
gb|KJB37540.1|  hypothetical protein B456_006G209400                    157   3e-41   Gossypium raimondii
ref|XP_004171335.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    149   1e-40   
gb|ACJ83305.1|  unknown                                                 148   1e-40   Medicago truncatula
ref|XP_008437270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    153   9e-40   Cucumis melo [Oriental melon]
gb|AFF18844.2|  gamma-glutamylcysteine synthetase                       152   2e-39   Dimocarpus longan [longan]
ref|XP_002867730.1|  hypothetical protein ARALYDRAFT_492552             152   2e-39   
ref|NP_001031701.1|  glutamate-cysteine ligase                          151   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ABJ98542.1|  gamma-glutamylcysteine synthetase                       151   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08228.1|  AT4g23100/F7H19_290                                     151   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194041.1|  glutamate-cysteine ligase                             151   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16161.1|AF428393_1  AT4g23100/F7H19_290                           151   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ADK77882.1|  gamma-glutamylcysteine synthetase                       151   5e-39   Cucumis sativus [cucumbers]
gb|KDO76211.1|  hypothetical protein CISIN_1g010751mg                   149   7e-39   Citrus sinensis [apfelsine]
gb|KDO76213.1|  hypothetical protein CISIN_1g010751mg                   149   8e-39   Citrus sinensis [apfelsine]
ref|XP_006413578.1|  hypothetical protein EUTSA_v10024916mg             150   8e-39   
emb|CAA82626.1|  gamma-glutamylcysteine synthetase                      150   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KDO76209.1|  hypothetical protein CISIN_1g010751mg                   150   1e-38   Citrus sinensis [apfelsine]
gb|AAG13459.1|AF128453_1  gamma-glutamylcysteine synthetase precu...    146   1e-38   Glycine max [soybeans]
gb|ADE06226.1|  gamma-glutamylcysteine synthetase                       150   1e-38   Hevea brasiliensis [jebe]
gb|AGI36546.1|  gamma-glutamylcysteine synthetase                       143   1e-38   Brassica oleracea var. botrytis [cauliflower]
gb|KDO76206.1|  hypothetical protein CISIN_1g010751mg                   149   1e-38   Citrus sinensis [apfelsine]
ref|XP_008792987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   1e-38   Phoenix dactylifera
ref|XP_010529570.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_008792975.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   2e-38   
gb|AAF22136.1|AF128454_1  gamma-glutamylcysteine synthetase precu...    149   2e-38   Phaseolus vulgaris [French bean]
ref|XP_007160058.1|  hypothetical protein PHAVU_002G289200g             149   2e-38   Phaseolus vulgaris [French bean]
gb|AAO45821.1|  gamma-glutamylcysteine synthetase                       149   2e-38   Lotus japonicus
emb|CAA71075.1|  gamma-glutamylcysteine synthetase                      149   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010241948.1|  PREDICTED: glutamate--cysteine ligase, chlor...    142   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008792981.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   3e-38   
ref|XP_004143907.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    148   3e-38   
ref|XP_010920822.1|  PREDICTED: glutamate--cysteine ligase, chlor...    148   6e-38   Elaeis guineensis
ref|XP_010439228.1|  PREDICTED: glutamate--cysteine ligase, chlor...    148   7e-38   Camelina sativa [gold-of-pleasure]
gb|AEA77156.1|  chloroplast gamma glutamyl cysteine synthetase          147   1e-37   Vigna radiata [mung bean]
gb|AAF22137.1|AF128455_1  gamma-glutamylcysteine synthetase precu...    147   1e-37   Pisum sativum [garden pea]
gb|KHN16824.1|  Glutamate--cysteine ligase, chloroplastic               146   2e-37   Glycine soja [wild soybean]
ref|XP_006586325.1|  PREDICTED: glutamate--cysteine ligase, chlor...    146   2e-37   
ref|XP_006283533.1|  hypothetical protein CARUB_v10004582mg             146   2e-37   Capsella rubella
ref|XP_003630512.1|  Glutamate-cysteine ligase                          146   3e-37   Medicago truncatula
ref|XP_009380693.1|  PREDICTED: glutamate--cysteine ligase A, chl...    146   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010433943.1|  PREDICTED: glutamate--cysteine ligase, chlor...    146   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004503722.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   3e-37   Cicer arietinum [garbanzo]
ref|XP_010255398.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003525397.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   5e-37   Glycine max [soybeans]
ref|XP_010448772.1|  PREDICTED: glutamate--cysteine ligase, chlor...    145   6e-37   Camelina sativa [gold-of-pleasure]
gb|EPS61788.1|  gamma-glutamylcysteine synthetase                       144   8e-37   Genlisea aurea
ref|XP_010937863.1|  PREDICTED: glutamate--cysteine ligase A, chl...    144   1e-36   Elaeis guineensis
ref|XP_009402382.1|  PREDICTED: glutamate--cysteine ligase A, chl...    144   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
sp|O23736.1|GSH1_BRAJU  RecName: Full=Glutamate--cysteine ligase,...    143   2e-36   Brassica juncea [brown mustard]
emb|CAK24967.1|  gamma-glutamylcysteine synthetase                      143   2e-36   Brassica napus [oilseed rape]
gb|AHC02699.1|  gamma-glutamylcysteine synthetase                       143   3e-36   Pyrus calleryana [Bradford pear]
ref|XP_008789126.1|  PREDICTED: glutamate--cysteine ligase A, chl...    143   4e-36   Phoenix dactylifera
gb|KDP25439.1|  hypothetical protein JCGZ_20595                         140   2e-35   Jatropha curcas
gb|ABM46854.1|  gamma-glutamylcysteine synthetase                       140   4e-35   Chorispora bungeana
gb|KGN50100.1|  hypothetical protein Csa_5G153150                       139   6e-35   Cucumis sativus [cucumbers]
ref|XP_010241950.1|  PREDICTED: glutamate--cysteine ligase, chlor...    133   7e-35   
ref|XP_010695138.1|  PREDICTED: glutamate--cysteine ligase, chlor...    138   7e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|ACX70134.1|  gamma-glutamylcysteine synthetase                       138   1e-34   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010695135.1|  PREDICTED: glutamate--cysteine ligase, chlor...    138   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009136711.1|  PREDICTED: glutamate--cysteine ligase, chlor...    138   1e-34   Brassica rapa
emb|CDY41249.1|  BnaA01g12900D                                          138   1e-34   Brassica napus [oilseed rape]
emb|CAD91714.1|  glutamate-cysteine ligase                              136   9e-34   Brassica juncea [brown mustard]
ref|XP_009137315.1|  PREDICTED: glutamate--cysteine ligase, chlor...    136   1e-33   Brassica rapa
ref|XP_009380691.1|  PREDICTED: glutamate--cysteine ligase A, chl...    135   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210716.1|  hypothetical protein PRUPE_ppa022884mg             135   2e-33   
emb|CAR82640.1|  putative glutamyl cysteine ligase                      132   2e-32   Brassica napus [oilseed rape]
emb|CDY10914.1|  BnaA03g45730D                                          132   3e-32   Brassica napus [oilseed rape]
ref|XP_008346998.1|  PREDICTED: glutamate--cysteine ligase, chlor...    124   3e-32   
ref|XP_002439220.1|  hypothetical protein SORBIDRAFT_09g002470          131   4e-32   Sorghum bicolor [broomcorn]
ref|XP_003611087.1|  Glutamate-cysteine ligase                          130   6e-32   
emb|CDY41369.1|  BnaC03g65140D                                          130   6e-32   Brassica napus [oilseed rape]
gb|AAL61610.1|AF401621_1  gamma-glutamylcysteine synthetase             130   9e-32   Allium cepa
ref|XP_004511574.1|  PREDICTED: glutamate--cysteine ligase, chlor...    130   1e-31   Cicer arietinum [garbanzo]
pdb|2GWD|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    129   3e-31   Brassica juncea [brown mustard]
ref|XP_003611086.1|  Glutamate-cysteine ligase                          129   4e-31   
emb|CAD48599.3|  gamma-glutamylcysteine synthetase                      127   7e-31   Oryza sativa Japonica Group [Japonica rice]
sp|Q8GU95.2|GSH1A_ORYSI  RecName: Full=Glutamate--cysteine ligase...    127   7e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001054541.1|  Os05g0129000                                       127   7e-31   
pdb|2GWC|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    125   3e-30   Brassica juncea [brown mustard]
ref|XP_008655177.1|  PREDICTED: uncharacterized protein LOC100381...    125   4e-30   
gb|EEE62203.1|  hypothetical protein OsJ_16990                          128   5e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ21770.1|  putative gamma-glutamylcysteine synthetase             124   1e-29   Pteris vittata
dbj|BAJ21771.1|  putative gamma-glutamylcysteine synthetase             124   1e-29   Pteris vittata
ref|XP_008375304.1|  PREDICTED: glutamate--cysteine ligase, chlor...    122   4e-29   
ref|XP_008375303.1|  PREDICTED: glutamate--cysteine ligase, chlor...    122   4e-29   
ref|XP_006827661.1|  hypothetical protein AMTR_s00009p00252400          122   5e-29   
ref|XP_008648285.1|  PREDICTED: gamma-glutamylcysteine synthetase...    122   9e-29   Zea mays [maize]
ref|XP_003611083.1|  Glutamate-cysteine ligase                          117   1e-28   
sp|A2YL07.2|GSH1B_ORYSI  RecName: Full=Glutamate--cysteine ligase...    121   1e-28   Oryza sativa Indica Group [Indian rice]
sp|Q6Z3A3.1|GSH1B_ORYSJ  RecName: Full=Glutamate--cysteine ligase...    121   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81979.1|  hypothetical protein OsI_25896                          121   5e-28   Oryza sativa Indica Group [Indian rice]
gb|EEE67118.1|  hypothetical protein OsJ_24143                          119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965328.1|  hypothetical protein SELMODRAFT_83292              118   2e-27   
ref|XP_003569058.1|  PREDICTED: glutamate--cysteine ligase B, chl...    118   2e-27   Brachypodium distachyon [annual false brome]
ref|XP_004960382.1|  PREDICTED: glutamate--cysteine ligase B, chl...    116   8e-27   Setaria italica
ref|XP_001785532.1|  predicted protein                                  114   5e-26   
gb|KFK30813.1|  hypothetical protein AALP_AA6G029500                    113   1e-25   Arabis alpina [alpine rockcress]
ref|XP_010448777.1|  PREDICTED: glutamate--cysteine ligase, chlor...    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003516702.1|  PREDICTED: glutamate--cysteine ligase, chlor...    110   2e-24   Glycine max [soybeans]
ref|XP_006654002.1|  PREDICTED: glutamate--cysteine ligase B, chl...    108   2e-24   
ref|XP_002974231.1|  hypothetical protein SELMODRAFT_101407             108   3e-24   
emb|CAD48598.1|  gamma-glutamylcysteine synthetase                      108   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010448775.1|  PREDICTED: glutamate--cysteine ligase, chlor...    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001105142.1|  gamma-glutamylcysteine synthetase1                 108   4e-24   Zea mays [maize]
ref|XP_010439235.1|  PREDICTED: glutamate--cysteine ligase, chlor...    108   5e-24   
ref|XP_010439231.1|  PREDICTED: glutamate--cysteine ligase, chlor...    108   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010439234.1|  PREDICTED: glutamate--cysteine ligase, chlor...    108   6e-24   
ref|XP_002867731.1|  hypothetical protein ARALYDRAFT_914292             108   7e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_002875199.1|  predicted protein                                  107   7e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010448773.1|  PREDICTED: glutamate--cysteine ligase, chlor...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004971557.1|  PREDICTED: glutamate--cysteine ligase B, chl...    107   1e-23   
ref|XP_002985600.1|  hypothetical protein SELMODRAFT_122883             107   2e-23   
emb|CAA06613.1|  gamma-glutamylcysteine synthetase                      105   3e-23   Brassica juncea [brown mustard]
ref|XP_007158499.1|  hypothetical protein PHAVU_002G157600g             105   5e-23   Phaseolus vulgaris [French bean]
ref|XP_001757520.1|  predicted protein                                  105   7e-23   
ref|XP_010433942.1|  PREDICTED: glutamate--cysteine ligase, chlor...    105   7e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010439229.1|  PREDICTED: glutamate--cysteine ligase, chlor...    104   8e-23   Camelina sativa [gold-of-pleasure]
gb|ADY17635.1|  gamma-glutamylcysteine synthetase                       103   1e-22   Salix sachalinensis
ref|XP_006283598.1|  hypothetical protein CARUB_v10004654mg             103   2e-22   Capsella rubella
emb|CDX94156.1|  BnaC07g37900D                                          103   4e-22   
emb|CDY63259.1|  BnaA03g58670D                                          101   2e-21   Brassica napus [oilseed rape]
ref|XP_009137312.1|  PREDICTED: glutamate--cysteine ligase, chlor...    101   3e-21   Brassica rapa
ref|XP_002977172.1|  hypothetical protein SELMODRAFT_232900             100   4e-21   
ref|XP_004971558.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...  99.0    1e-20   
ref|XP_010440635.1|  PREDICTED: glutamate--cysteine ligase, chlor...  94.4    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010440632.1|  PREDICTED: glutamate--cysteine ligase, chlor...  94.4    8e-19   
ref|XP_010435330.1|  PREDICTED: glutamate--cysteine ligase, chlor...  94.4    8e-19   Camelina sativa [gold-of-pleasure]
gb|AES94042.2|  gamma glutamyl cysteine synthetase                    90.1    3e-18   Medicago truncatula
ref|XP_001778732.1|  predicted protein                                83.6    4e-15   
ref|XP_003062187.1|  predicted protein                                83.2    6e-15   Micromonas pusilla CCMP1545
ref|XP_006851854.1|  hypothetical protein AMTR_s00041p00090560        78.2    1e-14   
ref|XP_005844806.1|  hypothetical protein CHLNCDRAFT_26566            80.9    3e-14   Chlorella variabilis
ref|XP_002507857.1|  predicted protein                                80.5    4e-14   Micromonas commoda
gb|ADX30738.2|  truncated gamma-glutamyl-cysteine synthetase          79.7    5e-14   Populus x canadensis [Canadian poplar]
ref|XP_007513078.1|  glutamate--cysteine ligase                       78.2    3e-13   Bathycoccus prasinos
ref|XP_001701647.1|  gamma-glutamylcysteine synthetase                77.8    3e-13   Chlamydomonas reinhardtii
ref|XP_005646648.1|  plant glutamate cysteine ligase in complex w...  76.6    8e-13   Coccomyxa subellipsoidea C-169
ref|XP_009138281.1|  PREDICTED: glutamate--cysteine ligase, chlor...  71.2    9e-13   Brassica rapa
ref|XP_009138279.1|  PREDICTED: glutamate--cysteine ligase, chlor...  71.2    1e-12   Brassica rapa
emb|CDY32005.1|  BnaC06g15830D                                        72.0    3e-12   Brassica napus [oilseed rape]
emb|CDY45302.1|  BnaA03g52750D                                        70.9    8e-12   Brassica napus [oilseed rape]
ref|XP_009138280.1|  PREDICTED: glutamate--cysteine ligase, chlor...  68.6    1e-11   
gb|KIY94325.1|  glutamate--cysteine ligase                            72.0    1e-11   Monoraphidium neglectum
ref|XP_006851855.1|  hypothetical protein AMTR_s00041p00090940        72.0    3e-11   
ref|WP_041643346.1|  glutamate--cysteine ligase                       70.1    1e-10   
gb|ABK46164.1|  glutamate--cysteine ligase                            70.1    1e-10   Magnetococcus marinus MC-1
gb|AFC88288.1|  gamma-glutamylcysteine synthetase                     70.1    1e-10   Chlamydomonas sp. ICE-L
ref|WP_031555060.1|  glutamate--cysteine ligase                       69.3    2e-10   
ref|WP_043871177.1|  glutamate--cysteine ligase                       68.9    3e-10   Celeribacter indicus
ref|WP_031448324.1|  glutamate--cysteine ligase                       68.9    3e-10   Caulobacteraceae bacterium PMMR1
gb|KCZ49144.1|  glutamate--cysteine ligase                            68.2    5e-10   Hyphomonas sp. CY54-11-8
ref|WP_027840020.1|  glutamate--cysteine ligase                       67.8    6e-10   
ref|WP_035537514.1|  glutamate--cysteine ligase                       67.8    6e-10   Hyphomonas oceanitis
gb|KDA02929.1|  glutamate--cysteine ligase                            67.8    6e-10   Hyphomonas oceanitis SCH89
ref|WP_020057893.1|  glutamate--cysteine ligase                       67.8    7e-10   
gb|KCZ62975.1|  glutamate--cysteine ligase                            67.8    7e-10   Hyphomonas sp. L-53-1-40
ref|WP_026986595.1|  glutamate--cysteine ligase                       67.4    8e-10   Fodinicurvata fenggangensis
ref|WP_034763127.1|  glutamate--cysteine ligase                       67.4    8e-10   
ref|WP_008438534.1|  glutamate--cysteine ligase                       67.4    8e-10   Rhodanobacter thiooxydans
ref|WP_011457023.1|  glutamate--cysteine ligase                       67.0    1e-09   Jannaschia sp. CCS1
ref|WP_002725375.1|  glutamate--cysteine ligase                       66.6    1e-09   Phaeospirillum molischianum
ref|WP_009572338.1|  glutamate--cysteine ligase                       66.6    1e-09   Celeribacter baekdonensis
ref|WP_018998172.1|  glutamate--cysteine ligase                       66.6    1e-09   Hirschia maritima
ref|WP_013960367.1|  glutamate--cysteine ligase                       66.6    2e-09   Roseobacter litoralis
ref|WP_025898136.1|  glutamate--cysteine ligase                       66.2    2e-09   Sneathiella glossodoripedis
ref|WP_018304101.1|  glutamate--cysteine ligase                       66.2    2e-09   Wenxinia marina
dbj|BAE52827.1|  Gamma-glutamylcysteine synthetase                    66.2    2e-09   Magnetospirillum magneticum AMB-1
ref|WP_034815788.1|  glutamate--cysteine ligase                       66.2    2e-09   
ref|WP_012568753.1|  glutamate--cysteine ligase                       66.2    2e-09   Rhodospirillum centenum
ref|WP_022727621.1|  glutamate--cysteine ligase                       66.2    2e-09   Fodinicurvata sediminis
emb|CEG00964.1|  Glutamate--cysteine ligase, plant                    66.2    2e-09   Ostreococcus tauri
ref|WP_035612545.1|  glutamate--cysteine ligase                       65.9    3e-09   Hyphomonas johnsonii
ref|WP_034744831.1|  glutamate--cysteine ligase                       65.9    3e-09   Hyphomonas chukchiensis
ref|WP_013383393.1|  glutamate--cysteine ligase                       65.9    3e-09   Ketogulonicigenium vulgare
ref|WP_014537450.1|  glutamate--cysteine ligase                       65.9    3e-09   Ketogulonicigenium vulgare
ref|WP_028092401.1|  glutamate--cysteine ligase                       65.9    3e-09   Pseudodonghicola xiamenensis
ref|WP_007427205.1|  glutamate--cysteine ligase                       65.9    3e-09   Oceaniovalibus guishaninsula
ref|WP_012654088.1|  glutamate--cysteine ligase                       65.9    3e-09   Agrobacterium vitis
gb|KCZ53527.1|  glutamate--cysteine ligase                            65.9    3e-09   Hyphomonas chukchiensis
ref|WP_028098740.1|  glutamate--cysteine ligase                       65.9    3e-09   Dongia sp. URHE0060
ref|WP_011570131.1|  glutamate--cysteine ligase                       65.9    3e-09   Roseobacter denitrificans
ref|WP_008208925.1|  glutamate--cysteine ligase                       65.9    3e-09   Roseobacter sp. SK209-2-6
ref|WP_043745404.1|  glutamate--cysteine ligase                       65.5    4e-09   Magnetospirillum magneticum
emb|CCQ74722.1|  Glutamate--cysteine ligase                           65.5    4e-09   Magnetospira sp. QH-2
ref|WP_043136175.1|  glutamate--cysteine ligase                       65.5    4e-09   Mameliella alba
ref|WP_044559775.1|  glutamate--cysteine ligase                       65.1    5e-09   Azospirillum sp. B4
ref|WP_038005861.1|  MULTISPECIES: glutamate--cysteine ligase         65.1    5e-09   Thalassobacter
ref|WP_015826863.1|  glutamate--cysteine ligase                       65.1    5e-09   Hirschia baltica
ref|WP_036637388.1|  glutamate--cysteine ligase                       65.1    5e-09   Paenirhodobacter enshiensis
ref|WP_009870063.1|  COG3572: Gamma-glutamylcysteine synthetase       65.1    5e-09   Magnetospirillum magnetotacticum
ref|WP_021132910.1|  gamma-glutamylcysteine synthetase                65.1    5e-09   Phaeospirillum fulvum
emb|CAM77119.1|  Glutamate--cysteine ligase, plant                    65.1    6e-09   Magnetospirillum gryphiswaldense MSR-1
ref|WP_028287925.1|  glutamate--cysteine ligase                       65.1    6e-09   Pseudooceanicola nanhaiensis
ref|WP_027494082.1|  glutamate--cysteine ligase                       64.7    6e-09   Rhodanobacter sp. OR444
ref|WP_024082207.1|  Glutamate--cysteine ligase, chloroplastic        64.7    6e-09   Magnetospirillum gryphiswaldense
ref|WP_008614793.1|  gamma-glutamylcysteine synthetase                64.7    6e-09   Magnetospirillum caucaseum
ref|WP_043917987.1|  glutamate--cysteine ligase                       64.7    7e-09   Jannaschia aquimarina
ref|WP_041270803.1|  glutamate--cysteine ligase                       64.7    7e-09   Frateuria aurantia
ref|WP_036701928.1|  glutamate--cysteine ligase                       64.7    7e-09   Paracoccus sanguinis
ref|WP_007256884.1|  glutamate--cysteine ligase                       64.7    8e-09   Oceanicola granulosus
ref|WP_036707793.1|  glutamate--cysteine ligase                       64.3    8e-09   Paracoccus sanguinis
ref|WP_019463764.1|  glutamate--cysteine ligase                       64.3    8e-09   Dyella japonica
ref|WP_036733683.1|  glutamate--cysteine ligase                       64.3    8e-09   Paracoccus sanguinis
ref|WP_043131585.1|  glutamate--cysteine ligase                       64.3    8e-09   Paracoccus sanguinis
gb|AFC85239.1|  glutamate--cysteine ligase, plant type                64.3    9e-09   Frateuria aurantia DSM 6220
ref|WP_017463721.1|  glutamate--cysteine ligase                       64.3    9e-09   Dyella ginsengisoli
gb|ADI20112.1|  gamma-glutamylcysteine synthetase                     64.3    1e-08   uncultured alpha proteobacterium EB080_L06A09
ref|WP_026633958.1|  glutamate--cysteine ligase                       64.3    1e-08   Dyella
ref|WP_036179038.1|  glutamate--cysteine ligase                       63.9    1e-08   Maribius sp. MOLA 401
ref|WP_027081073.1|  glutamate--cysteine ligase                       63.9    1e-08   Luteimonas mephitis
ref|WP_008035160.1|  glutamate--cysteine ligase                       63.9    1e-08   Rhodobacterales bacterium HTCC2255
ref|WP_011628951.1|  glutamate--cysteine ligase                       63.9    1e-08   Alkalilimnicola ehrlichii
ref|WP_018147083.1|  glutamate--cysteine ligase                       63.9    1e-08   Henriciella marina
ref|WP_037991147.1|  glutamate--cysteine ligase                       63.5    1e-08   Thalassospira permensis
ref|WP_017931593.1|  hypothetical protein                             63.5    1e-08   Robiginitomaculum antarcticum
ref|WP_007091204.1|  glutamate--cysteine ligase                       63.5    1e-08   Thalassospira xiamenensis
ref|WP_025311017.1|  glutamate--cysteine ligase                       63.5    2e-08   Roseibacterium elongatum
ref|WP_034794187.1|  glutamate--cysteine ligase                       63.5    2e-08   Hyphomonas beringensis
ref|WP_039159936.1|  glutamate--cysteine ligase                       63.5    2e-08   Leisingera sp. ANG-M1
ref|WP_040849077.1|  glutamate--cysteine ligase                       63.5    2e-08   Nitrospirillum amazonense
ref|WP_015448887.1|  MULTISPECIES: glutamate--cysteine ligase         63.5    2e-08   Rhodanobacter
ref|WP_007513778.1|  glutamate--cysteine ligase                       63.5    2e-08   Rhodanobacter denitrificans
ref|WP_028958648.1|  glutamate--cysteine ligase                       63.5    2e-08   Sulfitobacter sp. 20_GPM-1509m
ref|WP_037924320.1|  glutamate--cysteine ligase                       63.2    2e-08   Sulfitobacter pseudonitzschiae
ref|WP_024088897.1|  glutamate--cysteine ligase                       63.2    2e-08   Leisingera methylohalidivorans
ref|WP_036716534.1|  glutamate--cysteine ligase                       63.2    2e-08   Paracoccus sphaerophysae
ref|WP_035583514.1|  glutamate--cysteine ligase                       63.2    2e-08   Hyphomonas jannaschiana
ref|WP_029011247.1|  glutamate--cysteine ligase                       63.2    2e-08   Azospirillum halopraeferens
ref|WP_014416028.1|  glutamate--cysteine ligase                       63.2    2e-08   Pararhodospirillum photometricum
ref|WP_027241581.1|  glutamate--cysteine ligase                       63.2    2e-08   Pseudophaeobacter arcticus
ref|WP_011049305.1|  glutamate--cysteine ligase                       63.2    2e-08   Ruegeria pomeroyi
ref|WP_025047965.1|  glutamate--cysteine ligase                       63.2    2e-08   Sulfitobacter
ref|WP_009809702.1|  glutamate--cysteine ligase                       63.2    2e-08   
ref|WP_008891547.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_028030001.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_007118944.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_037909876.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_020591012.1|  hypothetical protein                             62.8    3e-08   
ref|WP_005859104.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_044826967.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_042619088.1|  glutamate--cysteine ligase                       62.8    3e-08   
ref|WP_012179758.1|  glutamate--cysteine ligase                       62.4    3e-08   
ref|WP_043099349.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_039181640.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_039173812.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_039149394.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_039191673.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_021693638.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_019297147.1|  MULTISPECIES: glutamate--cysteine ligase         62.4    4e-08   
ref|WP_008215925.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_037244759.1|  glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_009563049.1|  Glutamate--cysteine ligase                       62.4    4e-08   
ref|WP_002721323.1|  glutamate--cysteine ligase                       62.4    5e-08   
ref|WP_015921392.1|  glutamate--cysteine ligase                       62.0    5e-08   
gb|KCZ97952.1|  glutamate--cysteine ligase                            62.0    5e-08   
ref|WP_038036730.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_008561563.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_038621702.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_010141018.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_026613047.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_008554755.1|  glutamate--cysteine ligase                       62.0    5e-08   
ref|WP_011338651.1|  glutamate--cysteine ligase                       62.0    6e-08   
ref|WP_039688281.1|  glutamate--cysteine ligase                       62.0    6e-08   
ref|WP_010443590.1|  glutamate--cysteine ligase                       62.0    6e-08   
ref|WP_008944552.1|  glutamate--cysteine ligase                       61.6    6e-08   
ref|WP_020038423.1|  glutamate--cysteine ligase                       61.6    6e-08   
ref|WP_035262427.1|  glutamate--cysteine ligase                       61.6    6e-08   
ref|WP_039131405.1|  glutamate--cysteine ligase                       61.6    6e-08   
ref|WP_018971758.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_027235179.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_042463612.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_035599559.1|  glutamate--cysteine ligase                       61.6    7e-08   
gb|ABI75913.1|  glutamate--cysteine ligase                            61.6    7e-08   
ref|WP_027840761.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_028919288.1|  glutamate--cysteine ligase                       61.6    7e-08   
dbj|GAN45514.1|  glutamate--cysteine ligase                           61.6    7e-08   
ref|WP_024868542.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_035528788.1|  glutamate--cysteine ligase                       61.6    7e-08   
ref|WP_035590604.1|  MULTISPECIES: glutamate--cysteine ligase         61.6    8e-08   
ref|WP_011388328.1|  glutamate--cysteine ligase                       61.6    8e-08   
ref|WP_013536404.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_025045830.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_007668376.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_035571182.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_022694894.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_027256476.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_009825249.1|  glutamate--cysteine ligase                       61.2    9e-08   
ref|WP_033069251.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_025059631.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_005849673.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_037944812.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_018289050.1|  hypothetical protein                             61.2    1e-07   
ref|WP_043948471.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_037966014.1|  glutamate--cysteine ligase                       61.2    1e-07   
ref|WP_020044267.1|  hypothetical protein                             61.2    1e-07   
ref|WP_029418256.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_027244640.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_034223844.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_008331213.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_026940724.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_008280351.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_027298647.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_039522877.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_024098545.1|  glutamate--cysteine ligase, plant type           60.8    1e-07   
ref|WP_040171354.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_040180655.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_014873403.1|  MULTISPECIES: glutamate--cysteine ligase         60.8    1e-07   
ref|WP_017929555.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_043958070.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_037316513.1|  glutamate--cysteine ligase                       60.8    1e-07   
ref|WP_025054601.1|  glutamate--cysteine ligase                       60.8    1e-07   
gb|KIQ97509.1|  Glutamate--cysteine ligase                            60.8    1e-07   
ref|WP_020055049.1|  hypothetical protein                             60.5    2e-07   
ref|WP_008755986.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_037378992.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_011841809.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_019953566.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_037105932.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_035100257.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_035047089.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_042696029.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_022571217.1|  glutamate--cysteine ligase, plant type           60.5    2e-07   
gb|AEG03327.1|  glutamate/cysteine ligase                             60.5    2e-07   
ref|WP_007808142.1|  glutamate--cysteine ligase                       60.5    2e-07   
emb|CCM66472.1|  glutamate--cysteine ligase precursor protein         60.5    2e-07   
ref|WP_013077468.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_026618399.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_036212296.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_018631656.1|  hypothetical protein                             60.5    2e-07   
ref|WP_028770479.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|WP_027135070.1|  glutamate--cysteine ligase                       60.5    2e-07   
ref|XP_005976798.1|  PREDICTED: glutamate--cysteine ligase, chlor...  60.5    2e-07   
ref|WP_036138872.1|  glutamate--cysteine ligase                       59.7    2e-07   
dbj|GAK70160.1|  putative glutamate--cysteine ligase                  60.1    2e-07   
ref|WP_026030461.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_035707859.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_012973384.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_024843638.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_028010423.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_026168539.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_003527223.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_027990498.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_010968802.1|  glutamate--cysteine ligase                       60.1    2e-07   
gb|KCZ51869.1|  glutamate--cysteine ligase                            60.1    2e-07   
ref|WP_035745514.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_027999595.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_022698585.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_037269048.1|  glutamate--cysteine ligase                       60.1    2e-07   
ref|WP_037211212.1|  glutamate--cysteine ligase                       60.1    3e-07   
gb|KJB50111.1|  hypothetical protein B456_008G154200                  56.6    3e-07   
ref|WP_036137292.1|  glutamate--cysteine ligase                       60.1    3e-07   
ref|WP_026758219.1|  glutamate--cysteine ligase                       60.1    3e-07   
ref|WP_034852032.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_009819233.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_037133094.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_013268243.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_008227367.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_007206794.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_022707282.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_028717858.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_009805745.1|  glutamate--cysteine ligase                       59.7    3e-07   
ref|WP_039018738.1|  glutamate--cysteine ligase                       59.7    3e-07   
gb|KCZ59182.1|  glutamate--cysteine ligase                            59.7    3e-07   
ref|WP_007081607.1|  glutamate--cysteine ligase                       59.7    4e-07   
ref|WP_035076274.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_027069933.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_038272234.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_005414465.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_029958704.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_014648396.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_014038468.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_043400077.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_005419277.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_011749120.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_024956060.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_021203943.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_019662096.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_005411018.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_029041764.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_022704956.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_033835224.1|  glutamate--cysteine ligase                       59.3    4e-07   
ref|WP_032129893.1|  glutamate--cysteine ligase                       59.3    5e-07   
emb|CAP50142.1|  glutamate-cysteine ligase                            59.3    5e-07   
ref|WP_034825230.1|  glutamate--cysteine ligase                       59.3    5e-07   
gb|KGM54711.1|  glutamate--cysteine ligase                            59.3    5e-07   
ref|WP_020085081.1|  glutamate--cysteine ligase                       59.3    5e-07   
ref|WP_035554031.1|  glutamate--cysteine ligase                       58.9    5e-07   
ref|WP_024354517.1|  glutamate--cysteine ligase                       58.9    5e-07   
ref|WP_025063362.1|  glutamate--cysteine ligase                       58.9    5e-07   
ref|WP_015496691.1|  glutamate--cysteine ligase                       58.9    5e-07   
ref|WP_025977737.1|  glutamate--cysteine ligase                       58.9    5e-07   
ref|XP_005977097.1|  PREDICTED: glutamate--cysteine ligase, chlor...  58.9    5e-07   
ref|WP_004623350.1|  glutamate--cysteine ligase, plant type           58.9    6e-07   
ref|WP_011536696.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_007797378.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_007196210.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_008187808.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_022969328.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_036756177.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_007812764.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_026873097.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_023512633.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_014761271.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_028916629.1|  glutamate--cysteine ligase                       58.9    6e-07   
ref|WP_017998317.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_027673864.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_039718559.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_011907279.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_018182707.1|  hypothetical protein                             58.5    7e-07   
ref|WP_018238893.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_008030431.1|  glutamate--cysteine ligase                       58.5    7e-07   
ref|WP_019183743.1|  glutamate--cysteine ligase                       58.5    8e-07   
ref|WP_028038147.1|  glutamate--cysteine ligase                       58.5    8e-07   
ref|WP_038686277.1|  glutamate--cysteine ligase                       58.5    8e-07   
ref|WP_035029482.1|  MULTISPECIES: glutamate--cysteine ligase         58.5    8e-07   
ref|WP_005640786.1|  glutamate--cysteine ligase                       58.5    8e-07   
ref|WP_036109768.1|  MULTISPECIES: glutamate--cysteine ligase         58.5    9e-07   
ref|WP_043696285.1|  glutamate--cysteine ligase                       58.5    9e-07   
ref|WP_009175638.1|  glutamate--cysteine ligase                       58.5    9e-07   
ref|WP_037413227.1|  glutamate--cysteine ligase                       58.2    9e-07   
ref|WP_014247076.1|  glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_042248429.1|  glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_035837697.1|  glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_018688648.1|  MULTISPECIES: hypothetical protein               58.2    1e-06   
ref|WP_020949400.1|  glutamate-cysteine ligase                        58.2    1e-06   
ref|WP_021101289.1|  Glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_003169608.1|  glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_025050606.1|  glutamate--cysteine ligase                       58.2    1e-06   
ref|WP_009160051.1|  glutamate--cysteine ligase                       58.2    1e-06   
gb|KIX18185.1|  glutamate--cysteine ligase                            58.2    1e-06   
ref|WP_035253302.1|  glutamate--cysteine ligase                       57.8    1e-06   
gb|ESQ83799.1|  glutamate--cysteine ligase                            57.8    1e-06   
ref|WP_008232865.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_018329984.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_027287248.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_005979126.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_034834449.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_039615750.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|XP_001418312.1|  gamma-glutamate cysteine synthase                57.8    1e-06   
ref|WP_019399013.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_029075850.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_028915165.1|  glutamate--cysteine ligase                       57.8    1e-06   
gb|KGQ18054.1|  Glutamate-cysteine ligase                             57.8    1e-06   
ref|WP_036138179.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_043094767.1|  glutamate--cysteine ligase                       57.8    1e-06   
emb|CCP17893.1|  glutamate--cysteine ligase                           57.8    1e-06   
ref|WP_003163908.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_036170843.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_009849847.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_027262077.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_036515476.1|  glutamate--cysteine ligase                       57.8    1e-06   
ref|WP_010480897.1|  glutamate--cysteine ligase [                     57.8    2e-06   
ref|WP_039540655.1|  glutamate--cysteine ligase                       57.8    2e-06   



>ref|XP_006343987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Solanum 
tuberosum]
Length=523

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS  385
            MALMS AGSS HC   E IRC  G +N  NN+E ++M+E+ FG++ SS N+S+ VQG   
Sbjct  1    MALMSQAGSS-HCIYSEKIRCIGGHSNIMNNMEMFKMREICFGVDISSRNASRRVQGNHL  59

Query  386  NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG  565
            N IG G RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct  60   NLIGVGSRRGGLTIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKTKEKWRIGTEHEKFG  119

Query  566  FEFGTLRPMKYAQIAELLNGIAERFDW  646
            FEFGTLRPMKY QIA+LLNGIAERFDW
Sbjct  120  FEFGTLRPMKYDQIADLLNGIAERFDW  146



>ref|NP_001234010.1| glutamate--cysteine ligase, chloroplastic [Solanum lycopersicum]
 sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Solanum lycopersicum]
 gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
Length=523

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS  385
            MALMS AGSS HC   E +RC +G  +  NN++ +RM+E+ FG++ SS N+S+ VQG   
Sbjct  1    MALMSQAGSS-HCIYSEKVRCISGHRSIINNMDMFRMREICFGVDISSRNASRRVQGNYL  59

Query  386  NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG  565
            N IG G RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct  60   NHIGVGSRRGDLTIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKSKEKWRIGTEHEKFG  119

Query  566  FEFGTLRPMKYAQIAELLNGIAERFDW  646
            FEFGTLRPMKY QIA+LLNGIAERFDW
Sbjct  120  FEFGTLRPMKYDQIADLLNGIAERFDW  146



>ref|XP_010325297.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Solanum lycopersicum]
 gb|ACQ91100.1| GSH1 [Solanum lycopersicum]
Length=523

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS  385
            MALMS AGSS HC   E +RC +G  +  NN++ +RM+E+ FG++ SS N+S+ VQG   
Sbjct  1    MALMSQAGSS-HCIYSEKVRCISGHRSIINNMDMFRMREICFGVDISSRNASRRVQGNYL  59

Query  386  NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG  565
            N IG G RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct  60   NHIGVGSRRGDLTIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKSKEKWRIGTEHEKFG  119

Query  566  FEFGTLRPMKYAQIAELLNGIAERFDW  646
            FEFGTLRPMKY QIA+LLNGIAERFDW
Sbjct  120  FEFGTLRPMKYDQIADLLNGIAERFDW  146



>ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
tomentosiformis]
Length=522

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS  385
            MALMS AGSS HC   E ++C +G  +  NN+E  +MKE+ FG N SS NSS+ +QG+  
Sbjct  1    MALMSQAGSS-HCIYSEKMKCISGHNSITNNMEMLKMKEICFG-NISSRNSSKRMQGIYL  58

Query  386  NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG  565
            + +    RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct  59   DRVVMERRRGRLAIVAASPPTEDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFG  118

Query  566  FEFGTLRPMKYAQIAELLNGIAERFDW  646
            FEFG+LRPMKY QIAELLNGIAERFDW
Sbjct  119  FEFGSLRPMKYEQIAELLNGIAERFDW  145



>gb|AFP93564.1| GCS [Cestrum nocturnum]
Length=518

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 111/146 (76%), Gaps = 7/146 (5%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN  388
            MALMS AGSS  +H E IRC+ G     +N+E +++KE+ FG++ S  NSS A QG+   
Sbjct  1    MALMSQAGSSHCIHPEKIRCKGG-----HNMEIFKLKEICFGVHISPRNSSNAKQGICLR  55

Query  389  CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF  568
             +GA  RR    IVAASPPT+DAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFGF
Sbjct  56   RVGAERRRGRLSIVAASPPTDDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFGF  115

Query  569  EFGTLRPMKYAQIAELLNGIAERFDW  646
            EFGTLRPM Y QIAELL G++ERFDW
Sbjct  116  EFGTLRPMNYEQIAELLYGVSERFDW  141



>gb|EYU23478.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
 gb|EYU23479.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
Length=526

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEA---GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MALMS  G+S  +H E ++C+A   G  +  + +E+ + KE+ FGL   SW+S +  Q  
Sbjct  1    MALMSHPGASPCIHTEAVQCKARNYGVNSFTSTMESAKTKEIFFGLRSPSWSSLKVAQKW  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S+    G RR H + VAASPPTEDAV++TEPLTK+DL+DYL SGCKPK+KWRIGTEHEK
Sbjct  61   SSDSTEVGQRRGHRVTVAASPPTEDAVIATEPLTKQDLVDYLASGCKPKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPM Y QI++LLNGI+ERFDW
Sbjct  121  FGFEIETLRPMTYEQISDLLNGISERFDW  149



>ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
sylvestris]
 sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Nicotiana tabacum]
 gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
Length=522

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 115/147 (78%), Gaps = 5/147 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS  385
            MALMS AGSS HC   E ++C +G ++  +N+E  +MK++ FG N SS NSS+ +QG+  
Sbjct  1    MALMSQAGSS-HCIYSEKMKCISGHSSITSNMEMLKMKDICFG-NISSRNSSKPMQGIYL  58

Query  386  NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG  565
            + +G   RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct  59   DRVGVERRRGRLAIVAASPPTEDAVVAAEPLTKEDLVAYLASGCKSKEKWRIGTEHEKFG  118

Query  566  FEFGTLRPMKYAQIAELLNGIAERFDW  646
            FEFGTLRPMKY QIAELLNGIAERFDW
Sbjct  119  FEFGTLRPMKYEQIAELLNGIAERFDW  145



>dbj|BAP47506.1| gamma-glutamylcysteine synthetase [Gentiana triflora]
Length=526

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGC-TNSGN--NLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MALMS AGSS  +  E++R +AG  T SG   ++E  + KE+ FGL+ SS  S +A+Q L
Sbjct  1    MALMSQAGSSYCIQSEVLRGKAGQNTVSGLLCHVEGSKAKEVLFGLHSSSLVSPKAIQSL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                     R RH +IVAASPPTEDAVV+ EPLTK DL++YL SGCKPKE+WRIGTEHEK
Sbjct  61   NLESPRKLLRHRHQVIVAASPPTEDAVVAAEPLTKDDLVEYLKSGCKPKEQWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEFGTLRPMKY QI+ELL  I+ERFDW
Sbjct  121  FGFEFGTLRPMKYQQISELLYSISERFDW  149



>ref|XP_011080960.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEA---GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MALMS +GSS  +H E  +C++   G  +  + +EA + K + FG + +SW+S +A +G 
Sbjct  1    MALMSHSGSSHCIHSETTQCKSRYNGVNSFADKMEAAKAKGIIFGFHPASWSSLKATKGW  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G RR H + VAASPPTEDAV+++EPLTK++L+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   SLDGSEVGQRRGHCVTVAASPPTEDAVIASEPLTKEELVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTL+PMKY QI ELLNG++ERFDW
Sbjct  121  FGFEIGTLKPMKYEQIEELLNGLSERFDW  149



>emb|CDP09740.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MALMS AG S  +  E++RC+AG     +   ++E  ++K++ F   FSS N S+     
Sbjct  90   MALMSQAGPSYCVQPEIVRCKAGHGVVYSLTGSMEGSKVKDVCFDFRFSSSNLSK-----  144

Query  380  RSNCIGAG-YRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +    G G  +RRH +IVAASPPTEDAVV+ EPLTK+DL+ YL SGCKPKEKWRIGTEHE
Sbjct  145  QRRSYGPGESKRRHQVIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKPKEKWRIGTEHE  204

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFEFGTLRPMKY QIAELLN I+ERFDW
Sbjct  205  KFGFEFGTLRPMKYEQIAELLNSISERFDW  234



>gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
Length=526

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S AG S  +  ++ RC+          +N++A ++KE     +  S NSS+  + L
Sbjct  1    MTLVSQAGPSYCIPTDISRCKTAQNVVIGMASNIDASKLKETPARFSSLSCNSSKTPKIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S C+  G +R H  +VAASPPTEDAVV+TEPLTK+DLI YL SGCKPKE WRIGTEHEK
Sbjct  61   SSECLSVGMKRGHQFVVAASPPTEDAVVATEPLTKEDLIRYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  121  FGFEIGTLRPMKYEQIAELLHGIAERFDW  149



>ref|XP_002304493.2| hypothetical protein POPTR_0003s12700g [Populus trichocarpa]
 gb|EEE79472.2| hypothetical protein POPTR_0003s12700g [Populus trichocarpa]
Length=491

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S AG S  +  ++ RC+          +N++A ++KE     +  S NSS+  + L
Sbjct  1    MTLVSQAGPSYCIPTDISRCKTAQNVVIGMASNIDASKLKETPARFSSLSCNSSKTPKIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S C+  G +R H  +VAASPPTEDAVV+TEPLTK+DLI YL SGCKPKE WRIGTEHEK
Sbjct  61   SSECLSVGMKRGHQFVVAASPPTEDAVVATEPLTKEDLIRYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  121  FGFEIGTLRPMKYEQIAELLHGIAERFDW  149



>ref|XP_010089108.1| Glutamate--cysteine ligase [Morus notabilis]
 gb|EXB37355.1| Glutamate--cysteine ligase [Morus notabilis]
Length=582

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 111/150 (74%), Gaps = 7/150 (5%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLN-FSSWNSSQAVQG  376
            MAL+S AGSS  +  E+IR ++G     N G+NLEA R+K+   G +  S   +++    
Sbjct  1    MALISQAGSSYCVQSEVIRSKSGHNAIFNIGSNLEASRVKDNFVGASSLSCTFAAKKTNI  60

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            L  +C   G +R H +IVAASPPTEDAV + EPLTK+DLI YL SGCKPKEKWRIGTEHE
Sbjct  61   LHLDCARLGRKRGHHVIVAASPPTEDAV-AAEPLTKEDLIAYLASGCKPKEKWRIGTEHE  119

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFEFGTLRPM+Y QI+ELLNGIAERFDW
Sbjct  120  KFGFEFGTLRPMRYEQISELLNGIAERFDW  149



>ref|XP_008351685.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=165

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L    GSS  +  E+ R ++G     +  N+++A ++KE S G +   ++S+   Q L
Sbjct  1    MGLFLQMGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSTSKAQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                 G G +R H +IV ASPPTEDAV++TEPLTK+DL+ YL SGCK K+KWRIGTEHEK
Sbjct  61   HIANAGVGQKRGHSVIVTASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGF+  TLRP+KY QIAELLNGI+ER+DW
Sbjct  121  FGFDRKTLRPIKYEQIAELLNGISERYDW  149



>ref|XP_011029270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAG--SSLHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L++ AG  SS+  E+ RC+A          + +AY++KE     +  S NSS+  Q L
Sbjct  1    MTLVAQAGPSSSILTEISRCKAAQNVVIAMARSTDAYKLKETPPRFSSLSCNSSKTPQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S  +  G +R   ++VAASPPTEDAV++TEPLTK+DLI YL SGCKPKE WRIGTEHEK
Sbjct  61   SSESLSVGMKRGRRVVVAASPPTEDAVIATEPLTKEDLIGYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  121  FGFEIGTLRPMKYEQIAELLHGIAERFDW  149



>ref|XP_011022699.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S AG S  +  ++IRC+          +N++A ++KE     +  S NSS+  + L
Sbjct  1    MTLVSQAGPSYCIPADIIRCKTAQNVVIGMASNMDASKLKETPARFSSLSCNSSKTPKIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S  +  G +R H  +V ASPPTEDAV++TEPLTK+DLI YL SGCKPKE WRIGTEHEK
Sbjct  61   SSESLSVGMKRGHQFVVNASPPTEDAVIATEPLTKEDLIRYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  121  FGFEMGTLRPMKYEQIAELLHGIAERFDW  149



>ref|XP_007209899.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
 gb|EMJ11098.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
Length=526

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGCT---NSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+   GSS  +  E+ R + G     +  NN+EA ++KE   G +  S  SS+  Q L
Sbjct  1    MALLLQMGSSYCIRTEIFRHKCGQNVGLSRANNIEAAKLKENCIGFSSVSCFSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G++R H +IVAASPPTEDAV+ TEPLTK+DL+ YL SGCKPKE WRIGTEHEK
Sbjct  61   HVDDAVLGHKRGHSVIVAASPPTEDAVIVTEPLTKEDLVGYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QIAELLNGI+ERFDW
Sbjct  121  FGFELKTLRPMKYEQIAELLNGISERFDW  149



>ref|XP_009350439.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X4 [Pyrus x bretschneideri]
Length=447

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_002273626.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660724.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660727.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 emb|CBI34672.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+   G S  +  E++ C+ G     N  NN+EA ++KE    L+  S + ++    L
Sbjct  1    MALVPQTGPSYCMRSEVVHCKTGQSAVVNMTNNMEASKIKETRTWLSSLSRSRTKTKHIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              + +G G ++RH +IVAASPPTEDAVV+TEPLT++DLI YL SGCKPKEKWRIGTEHEK
Sbjct  61   SPDSVGVGCKQRHQVIVAASPPTEDAVVATEPLTREDLIGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEF TLRPM+Y QI+ELL G++ERF W
Sbjct  121  FGFEFRTLRPMRYEQISELLYGVSERFGW  149



>ref|XP_009350438.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Pyrus x bretschneideri]
Length=455

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=503

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_009350436.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=526

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLLSQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>gb|AHJ60103.1| gamma-glutamylcysteine synthetase [Pyrus betulifolia]
Length=526

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNAGVGQKRGHTVIVAASPPTEDAVIATEPLTKEDLVAYLVSGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_008238836.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238837.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238838.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
Length=526

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 104/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGCT---NSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+   GSS  +  E+ R ++G     +  NN+EA ++KE   G +  S  S +  Q  
Sbjct  1    MALLLQMGSSYCIRTEIFRHKSGQNVGLSRANNIEAAKLKENCIGFSSVSCYSPRKTQIF  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G++R H +IVAASPPTEDAV+ TEPLTK+DL+ YL SGCKPKE WRIGTEHEK
Sbjct  61   HVDNAVLGHKRGHSVIVAASPPTEDAVIVTEPLTKEDLVGYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QIAELLNGI+ERFDW
Sbjct  121  FGFELKTLRPMKYEQIAELLNGISERFDW  149



>ref|XP_011463882.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCI  394
            MAL+S  GSS +C  IR E    +   N+EA ++K+   G +  S NS++  Q L  +  
Sbjct  1    MALISQTGSS-YC--IRTEV--FSRAGNVEASKLKDNCVGFSSFSCNSARKTQILHMDNA  55

Query  395  GAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEF  574
            G G +R   ++VAASPPTEDAV++TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE 
Sbjct  56   GVGLKRCGSVVVAASPPTEDAVIATEPLTKEDLVAYLASGCKPKEAWRIGTEHEKFGFEL  115

Query  575  GTLRPMKYAQIAELLNGIAERFDW  646
             TLRPMKY QI+ELLNGIAERFDW
Sbjct  116  KTLRPMKYEQISELLNGIAERFDW  139



>ref|XP_002298035.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
 gb|EEE82840.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
Length=526

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAG--SSLHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L++ AG  SS+  E+ RC+A          + +A ++KE     +  S NSS+  Q L
Sbjct  1    MTLVAQAGPSSSILKEISRCKAAQNVVIAMARSTDASKLKETPPRFSSLSCNSSKTPQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S  +  G +R H ++VAASPPTEDAV++TEPLTK+DLI YL SGCKPKE WRIGTEHEK
Sbjct  61   SSESLSVGMKRGHRVVVAASPPTEDAVIATEPLTKEDLIGYLASGCKPKENWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIA LL+GIAERFDW
Sbjct  121  FGFEIGTLRPMKYEQIAGLLHGIAERFDW  149



>ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 ref|XP_007040226.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24726.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24727.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
Length=525

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +2

Query  293  NNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTE  472
            NNLEA  MKE S   +    N ++  +      +G G +RR+ +IVAASPPTEDAV++TE
Sbjct  31   NNLEAPIMKEKSVSFSSLLCNKAKIARIFPLETVGFGRKRRNSMIVAASPPTEDAVIATE  90

Query  473  PLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            PLTK+DL+ YL SGCKPKEKWRIGTEHEKFGFEF TLRPMKY QIAELLNGI+ERFDW
Sbjct  91   PLTKEDLVAYLASGCKPKEKWRIGTEHEKFGFEFKTLRPMKYEQIAELLNGISERFDW  148



>ref|XP_006439555.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52795.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=465

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRC---EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S A  S  +  ++ RC    +G      N EA RMKE     + SS  S++  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G RR    IVAASPPTEDAVV TEPLTK+DL+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   HLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEFGTLRPMKY QIAELLN IAERFDW
Sbjct  121  FGFEFGTLRPMKYEQIAELLNSIAERFDW  149



>ref|XP_010053261.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=556

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AG S  L  E++R  +G        NN+E  R K M      SS  SS+    L
Sbjct  1    MALISNAGPSCKLGNEIMRSRSGYDLVFGPINNVETARTKMMCLNFPSSSRCSSKIAHAL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
            R + +  G +RR  +IVAASPPTED  V+TEPLTK+DLI YL SGCKPKEKWRIGTEHEK
Sbjct  61   RIDDVSRGCKRRRQVIVAASPPTEDVAVATEPLTKEDLIAYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QI+ELL GI+ERFDW
Sbjct  121  FGFEIQTLRPMKYEQISELLYGISERFDW  149



>ref|XP_010053262.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW77521.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=526

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AG S  L  E++R  +G        NN+E  R K M      SS  SS+    L
Sbjct  1    MALISNAGPSCKLGNEIMRSRSGYDLVFGPINNVETARTKMMCLNFPSSSRCSSKIAHAL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
            R + +  G +RR  +IVAASPPTED  V+TEPLTK+DLI YL SGCKPKEKWRIGTEHEK
Sbjct  61   RIDDVSRGCKRRRQVIVAASPPTEDVAVATEPLTKEDLIAYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QI+ELL GI+ERFDW
Sbjct  121  FGFEIQTLRPMKYEQISELLYGISERFDW  149



>ref|XP_008341055.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Malus domestica]
Length=526

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNARVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_006439553.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 ref|XP_006439554.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52793.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52794.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=526

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRC---EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S A  S  +  ++ RC    +G      N EA RMKE     + SS  S++  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G RR    IVAASPPTEDAVV TEPLTK+DL+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   HLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEFGTLRPMKY QIAELLN IAERFDW
Sbjct  121  FGFEFGTLRPMKYEQIAELLNSIAERFDW  149



>ref|XP_008341054.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=547

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNARVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_006439556.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52796.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=487

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRC---EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S A  S  +  ++ RC    +G      N EA RMKE     + SS  S++  Q L
Sbjct  1    MTLISRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G RR    IVAASPPTEDAVV TEPLTK+DL+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   HLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEFGTLRPMKY QIAELLN IAERFDW
Sbjct  121  FGFEFGTLRPMKYEQIAELLNSIAERFDW  149



>ref|XP_008341053.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=550

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+S  GSS  +  E+ R ++G     +  NN+EA ++KE S G +  S++SS+  Q L
Sbjct  1    MVLISQTGSSYCIRTELFRYKSGQNVVFSRANNIEASKLKENSIGFSSVSYSSSRKTQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +    G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   HIDNARVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  121  FGFELKTLRPIKYEQIAELLNVISERFDW  149



>ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
Length=526

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 103/149 (69%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSSLHC--EMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M ++S AG S +   ++ RC+ G        N++E  ++KE     +  S NS++  Q  
Sbjct  1    MPVISQAGPSCYVPTDITRCKTGQNAVLGVFNSIETSKLKETCVRFSSLSCNSTKIPQLP  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             S       RR + +IVAASPP EDAV++TEPLTK+DL+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   SSENSWVRSRRGNQMIVAASPPIEDAVIATEPLTKEDLVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE GTLRPMKY QIAELLNGIAERFDW
Sbjct  121  FGFELGTLRPMKYEQIAELLNGIAERFDW  149



>ref|XP_011072645.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
 ref|XP_011072650.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 102/150 (68%), Gaps = 7/150 (5%)
 Frame = +2

Query  215  MALMSMAGSSLHC---EMIRCEA---GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MALMS   SSLHC   E I+ +A   G  N  + +   + KE+ FG   +S +  +A Q 
Sbjct  1    MALMSHP-SSLHCVCTETIQPKARYNGVNNISSTMGTAKSKEICFGFRPASQSFLKAAQS  59

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
               +      +R H L VAASPPTEDAV++TEPLTK+DL+ YL SGCKPK  WRIGTEHE
Sbjct  60   WSMDDTEVQRKRGHWLTVAASPPTEDAVIATEPLTKEDLVGYLASGCKPKANWRIGTEHE  119

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPM YAQIAELLNGI+ERFDW
Sbjct  120  KFGFEIATLRPMNYAQIAELLNGISERFDW  149



>ref|XP_009364919.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364920.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364921.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364922.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=526

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L S  GSS  +  E+ R ++G     +  N+++A ++KE S G +   ++SS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                 G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK K+KWRIGTEHEK
Sbjct  61   HIANAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLNGI+ER+DW
Sbjct  121  FGFERKTLRPIKYEQIAELLNGISERYDW  149



>ref|XP_009364899.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364900.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364901.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364902.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364956.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=526

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L S  GSS  +  E+ R ++G     +  N+++A ++KE S G +   ++SS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                 G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK K+KWRIGTEHEK
Sbjct  61   HIANAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLNGI+ER+DW
Sbjct  121  FGFERKTLRPIKYEQIAELLNGISERYDW  149



>ref|XP_009364953.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364954.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=537

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L S  GSS  +  E+ R ++G     +  N+++A ++KE S G +   ++SS   Q L
Sbjct  1    MVLFSQTGSSYCIRTELFRYKSGKNVVFSRANSIDASKLKENSIGFSSLLYSSSSKAQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                 G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK K+KWRIGTEHEK
Sbjct  61   HIANAGVGQKRGHSVIVAASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRP+KY QIAELLNGI+ER+DW
Sbjct  121  FGFERKTLRPIKYEQIAELLNGISERYDW  149



>ref|XP_010540840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=508

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 103/152 (68%), Gaps = 13/152 (9%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGN--------NLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S AG +  C  +   A C+ +GN        NLE  +MKE    ++F S + S   
Sbjct  1    MALVSQAGGT--CS-VPSGAVCSKTGNKAGPGSVRNLEMSKMKETY--VSFCSRSKSSEK  55

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              LRSN  G   +R   +IVA S PTEDA V+TEPLTK+DLI YL SGCKPKEKWRIGTE
Sbjct  56   MLLRSNDNGKRSKRGRQVIVATSAPTEDAAVATEPLTKEDLIGYLASGCKPKEKWRIGTE  115

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRPMKY QIAELLNGIAERFDW
Sbjct  116  HEKFGFEVNTLRPMKYEQIAELLNGIAERFDW  147



>ref|XP_010540831.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=524

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 103/152 (68%), Gaps = 13/152 (9%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGN--------NLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S AG +  C  +   A C+ +GN        NLE  +MKE    ++F S + S   
Sbjct  1    MALVSQAGGT--CS-VPSGAVCSKTGNKAGPGSVRNLEMSKMKETY--VSFCSRSKSSEK  55

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              LRSN  G   +R   +IVA S PTEDA V+TEPLTK+DLI YL SGCKPKEKWRIGTE
Sbjct  56   MLLRSNDNGKRSKRGRQVIVATSAPTEDAAVATEPLTKEDLIGYLASGCKPKEKWRIGTE  115

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRPMKY QIAELLNGIAERFDW
Sbjct  116  HEKFGFEVNTLRPMKYEQIAELLNGIAERFDW  147



>ref|XP_006476577.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476578.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=526

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRC---EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L+  A  S  +  ++ RC    +G      N EA RMKE     + SS  S++  Q L
Sbjct  1    MTLILRASPSCRVLTDVTRCTIRRSGVCGLAKNAEASRMKETCVSFSSSSRYSAKISQVL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
              +  G G RR    IVAASPPTEDAVV TEPLTK+DL+ YL SGCKPKEKWRIGTEHEK
Sbjct  61   HLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDLVGYLASGCKPKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFEFGTL PMKY QIAELLN IAERFDW
Sbjct  121  FGFEFGTLHPMKYEQIAELLNSIAERFDW  149



>dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
Length=523

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 12/151 (8%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGCT---NSGNNLEAYRMK--EMSFGLNFSSWNSSQAVQ  373
            M LMS A  S  +H E+++ ++G +   N  +N  A+R +  +++F  N+  +      Q
Sbjct  1    MVLMSQASPSHGIHAEILQSKSGYSSLLNGASNTNAFRHQTSKVAFSRNYLKYT-----Q  55

Query  374  GLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEH  553
             +  + +G  ++R + +IVAASPPTEDAVV+TEPLTK+DL+ YL SGCKPKE WRIGTEH
Sbjct  56   AMHVDAVGGNFKRGNKVIVAASPPTEDAVVATEPLTKEDLVGYLASGCKPKENWRIGTEH  115

Query  554  EKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            EKFGF+  TLRPM Y QIA LLN I+ERFDW
Sbjct  116  EKFGFDLKTLRPMTYEQIAHLLNAISERFDW  146



>gb|KJB37542.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=490

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 103/149 (69%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AGSS  +  ++ R   G        NN+EA  MKE S  ++  S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                +G   + R+ +IVAASPPTEDA+++ EPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QIAELLNGI+ERFDW
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDW  149



>ref|XP_008360718.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase, chloroplastic-like 
[Malus domestica]
Length=430

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            M L    GSS  +  E+ R ++G     +  N+++A ++KE S G +   ++S+   Q L
Sbjct  1    MGLFLQMGSSYCIRTELFRYKSGKNVVFSRXNSIDASKLKENSIGFSSLLYSSTSKAQIL  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                 G G +R H +IV ASPPTEDAV++TEPLTK+DL+ YL SGCK K+KWRIGTEHEK
Sbjct  61   HIANAGVGQKRGHSVIVTASPPTEDAVIATEPLTKEDLVAYLASGCKSKDKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGF+  TLRP+KY QIAELLNGI+ER+DW
Sbjct  121  FGFDRKTLRPIKYEQIAELLNGISERYDW  149



>gb|KJB37541.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=527

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 103/149 (69%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AGSS  +  ++ R   G        NN+EA  MKE S  ++  S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                +G   + R+ +IVAASPPTEDA+++ EPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QIAELLNGI+ERFDW
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDW  149



>gb|KJB37540.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37543.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37544.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=526

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 103/149 (69%), Gaps = 5/149 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AGSS  +  ++ R   G        NN+EA  MKE S  ++  S  +++  Q  
Sbjct  1    MALVSKAGSSYCIRSDITRGRTGQNVAFGVVNNVEAPIMKEKSIKISSLSCKNARVAQFF  60

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
                +G   + R+ +IVAASPPTEDA+++ EPLTK+DL+ YL SGCK KEKWRIGTEHEK
Sbjct  61   PLETVGFRSKGRNSVIVAASPPTEDALIAIEPLTKQDLVGYLASGCKSKEKWRIGTEHEK  120

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGFE  TLRPMKY QIAELLNGI+ERFDW
Sbjct  121  FGFEIKTLRPMKYEQIAELLNGISERFDW  149



>ref|XP_004171335.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase, chloroplastic-like, 
partial [Cucumis sativus]
Length=229

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG--CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLR  382
            MAL S  GS+  +  E +RC  G    N   + E+ +MKE+  G +  S +S   + GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEILLGSSSLSCSSGNIMHGLH  60

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
             +      +R   +IVAASPPTEDA V+ EPLTK+DL+ YL SGCKPKEKWRIGTEHEKF
Sbjct  61   IDSARMASKRGGRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEKF  120

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GF   TLRPM Y QIA LLNGIAERFDW
Sbjct  121  GFNIETLRPMTYDQIAGLLNGIAERFDW  148



>gb|ACJ83305.1| unknown [Medicago truncatula]
 gb|AFK47474.1| unknown [Medicago truncatula]
Length=172

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 85/112 (76%), Gaps = 7/112 (6%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R   +S   +FSS NS    + L S     G RR    IVAASPPTEDAVV+TEPLTK+D
Sbjct  27   RKTSVSNTFSFSSKNSLSFKRILTS----GGSRR---FIVAASPPTEDAVVATEPLTKQD  79

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            LIDYL SGCK K+KWRIGTEHEKFGFE G+LRPMKY QI+ELLNGIAERFDW
Sbjct  80   LIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYEQISELLNGIAERFDW  131



>ref|XP_008437270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
Length=525

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 100/148 (68%), Gaps = 4/148 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG--CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLR  382
            MAL S  GS+  +  E +RC  G    N   + E+ +MKE+S G +  S +S   + GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEISIGSSSLSCSSRNIMHGLH  60

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
             +      RR   +IVAASPPTEDA V+TEPLTK+DL+ YL SGCKPKEKWRIGTEHEKF
Sbjct  61   IDSARTASRRGDRVIVAASPPTEDATVATEPLTKEDLVAYLASGCKPKEKWRIGTEHEKF  120

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GF   TLRPM Y QIA LLNGIAERFDW
Sbjct  121  GFNIETLRPMTYEQIAGLLNGIAERFDW  148



>gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan]
Length=511

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 14/146 (10%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN  388
            MAL+S  G++  +  E+     G     NN+EA R+KE     +  S  S++        
Sbjct  1    MALVSQGGATYRVRSEITPGHRGVFGLVNNVEASRVKESCVSFSSLSCYSTK--------  52

Query  389  CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF  568
                G RR +  IVAASPPT+DAV++ EPLTK+DL+ YL SGCKP+EKWRIGTEHEKFGF
Sbjct  53   ----GSRRGYRAIVAASPPTDDAVIAAEPLTKEDLVGYLASGCKPREKWRIGTEHEKFGF  108

Query  569  EFGTLRPMKYAQIAELLNGIAERFDW  646
            E GTLRPMKY QIAELLN IAERFDW
Sbjct  109  EIGTLRPMKYEQIAELLNSIAERFDW  134



>ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGN----NLEAYRMKEMSFGLNFSSWNSSQAVQGLR  382
            MAL+S AG S     + C    T S +    NL+  RMKE +F    SS++ S + + + 
Sbjct  1    MALLSQAGGSYTVVPLGCSKTGTKSVSGGVRNLDVLRMKE-AF---VSSYSRSLSTKSML  56

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
               +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHEKF
Sbjct  57   LRSVKRS-KREHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHEKF  115

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  GFEVNTLRPMKYEQIAELLNGIAERFEW  143



>ref|NP_001031701.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84707.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=477

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKTGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 ref|NP_001190808.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 sp|P46309.2|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; AltName: Full=Protein ROOT MERISTEMLESS 
1; Short=AtGCL; AltName: Full=Protein cadmium-sensitive 2; 
AltName: Full=Protein phytoalexin-deficient 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=522

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>gb|ADK77882.1| gamma-glutamylcysteine synthetase [Cucumis sativus]
Length=525

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG--CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLR  382
            MAL S  GS+  +  E +RC  G    N   + E+ +MKE+  G +  S +S   + GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEILLGSSSLSCSSGNIMHGLH  60

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
             +      +R   +IVAASPPTEDA V+ EPLTK+DL+ YL SGCKPKEKWRIGTEHEKF
Sbjct  61   IDSARMASKRGGRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEKF  120

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GF   TLRPMKY QIA LLNGIAERFDW
Sbjct  121  GFNIETLRPMKYEQIAGLLNGIAERFDW  148



>gb|KDO76211.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76212.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=427

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  314  MKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDL  493
            MKE     + SS  S++  Q L  +  G G RR    IVAASPPTEDAVV TEPLTK+DL
Sbjct  1    MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDL  60

Query  494  IDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + YL SGCKPKEKWRIGTEHEKFGFEFGTL PMKY QIAELLN IAERFDW
Sbjct  61   VGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDW  111



>gb|KDO76213.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=397

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  314  MKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDL  493
            MKE     + SS  S++  Q L  +  G G RR    IVAASPPTEDAVV TEPLTK+DL
Sbjct  1    MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDL  60

Query  494  IDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + YL SGCKPKEKWRIGTEHEKFGFEFGTL PMKY QIAELLN IAERFDW
Sbjct  61   VGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDW  111



>ref|XP_006413578.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413579.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413580.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55031.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55032.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55033.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
Length=524

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 99/150 (66%), Gaps = 9/150 (6%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C  I  +A  + S  NL+  RMKE     N  S  +   +  
Sbjct  1    MALLSQAGGSYTVPSGPVCSKIGTKA-VSGSVRNLDVLRMKEAYVSSNSRSLPTKSVL--  57

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            L S+      +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHE
Sbjct  58   LHSSQSVKRSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHE  117

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct  118  KFGFEVNTLRPMKYDQIAELLNSIAERFEW  147



>emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=533

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=502

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  314  MKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDL  493
            MKE     + SS  S++  Q L  +  G G RR    IVAASPPTEDAVV TEPLTK+DL
Sbjct  1    MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDL  60

Query  494  IDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + YL SGCKPKEKWRIGTEHEKFGFEFGTL PMKY QIAELLN IAERFDW
Sbjct  61   VGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDW  111



>gb|AAG13459.1|AF128453_1 gamma-glutamylcysteine synthetase precursor [Glycine max]
Length=308

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKPK+KWRIGTEHEKFGFE G+LRPMKY 
Sbjct  53   VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD  112

Query  602  QIAELLNGIAERFDW  646
            QIAELLNGIAERFDW
Sbjct  113  QIAELLNGIAERFDW  127



>gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
Length=523

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +2

Query  293  NNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTE  472
            N +EA + KE  F  +    NS +   G+   C+    RR + L+VAASPPTED V++ E
Sbjct  30   NRIEASKQKEKCFRFSSLLCNSIKT-PGVPRECLRI--RRGNQLVVAASPPTEDTVIAAE  86

Query  473  PLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            PLTK+DL+ YL SGCKPKEKWRIGTEHEKFGFE GTLRPMKY QIA+LLNGIAERFDW
Sbjct  87   PLTKEDLVGYLASGCKPKEKWRIGTEHEKFGFELGTLRPMKYEQIADLLNGIAERFDW  144



>gb|AGI36546.1| gamma-glutamylcysteine synthetase, partial [Brassica oleracea 
var. botrytis]
Length=199

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 11/146 (8%)
 Frame = +2

Query  215  MALMSMAGS--SLHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN  388
            MAL+S AG   ++    +  +   T+    +   RMKE   G   SS+  +     L +N
Sbjct  1    MALLSQAGGAYTVPSGHVSPKIRTTSVSGCVRNLRMKE---GF-VSSYPRT-----LYTN  51

Query  389  CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF  568
             +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGF
Sbjct  52   SVLKSSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKWRIGTEHEKFGF  111

Query  569  EFGTLRPMKYAQIAELLNGIAERFDW  646
            E  TLRPMKY QIAELLN IAERF+W
Sbjct  112  EVNTLRPMKYDQIAELLNSIAERFEW  137



>gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76207.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76208.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=488

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  314  MKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDL  493
            MKE     + SS  S++  Q L  +  G G RR    IVAASPPTEDAVV TEPLTK+DL
Sbjct  1    MKETCVSFSSSSRYSAKISQVLHLDNAGIGIRRGRRSIVAASPPTEDAVVVTEPLTKEDL  60

Query  494  IDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + YL SGCKPKEKWRIGTEHEKFGFEFGTL PMKY QIAELLN IAERFDW
Sbjct  61   VGYLASGCKPKEKWRIGTEHEKFGFEFGTLHPMKYEQIAELLNSIAERFDW  111



>ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792991.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792999.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008793008.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=522

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R++    G    + N  +  QGLR + +G+  RR   ++VAASPPTEDAVV+TEPLTK+D
Sbjct  36   RVRRNVMGFRNMARNVERRSQGLRFDVVGS--RRGQRMVVAASPPTEDAVVTTEPLTKED  93

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            L+ YL SGCKPKEKWRIGTEHEKFGFE  TLRP+ Y QIA+LLNGI+ERFDW
Sbjct  94   LVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISERFDW  145



>ref|XP_010529570.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Tarenaya 
hassleriana]
Length=524

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 13/152 (9%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGN--------NLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S AG +  C  +   A C+ +GN        N    +MKE    ++F   N S   
Sbjct  1    MALVSQAGGT--CS-VPSGAVCSKTGNKAGFWAVKNQAMSKMKETY--VSFCPSNKSAKK  55

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              + S+  G   +R H +IVAAS PTE+AVV+TEPLTK+DLI YL SGCKPKE WRIGTE
Sbjct  56   MLIHSHNNGKRSQRGHQVIVAASAPTEEAVVATEPLTKEDLIGYLASGCKPKENWRIGTE  115

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  T RPMKY QIAELLNGIAERFDW
Sbjct  116  HEKFGFEVNTFRPMKYEQIAELLNGIAERFDW  147



>ref|XP_008792975.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=582

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R++    G    + N  +  QGLR + +G+  RR   ++VAASPPTEDAVV+TEPLTK+D
Sbjct  96   RVRRNVMGFRNMARNVERRSQGLRFDVVGS--RRGQRMVVAASPPTEDAVVTTEPLTKED  153

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            L+ YL SGCKPKEKWRIGTEHEKFGFE  TLRP+ Y QIA+LLNGI+ERFDW
Sbjct  154  LVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISERFDW  205



>gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
Length=508

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = +2

Query  344  SSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKP  523
            S+W+S++ +   +      G      +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKP
Sbjct  36   SNWDSAKKLSPTQRIVTRGGR-----VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKP  90

Query  524  KEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +EKWRIGTEHEKFGFEFG+LRPMKY QIAELLNGIAERFDW
Sbjct  91   REKWRIGTEHEKFGFEFGSLRPMKYEQIAELLNGIAERFDW  131



>ref|XP_007160058.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
 gb|ESW32052.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
Length=508

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = +2

Query  344  SSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKP  523
            S+W+S++ +   +      G      +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKP
Sbjct  36   SNWDSAKKLSPTQRIVTRGGR-----VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKP  90

Query  524  KEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +EKWRIGTEHEKFGFEFG+LRPMKY QIAELLNGIAERFDW
Sbjct  91   REKWRIGTEHEKFGFEFGSLRPMKYEQIAELLNGIAERFDW  131



>gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
Length=495

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            RR   LIVAASPPTEDAVV+TEPLTK+DL+DYL SGCKPK+ WRIGTEHEKFGFE G+LR
Sbjct  39   RRGRRLIVAASPPTEDAVVATEPLTKQDLVDYLASGCKPKQNWRIGTEHEKFGFELGSLR  98

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLNGIAERFDW
Sbjct  99   PMKYEQIAELLNGIAERFDW  118



>emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 103/150 (69%), Gaps = 11/150 (7%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS + S + + 
Sbjct  1    MALLSQAGGSYTVVPSGVCSKTGTKAVVSGGVRNLDVLRMKE-AFG---SSNSRSLSTKS  56

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
            +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct  57   MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE  115

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  116  KFGFEVNTLRPMKYDQIAELLNGIAERFEW  145



>ref|XP_010241948.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Nelumbo 
nucifera]
Length=199

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 99/152 (65%), Gaps = 16/152 (11%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGNNLE--------AYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S    S +   IR E    N   N+E        AY+MKE   G +   W++ +  
Sbjct  2    MALISQPSPSSY---IRSE---HNVAGNMEDRIVSRGKAYKMKEGWTGSSSLLWSAEKVP  55

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
            +   S+  G   +RR+  IVAASPPT+DAV+ TEPLTKKDL+ YL SGCK KE WRIGTE
Sbjct  56   R--ISHLDGLRGKRRYRTIVAASPPTDDAVIVTEPLTKKDLVGYLASGCKAKENWRIGTE  113

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE GTL P+KY QI +LLNG+AERFDW
Sbjct  114  HEKFGFEIGTLHPIKYEQIKDLLNGLAERFDW  145



>ref|XP_008792981.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=575

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R++    G    + N  +  QGLR + +G+  RR   ++VAASPPTEDAVV+TEPLTK+D
Sbjct  96   RVRRNVMGFRNMARNVERRSQGLRFDVVGS--RRGQRMVVAASPPTEDAVVTTEPLTKED  153

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            L+ YL SGCKPKEKWRIGTEHEKFGFE  TLRP+ Y QIA+LLNGI+ERFDW
Sbjct  154  LVRYLASGCKPKEKWRIGTEHEKFGFEVATLRPINYEQIADLLNGISERFDW  205



>ref|XP_004143907.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase, chloroplastic-like 
[Cucumis sativus]
Length=508

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = +2

Query  215  MALMSMAGSS--LHCEMIRCEAG--CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLR  382
            MAL S  GS+  +  E +RC  G    N   + E+ +MKE+  G +  S +S   + GL 
Sbjct  1    MALASHTGSAHRIGAETLRCRGGNMAFNFSTHAESLKMKEILLGSSSLSCSSGNIMHGLH  60

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
             +      +R   +IVAASPPTEDA V+ EPLTK+DL+ YL SGCKPKEKWRIGTEHEKF
Sbjct  61   IDSARMASKRGGRVIVAASPPTEDATVAAEPLTKEDLVAYLASGCKPKEKWRIGTEHEKF  120

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GF   TLRPM Y QIA LLNGIAERFDW
Sbjct  121  GFNIETLRPMTYDQIAGLLNGIAERFDW  148



>ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010920823.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = +2

Query  353  NSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEK  532
            N  + +QGLR + + +  RR   ++VAASPPTEDA+V TEPLTK+DL+ YL SGCKPKEK
Sbjct  51   NVERRLQGLRFDAVAS--RRGQRMVVAASPPTEDALVMTEPLTKEDLVWYLASGCKPKEK  108

Query  533  WRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            WRIGTEHEKFGFE  TLRPMKY QIA+LLNG+AERFDW
Sbjct  109  WRIGTEHEKFGFEVATLRPMKYEQIADLLNGVAERFDW  146



>ref|XP_010439228.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Camelina 
sativa]
Length=528

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 9/152 (6%)
 Frame = +2

Query  215  MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S  G S        C     +A       NL+  RMKE  FG ++S   S    + 
Sbjct  1    MALLSQGGGSYTVPSGPVCSKNGAKAVYGGGVRNLDVLRMKEGFFG-SYSGTRSLATTKS  59

Query  377  --LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              LRS+      +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTE
Sbjct  60   MLLRSDRSVKRSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTE  119

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  120  HEKFGFEVNTLRPMKYDQIAELLNGIAERFEW  151



>gb|AEA77156.1| chloroplast gamma glutamyl cysteine synthetase [Vigna radiata]
Length=508

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +IVAASPPTEDAVV T+PLTK+DL+DYL SGCKP+EKWRIGTEHEKFGFEFG+LRPMKY 
Sbjct  57   VIVAASPPTEDAVVVTDPLTKQDLVDYLASGCKPREKWRIGTEHEKFGFEFGSLRPMKYE  116

Query  602  QIAELLNGIAERFDW  646
            QIAELLNGIAERFDW
Sbjct  117  QIAELLNGIAERFDW  131



>gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
Length=499

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 10/112 (9%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R   +S G +FSS    + +       + +G RR   LIVAASPPTEDAVV+TEPLTK+D
Sbjct  21   RKTPVSNGFSFSSICFDRRI-------VSSGGRR---LIVAASPPTEDAVVATEPLTKQD  70

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            LIDYL SGCKPK+KWRIGTEHEKFGFE G+LRP+KY QIAELLN IAERFDW
Sbjct  71   LIDYLASGCKPKDKWRIGTEHEKFGFELGSLRPVKYEQIAELLNAIAERFDW  122



>gb|KHN16824.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=510

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +I+AASPPTEDA+V+T+PLTK+DL+DYL SGCKPK+KWRIGTEHEKFGFEFGTLRPMKY 
Sbjct  59   VILAASPPTEDALVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEFGTLRPMKYD  118

Query  602  QIAELLNGIAERFDW  646
            QIAELLNGIAERFDW
Sbjct  119  QIAELLNGIAERFDW  133



>ref|XP_006586325.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Glycine 
max]
Length=507

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +I+AASPPTEDA+V+T+PLTK+DL+DYL SGCKPK+KWRIGTEHEKFGFEFGTLRPMKY 
Sbjct  59   VILAASPPTEDALVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEFGTLRPMKYD  118

Query  602  QIAELLNGIAERFDW  646
            QIAELLNGIAERFDW
Sbjct  119  QIAELLNGIAERFDW  133



>ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
 gb|EOA16431.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
Length=525

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 12/152 (8%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGN--------NLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S  G  ++   +     C  +G         NL+  RMKE +F  +++   S++++
Sbjct  1    MALLSQGGGGVYT--VPSGPVCIKNGTKAVSGGVRNLDVLRMKE-AFVSSYARGLSTKSM  57

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              LRS+      +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTE
Sbjct  58   L-LRSHHSVKRSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTE  116

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  117  HEKFGFEVNTLRPMKYDQIAELLNGIAERFEW  148



>ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatula]
 sp|Q9ZNX6.1|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Medicago truncatula]
 gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
 gb|AET04988.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=508

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 85/112 (76%), Gaps = 7/112 (6%)
 Frame = +2

Query  311  RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD  490
            R   +S   +FSS NS    + L S     G RR    IVAASPPTEDAVV+TEPLTK+D
Sbjct  27   RKTSISNTFSFSSKNSLSFKRILTS----GGSRR---FIVAASPPTEDAVVATEPLTKQD  79

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            LIDYL SGCK K+KWRIGTEHEKFGFE G+LRPMKY QI+ELLNGIAERFDW
Sbjct  80   LIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYEQISELLNGIAERFDW  131



>ref|XP_009380693.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=524

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 94/145 (65%), Gaps = 11/145 (8%)
 Frame = +2

Query  239  SSLHCEMIRCEAG-CTNSGNNLE-AYRMKEMSF-------GLNFSSWNSSQAVQGLRSNC  391
            S  H   + C    C NS      A R +E+ F       GL F   N ++  +GL  N 
Sbjct  5    SDFHLNRVPCPGSPCANSVTECSGARRKREVRFRALGNSEGLGFLVQNGARKSRGLCWNA  64

Query  392  IGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFE  571
             G+  RR   ++VAASPPT+D VV TEPL K+DL+ YL SGCKPKE WRIGTEHEKFGFE
Sbjct  65   RGS--RRAKRMVVAASPPTDDGVVVTEPLMKEDLVGYLNSGCKPKEMWRIGTEHEKFGFE  122

Query  572  FGTLRPMKYAQIAELLNGIAERFDW  646
             G+LRPMKY QIA+LLNG+AERFDW
Sbjct  123  VGSLRPMKYEQIADLLNGLAERFDW  147



>ref|XP_010433943.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = +2

Query  296  NLEAYRMKEMSFGLNFSSWNSSQAVQG--LRSNCIGAGYRRRHGLIVAASPPTEDAVVST  469
            NL+  RMKE  FG +++   S    +   LRS+      +R H LIVAASPPTE+AVV+T
Sbjct  35   NLDVLRMKEGFFG-SYTGTRSLTTTKSMLLRSDLSVKRSKRGHQLIVAASPPTEEAVVAT  93

Query  470  EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            EPLT++DLI YL SGCK K+K+RIGTEHEKFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  94   EPLTREDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYDQIAELLNGIAERFEW  152



>ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=504

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 98/144 (68%), Gaps = 17/144 (12%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCI  394
            MA++S   SS     +R +A   N        R   +S  L FSS +S + +       +
Sbjct  1    MAIISRIASS--SPSLRYDAAPLNF-----HLRKTSLSNNLTFSSNDSVKRI-------V  46

Query  395  GAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEF  574
             +G RR   +IVAASPPTEDAVV+T PLTK+DLIDYL SGCK K+KWRIGTEHEKFGFE 
Sbjct  47   ASGGRR---VIVAASPPTEDAVVATHPLTKQDLIDYLASGCKTKDKWRIGTEHEKFGFEL  103

Query  575  GTLRPMKYAQIAELLNGIAERFDW  646
            G+LRPMKY QI++LLNGIAERFDW
Sbjct  104  GSLRPMKYEQISDLLNGIAERFDW  127



>ref|XP_010255398.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nelumbo 
nucifera]
Length=526

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 101/150 (67%), Gaps = 8/150 (5%)
 Frame = +2

Query  215  MALMSMAGSSLHCEMIRCEA--GCTNSGNNL----EAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S    S +    +  A    +N G+ +    +A+++KE     +  SW + +  + 
Sbjct  2    MALISQTNPSSYIRSDQNVALNAASNVGDMIVSRNKAFKIKEGMTSSSSLSWGAKKMPR-  60

Query  377  LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE  556
              SN  G   +R H +IVAASPPTEDAV++ EPLTK+DL+ YL SGCKPK+KWRIGTEHE
Sbjct  61   -ISNFDGLRCKRDHRMIVAASPPTEDAVIAAEPLTKEDLVGYLASGCKPKDKWRIGTEHE  119

Query  557  KFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KFGFE GTLRP+KY QI  LLNG+AERFDW
Sbjct  120  KFGFEIGTLRPIKYEQIKHLLNGLAERFDW  149



>ref|XP_003525397.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Glycine max]
 ref|XP_006580590.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Glycine max]
 gb|KHN23647.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=504

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKPK+KWRIGTEHEKFGFE G+LRPMKY 
Sbjct  53   VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD  112

Query  602  QIAELLNGIAERFDW  646
            QIAELLNGIAERFDW
Sbjct  113  QIAELLNGIAERFDW  127



>ref|XP_010448772.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=528

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 103/152 (68%), Gaps = 9/152 (6%)
 Frame = +2

Query  215  MALMSMAGSSLHCEM--IRCEAG--CTNSG--NNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S  G S       +  + G    +SG   NL+  RMKE  FG +++   S    + 
Sbjct  1    MALLSQGGGSYTVPSGPVYSKNGTRAVSSGGVRNLDVLRMKEGFFG-SYTGTRSLSTTKS  59

Query  377  --LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
              LRS+      +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTE
Sbjct  60   MLLRSDRSVKRSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTE  119

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct  120  HEKFGFEVNTLRPMKYDQIAELLNGIAERFEW  151



>gb|EPS61788.1| gamma-glutamylcysteine synthetase, partial [Genlisea aurea]
Length=454

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            LIVAASPPTED VVSTEPLTKKDL+DYL SGCKPKEKWRIGTEHEKFGFEF TLRPMKY 
Sbjct  3    LIVAASPPTEDTVVSTEPLTKKDLVDYLASGCKPKEKWRIGTEHEKFGFEFKTLRPMKYG  62

Query  602  QIAELLNGIAERFDW  646
            QI+ELL+ I+ERFDW
Sbjct  63   QISELLHSISERFDW  77



>ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010937864.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
Length=522

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  224  MSMAGSSLHCEMI-RCEAGCTNSGNNLEA------YRMKEMSFGLNFSSWNSSQAVQGLR  382
            MS+A S LH   I R E    +SG    A       +++    GL     N+ +  + L 
Sbjct  1    MSIA-SRLHLNQIHRSEMLNYSSGVECNAILKERQLKVRGNLLGLGDLVRNAERRSKRLH  59

Query  383  SNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKF  562
             N +G   RR   ++VAASPPTEDAVV TEPLTK+DL+ YL SGCKPKE+WRIGTEHEKF
Sbjct  60   FNVVGP--RRGQRMVVAASPPTEDAVVMTEPLTKEDLVQYLASGCKPKEQWRIGTEHEKF  117

Query  563  GFEFGTLRPMKYAQIAELLNGIAERFDW  646
            GFE  TLRP+KY QIA+LLNG+AERFDW
Sbjct  118  GFEVATLRPIKYEQIADLLNGLAERFDW  145



>ref|XP_009402382.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=517

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 2/92 (2%)
 Frame = +2

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
            QGLR   +  GY R  G++VAASPPT+DAVV TEPLTK+DL+ YL SGCKPKE WRIGTE
Sbjct  51   QGLR--WVARGYGRTSGMVVAASPPTDDAVVITEPLTKEDLVGYLASGCKPKEMWRIGTE  108

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE GTL PMKY QIA+LLN IAERFDW
Sbjct  109  HEKFGFEVGTLCPMKYEQIADLLNAIAERFDW  140



>sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Brassica juncea]
 emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
Length=514

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 11/146 (8%)
 Frame = +2

Query  215  MALMSMAGSSLHCE--MIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN  388
            MAL+S AG +       +    G       +   RMKE       SS++ + + + +   
Sbjct  1    MALLSQAGGAYTVPSGHVSSRTGTKTVSGCVNVLRMKETYV----SSYSRTLSTKSMLKR  56

Query  389  CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF  568
                  +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK KEKWRIGTEHEKFGF
Sbjct  57   S-----KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGF  111

Query  569  EFGTLRPMKYAQIAELLNGIAERFDW  646
            E  TLRPMKY QIAELLN IAERF+W
Sbjct  112  EVNTLRPMKYDQIAELLNSIAERFEW  137



>emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
 emb|CDY53137.1| BnaC01g41470D [Brassica napus]
Length=514

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 97/146 (66%), Gaps = 11/146 (8%)
 Frame = +2

Query  215  MALMSMAGSSLHCE--MIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN  388
            MAL+S AG +       +  +   T+    +   RMKE  F  ++S        + L +N
Sbjct  1    MALLSQAGGAYTVPSGHVSSKIRTTSVSGCVRNLRMKE-GFVSSYS--------RTLYTN  51

Query  389  CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF  568
             +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGF
Sbjct  52   SVLKSSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKWRIGTEHEKFGF  111

Query  569  EFGTLRPMKYAQIAELLNGIAERFDW  646
            E  TLRPMKY QIAELLN IAERF+W
Sbjct  112  EVNTLRPMKYDQIAELLNSIAERFEW  137



>gb|AHC02699.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
 gb|AHC02700.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
Length=490

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTE  550
            Q L  +  G G +R H +IVAASPPTEDAV++TEPLTK+DL+ YL SGCK KEKWRIGTE
Sbjct  22   QILHIDNAGVGQKRGHTVIVAASPPTEDAVIATEPLTKEDLVAYLVSGCKSKEKWRIGTE  81

Query  551  HEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            HEKFGFE  TLRP+KY QIAELLN I+ERFDW
Sbjct  82   HEKFGFELKTLRPIKYEQIAELLNVISERFDW  113



>ref|XP_008789126.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +2

Query  353  NSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEK  532
            N  +  + L  N +G+  RR   ++VAASPPTEDAVV TEPLTK+DL+ YL SGCKPKE+
Sbjct  50   NVERRSERLHFNVVGS--RRGQRMVVAASPPTEDAVVMTEPLTKEDLVQYLASGCKPKEE  107

Query  533  WRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            WRIGTEHEKFGFE  TLRP+KY QIA+LLNG+AERFDW
Sbjct  108  WRIGTEHEKFGFEVATLRPIKYEQIADLLNGLAERFDW  145



>gb|KDP25439.1| hypothetical protein JCGZ_20595 [Jatropha curcas]
Length=471

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            +R + +IVAASPP EDAV++TEPLTK+DL+ YL SGCK KE+WRIGTEHEKFGFE GTLR
Sbjct  15   KRGNQVIVAASPPIEDAVIATEPLTKEDLVGYLASGCKSKEQWRIGTEHEKFGFELGTLR  74

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLNGIAERFDW
Sbjct  75   PMKYEQIAELLNGIAERFDW  94



>gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
Length=524

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 102/149 (68%), Gaps = 7/149 (5%)
 Frame = +2

Query  215  MALMSMAGSSLHCEM--IRCEAG---CTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGL  379
            MAL+S AG S       +  + G    +    NL+  R+KE ++   +S   S++++  L
Sbjct  1    MALLSQAGGSYTVPSGPLSSKTGTKAVSGGLRNLDVLRIKE-AYVSPYSRSLSTKSML-L  58

Query  380  RSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEK  559
             SN      +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHEK
Sbjct  59   HSNHSVKRSKRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKYRIGTEHEK  118

Query  560  FGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            FGF+  TLRPMKY QIAELLN IAERF+W
Sbjct  119  FGFDVNTLRPMKYDQIAELLNSIAERFEW  147



>gb|KGN50100.1| hypothetical protein Csa_5G153150 [Cucumis sativus]
Length=501

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +2

Query  284  NSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVV  463
            N   + E+ +MKE+  G +  S +S   + GL  +      +R   +IVAASPPTEDA V
Sbjct  4    NFSTHAESLKMKEILLGSSSLSCSSGNIMHGLHIDSARMASKRGGRVIVAASPPTEDATV  63

Query  464  STEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFD  643
            + EPLTK+DL+ YL SGCKPKEKWRIGTEHEKFGF   TLRPM Y QIA LLNGIAERFD
Sbjct  64   AAEPLTKEDLVAYLASGCKPKEKWRIGTEHEKFGFNIETLRPMTYDQIAGLLNGIAERFD  123

Query  644  W  646
            W
Sbjct  124  W  124



>ref|XP_010241950.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like, partial 
[Nelumbo nucifera]
Length=187

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +2

Query  302  EAYRMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLT  481
            +AY+MKE   G +   W++ +  +   S+  G   +RR+  IVAASPPT+ AV+ TEPLT
Sbjct  33   KAYKMKEGWTGSSSLLWSAEKVPR--ISHLDGLRGKRRYRTIVAASPPTDVAVIVTEPLT  90

Query  482  KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            KKDL+ YL SGCK KE WRIGTE E FGFE GTL P+KY QI +LLNG+AERFDW
Sbjct  91   KKDLVGYLASGCKAKENWRIGTEQENFGFEIGTLHPIKYEQIKDLLNGLAERFDW  145



>ref|XP_010695138.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=423

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +2

Query  359  SQAVQGLRSNCIGAGY--------RRRHGL--IVAASPPTEDAVVSTEPLTKKDLIDYLT  508
            S  + G    C G  Y         R  G   IVAASPPTED VV+ +PLTK+DL++YL 
Sbjct  12   SMQLHGETVRCKGTNYLCLDISRGNRSRGFRSIVAASPPTEDPVVAADPLTKEDLVNYLA  71

Query  509  SGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            SGCKPK+KWRIGTEHEKFGFE  TLRPMKY QIAELLNGIAERFDW
Sbjct  72   SGCKPKQKWRIGTEHEKFGFEIDTLRPMKYEQIAELLNGIAERFDW  117



>gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
Length=511

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLR
Sbjct  55   KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLR  114

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLN IAERF+W
Sbjct  115  PMKYEQIAELLNSIAERFEW  134



>ref|XP_010695135.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695136.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695137.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 76/106 (72%), Gaps = 10/106 (9%)
 Frame = +2

Query  359  SQAVQGLRSNCIGAGY--------RRRHGL--IVAASPPTEDAVVSTEPLTKKDLIDYLT  508
            S  + G    C G  Y         R  G   IVAASPPTED VV+ +PLTK+DL++YL 
Sbjct  12   SMQLHGETVRCKGTNYLCLDISRGNRSRGFRSIVAASPPTEDPVVAADPLTKEDLVNYLA  71

Query  509  SGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            SGCKPK+KWRIGTEHEKFGFE  TLRPMKY QIAELLNGIAERFDW
Sbjct  72   SGCKPKQKWRIGTEHEKFGFEIDTLRPMKYEQIAELLNGIAERFDW  117



>ref|XP_009136711.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136719.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136726.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
Length=511

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLR
Sbjct  55   KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLR  114

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLN IAERF+W
Sbjct  115  PMKYEQIAELLNSIAERFEW  134



>emb|CDY41249.1| BnaA01g12900D [Brassica napus]
Length=511

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLR
Sbjct  55   KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLR  114

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLN IAERF+W
Sbjct  115  PMKYEQIAELLNSIAERFEW  134



>emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
Length=515

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 94/154 (61%), Gaps = 26/154 (17%)
 Frame = +2

Query  215  MALMSMAG------SSLHCEMIRCEA--GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S  G      S   C   R +A  GC N        RMK+ SF  + S        
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCVN------VLRMKDCSFSRSLSP-------  47

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIG  544
               +S  +    R +H LIVAASPPT++A   V+ EPLT++DLI YL SGCK K+KWRIG
Sbjct  48   ---KSMLVERSKRGQHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIG  104

Query  545  TEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct  105  TEHEKFGFEVKTLRPMKYDQIAELLNSIAERFEW  138



>ref|XP_009137315.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=515

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 94/154 (61%), Gaps = 26/154 (17%)
 Frame = +2

Query  215  MALMSMAG------SSLHCEMIRCEA--GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAV  370
            MAL+S  G      S   C   R +A  GC N        RMK+ SF  + S        
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCVN------VLRMKDCSFSRSLSP-------  47

Query  371  QGLRSNCIGAGYRRRHGLIVAASPPTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIG  544
               +S  +    R +H LIVAASPPT++A   V+ EPLT++DLI YL SGCK K+KWRIG
Sbjct  48   ---KSMLVERSKRGQHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIG  104

Query  545  TEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct  105  TEHEKFGFEVKTLRPMKYDQIAELLNSIAERFEW  138



>ref|XP_009380691.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380692.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 94/160 (59%), Gaps = 26/160 (16%)
 Frame = +2

Query  239  SSLHCEMIRCEAG-CTNSGNNLE-AYRMKEMSF-------GLNFSSWNSSQAVQGLRSNC  391
            S  H   + C    C NS      A R +E+ F       GL F   N ++  +GL  N 
Sbjct  5    SDFHLNRVPCPGSPCANSVTECSGARRKREVRFRALGNSEGLGFLVQNGARKSRGLCWNA  64

Query  392  IGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKW------------  535
             G+  RR   ++VAASPPT+D VV TEPL K+DL+ YL SGCKPKE W            
Sbjct  65   RGS--RRAKRMVVAASPPTDDGVVVTEPLMKEDLVGYLNSGCKPKEMWSSWELLLTEEHF  122

Query  536  ---RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
               RIGTEHEKFGFE G+LRPMKY QIA+LLNG+AERFDW
Sbjct  123  CCNRIGTEHEKFGFEVGSLRPMKYEQIADLLNGLAERFDW  162



>ref|XP_007210716.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
 gb|EMJ11915.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
Length=463

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  398  AGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFG  577
             G RRR   IVAASPPTE AV++ EPLTK+DLI YL SGCKPKE WRIGTE E+FGF+  
Sbjct  4    VGQRRRRSAIVAASPPTEAAVIAAEPLTKEDLIGYLASGCKPKENWRIGTEQERFGFDLK  63

Query  578  TLRPMKYAQIAELLNGIAERFDW  646
            TLRPMKY  IAELLNGIA+RFDW
Sbjct  64   TLRPMKYEHIAELLNGIADRFDW  86



>emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
 emb|CDX94161.1| BnaC07g37950D [Brassica napus]
Length=503

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDA-VVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTL  583
            RR H LIVAASPPT++A VV+ EPLT+ DLI YL SGCK K+KWRIGTEHEKFGFE  TL
Sbjct  46   RRNHQLIVAASPPTDEAAVVAAEPLTRDDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTL  105

Query  584  RPMKYAQIAELLNGIAERFDW  646
            RPMKY QIAELLN IAERF+W
Sbjct  106  RPMKYDQIAELLNSIAERFEW  126



>emb|CDY10914.1| BnaA03g45730D [Brassica napus]
Length=517

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 93/153 (61%), Gaps = 22/153 (14%)
 Frame = +2

Query  215  MALMSMAG------SSLHCEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG  376
            MAL+S  G      S   C   R +A     GN L   RMK+ SF  + S          
Sbjct  1    MALLSQGGGAYTVPSGTLCSKTRAKAVSGCGGNVL---RMKDCSFSRSLSP---------  48

Query  377  LRSNCIGAGYR-RRHGLIVAASPPTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIGT  547
             +S  +    R   H LIVAASPPT++A   V+ EPLT++DLI YL SGCK K+KWRIGT
Sbjct  49   -KSMLVERSKRGHHHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIGT  107

Query  548  EHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            EHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct  108  EHEKFGFEVKTLRPMKYDQIAELLNSIAERFEW  140



>ref|XP_008346998.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=125

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  392  IGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFE  571
            +  G +R    IV A PP+E A VST+PLTK+DLI Y  SGCKPKE WRIG EHE+FGF+
Sbjct  26   LXXGQKRWRSXIVNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFD  85

Query  572  FGTLRPMKYAQIAELLNGIAERFDW  646
              TLRPMKY QIAE LNGIAERF W
Sbjct  86   LKTLRPMKYEQIAEFLNGIAERFGW  110



>ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
Length=501

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +2

Query  356  SSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKW  535
            +  A+ G+R        R R G  VAASPPTE+AV  TEPLTK DL+ YL SGCKPKE W
Sbjct  28   TRTALAGVRFPPAARTGRTRRGGAVAASPPTEEAVQMTEPLTKDDLVAYLVSGCKPKENW  87

Query  536  RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            RIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct  88   RIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW  124



>ref|XP_003611087.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=372

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            ++   +IVA  P  E  V++TEPLTK DLIDY+ SGCKPKEKWRIGTEHEKFGFEF TLR
Sbjct  56   KKERNVIVATGPAIEAPVIATEPLTKDDLIDYMVSGCKPKEKWRIGTEHEKFGFEFDTLR  115

Query  587  PMKYAQIAELLNGIAERFDW  646
            P+KY QI+ LLNGIAERF W
Sbjct  116  PIKYKQISPLLNGIAERFHW  135



>emb|CDY41369.1| BnaC03g65140D [Brassica napus]
Length=460

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            +R H LIVAASPPTE+ V++ EPL ++DLI YL SGCK K+KWRIGTEHEKFGFE  TLR
Sbjct  19   KRGHQLIVAASPPTEEPVIANEPLRREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLR  78

Query  587  PMKYAQIAELLNGIAERFDW  646
            PMKY QIAELLN IAERF+W
Sbjct  79   PMKYDQIAELLNSIAERFEW  98



>gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
Length=496

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  413  RHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPM  592
            R   +V+ASPPTEDAVV TEPLTK DL+ YL SGCK K+KWRIGTEHEKFGF+  TLRPM
Sbjct  42   RGKFVVSASPPTEDAVVMTEPLTKDDLVAYLASGCKTKDKWRIGTEHEKFGFQINTLRPM  101

Query  593  KYAQIAELLNGIAERFDW  646
             Y QIA LLNGIAERFDW
Sbjct  102  TYEQIAYLLNGIAERFDW  119



>ref|XP_004511574.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=511

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  398  AGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFG  577
            A YRR   +IVA  P TE   ++TEPLTK DLIDY+ SGCKPKEKWRIGTEHEKFGFEF 
Sbjct  52   ARYRRGRSVIVATGPATEAHAIATEPLTKDDLIDYMLSGCKPKEKWRIGTEHEKFGFEFD  111

Query  578  TLRPMKYAQIAELLNGIAERFDW  646
            +LRP+KY QI+ LLN IA RFDW
Sbjct  112  SLRPIKYNQISALLNSIAARFDW  134



>pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With Mg2+ And L-glutamate
Length=449

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +2

Query  431  AASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIA  610
            AASPPTE+AVV+TEPLT++DLI YL SGCK KEKWRIGTEHEKFGFE  TLRPMKY QIA
Sbjct  1    AASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQIA  60

Query  611  ELLNGIAERFDW  646
            ELLN IAERF+W
Sbjct  61   ELLNSIAERFEW  72



>ref|XP_003611086.1| Glutamate-cysteine ligase [Medicago truncatula]
 gb|AES94044.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=512

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            ++   +IVA  P  E  V++TEPLTK DLIDY+ SGCKPKEKWRIGTEHEKFGFEF TLR
Sbjct  56   KKERNVIVATGPAIEAPVIATEPLTKDDLIDYMVSGCKPKEKWRIGTEHEKFGFEFDTLR  115

Query  587  PMKYAQIAELLNGIAERFDW  646
            P+KY QI+ LLNGIAERF W
Sbjct  116  PIKYKQISPLLNGIAERFHW  135



>emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=492

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  410  RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct  37   RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP  96

Query  590  MKYAQIAELLNGIAERFDW  646
            +KY QI ++LNG+AERFDW
Sbjct  97   IKYDQIRDILNGLAERFDW  115



>sp|Q8GU95.2|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
Length=492

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  410  RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct  37   RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP  96

Query  590  MKYAQIAELLNGIAERFDW  646
            +KY QI ++LNG+AERFDW
Sbjct  97   IKYDQIRDILNGLAERFDW  115



>ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 sp|Q688Q9.1|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  410  RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct  37   RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP  96

Query  590  MKYAQIAELLNGIAERFDW  646
            +KY QI ++LNG+AERFDW
Sbjct  97   IKYDQIRDILNGLAERFDW  115



>pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
Length=449

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  431  AASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIA  610
            AASPPTE+AVV+TEPLT++DLI YL SGCK KEKWRIGTEHEKFGFE  TLRP KY QIA
Sbjct  1    AASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPXKYDQIA  60

Query  611  ELLNGIAERFDW  646
            ELLN IAERF+W
Sbjct  61   ELLNSIAERFEW  72



>ref|XP_008655177.1| PREDICTED: uncharacterized protein LOC100381846 isoform X1 [Zea 
mays]
 gb|AFW82737.1| hypothetical protein ZEAMMB73_015174 [Zea mays]
Length=500

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  428  VAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQI  607
            VAASPPTE+ V  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI
Sbjct  51   VAASPPTEEVVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQI  110

Query  608  AELLNGIAERFDW  646
             ++LNG+AERFDW
Sbjct  111  RDILNGLAERFDW  123



>gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
Length=1281

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  410  RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct  826  RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP  885

Query  590  MKYAQIAELLNGIAERFDW  646
            +KY QI ++LNG+AERFDW
Sbjct  886  IKYDQIRDILNGLAERFDW  904



>dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=502

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            RRR  L V AS P E+ V +TEPLTKKDL+++++SGCKPK KWRIGTEHEKFGFE  TL+
Sbjct  46   RRRCLLPVRASAPAEELVAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELKTLK  105

Query  587  PMKYAQIAELLNGIAERFDW  646
            PM Y QIAELL GIAERF+W
Sbjct  106  PMSYLQIAELLEGIAERFNW  125



>dbj|BAJ21771.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=439

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            RRR  L V AS P E+ V +TEPLTKKDL+++++SGCKPK KWRIGTEHEKFGFE  TL+
Sbjct  46   RRRCLLPVRASAPAEELVAATEPLTKKDLVEFISSGCKPKHKWRIGTEHEKFGFELKTLK  105

Query  587  PMKYAQIAELLNGIAERFDW  646
            PM Y QIAELL GIAERF+W
Sbjct  106  PMSYLQIAELLEGIAERFNW  125



>ref|XP_008375304.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=465

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  392  IGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFE  571
            +  G +R    IV A PP+E A VST+PLTK+DLI Y  SGCKPKE WRIG EHE+FGF+
Sbjct  26   LXXGQKRWRSXIVNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFD  85

Query  572  FGTLRPMKYAQIAELLNGIAERFDW  646
              TLRPMKY QIAE LNGIAERF W
Sbjct  86   LKTLRPMKYEQIAEXLNGIAERFGW  110



>ref|XP_008375303.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=488

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  392  IGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFE  571
            +  G +R    IV A PP+E A VST+PLTK+DLI Y  SGCKPKE WRIG EHE+FGF+
Sbjct  26   LXXGQKRWRSXIVNARPPSEAAAVSTDPLTKEDLIGYFASGCKPKENWRIGIEHERFGFD  85

Query  572  FGTLRPMKYAQIAELLNGIAERFDW  646
              TLRPMKY QIAE LNGIAERF W
Sbjct  86   LKTLRPMKYEQIAEXLNGIAERFGW  110



>ref|XP_006827661.1| hypothetical protein AMTR_s00009p00252400 [Amborella trichopoda]
 gb|ERM95077.1| hypothetical protein AMTR_s00009p00252400 [Amborella trichopoda]
Length=396

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +2

Query  335  LNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSG  514
            + FSS +  + ++   SN    G +R +G+IVA + PTEDAVV+TEPLTK DL+ YL SG
Sbjct  40   VGFSSLSCVERIKR-ASNLNITGAKRGYGVIVAGNAPTEDAVVTTEPLTKADLVSYLESG  98

Query  515  CKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            CKPKE+WRIGTEHE FGFEFGTL+  KY QI ELL   + RF W
Sbjct  99   CKPKEQWRIGTEHENFGFEFGTLKSPKYEQIRELLERFSARFGW  142



>ref|XP_008648285.1| PREDICTED: gamma-glutamylcysteine synthetase1 isoform X1 [Zea 
mays]
 gb|AFW74704.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=503

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++
Sbjct  57   SPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  116

Query  617  LNGIAERFDW  646
            LNG+AERFDW
Sbjct  117  LNGLAERFDW  126



>ref|XP_003611083.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=172

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
             +V+TEPLTK DLIDY+  GCKPKEKWRIGTEHEKFGFEF TLRP+ Y QI+ LLNGIA 
Sbjct  59   VIVATEPLTKDDLIDYMVHGCKPKEKWRIGTEHEKFGFEFDTLRPINYQQISALLNGIAA  118

Query  635  RFDW  646
            RFDW
Sbjct  119  RFDW  122



>sp|A2YL07.2|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Indica Group]
Length=496

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++
Sbjct  50   SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  109

Query  617  LNGIAERFDW  646
            LNG+AERFDW
Sbjct  110  LNGLAERFDW  119



>sp|Q6Z3A3.1|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=496

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++
Sbjct  50   SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  109

Query  617  LNGIAERFDW  646
            LNG+AERFDW
Sbjct  110  LNGLAERFDW  119



>gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
Length=670

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++
Sbjct  224  SPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  283

Query  617  LNGIAERFDW  646
            LNG+AERFDW
Sbjct  284  LNGLAERFDW  293



>gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
Length=579

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEP TK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++
Sbjct  133  SPPTEEAVQMTEPFTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI  192

Query  617  LNGIAERFDW  646
            LNG+AERFDW
Sbjct  193  LNGLAERFDW  202



>ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
Length=464

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            RR+ G IVAASPP E+  +  EPLTK DL+DYL SGCKPK KWRIGTEHEKFGF   +L 
Sbjct  9    RRKLG-IVAASPPAEETALRAEPLTKLDLVDYLASGCKPKSKWRIGTEHEKFGFRMSSLE  67

Query  587  PMKYAQIAELLNGIAERFDW  646
            P+ Y QIA+LL G+AERF+W
Sbjct  68   PIDYEQIAQLLEGLAERFNW  87



>ref|XP_003569058.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic [Brachypodium 
distachyon]
Length=497

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  413  RHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPM  592
            + G  VAASPPTE+A   TEPLTK DL+ YL SGCKPKE WRIGTEHEKFGF+  TLRP+
Sbjct  43   KRGGAVAASPPTEEAAQMTEPLTKDDLVAYLVSGCKPKENWRIGTEHEKFGFDIETLRPI  102

Query  593  KYAQIAELLNGIAERFDW  646
             Y QI+ +LNG++ERF+W
Sbjct  103  TYDQISGILNGLSERFEW  120



>ref|XP_004960382.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=498

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            SPPTE+AV  TEPLTK DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+ Y QI ++
Sbjct  52   SPPTEEAVQMTEPLTKDDLVAYLASGCKPKENWRIGTEHEKFGFEVDTLRPINYNQIRDI  111

Query  617  LNGIAERFDW  646
            LNG+AERF W
Sbjct  112  LNGLAERFSW  121



>ref|XP_001785532.1| predicted protein [Physcomitrella patens]
 gb|EDQ49666.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGT  580
            RRR   IVAASPP  +A    S EPLT++DL+ YL SGCKPKEKWRIGTEHEKFGF+   
Sbjct  26   RRRTPCIVAASPPNNNAGGSRSGEPLTRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDN  85

Query  581  LRPMKYAQIAELLNGIAERFDW  646
            L+PM YAQI +LL G+A+RF+W
Sbjct  86   LQPMTYAQIRQLLEGLADRFEW  107



>gb|KFK30813.1| hypothetical protein AALP_AA6G029500 [Arabis alpina]
Length=479

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            ++ A+V+TEPLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRPMK+ QI  LLNG
Sbjct  37   SDSAIVATEPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFELRTLRPMKFGQITSLLNG  96

Query  626  IAERFDW  646
            +AE+FDW
Sbjct  97   MAEKFDW  103



>ref|XP_010448777.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            T  +VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRP+K+ QI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEVKTLRPLKFEQITALLNG  64

Query  626  IAERFDW  646
            IAERFDW
Sbjct  65   IAERFDW  71



>ref|XP_003516702.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006573776.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN25701.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=506

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  425  IVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ  604
            IVA  P  + A V  +PLTK DLIDY  SGCKPK  WRIGTEHEKFGFE  TLRP+ Y Q
Sbjct  56   IVATGPAIDHAPVIAKPLTKDDLIDYFVSGCKPKHNWRIGTEHEKFGFELKTLRPINYKQ  115

Query  605  IAELLNGIAERFDW  646
            I+ LLN IA RFDW
Sbjct  116  ISALLNRIATRFDW  129



>ref|XP_006654002.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Oryza 
brachyantha]
Length=438

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEPLTK+DLI YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct  2    TEPLTKEDLIAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW  61



>ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
Length=455

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  425  IVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ  604
            IVAA+P  ED +    PLTK DL+DYL SGCKPK +WRIGTEHEKFGF+  TL+P+ Y Q
Sbjct  5    IVAAAPAAEDRITKAAPLTKLDLVDYLASGCKPKSRWRIGTEHEKFGFDKSTLKPLDYPQ  64

Query  605  IAELLNGIAERFDW  646
            I++L  G+ ERF+W
Sbjct  65   ISQLFEGLCERFNW  78



>emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=438

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct  2    TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW  61



>ref|XP_010448775.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            T   VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRP+++ QI  LLNG
Sbjct  5    TASCVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALLNG  64

Query  626  IAERFDW  646
            IAER+DW
Sbjct  65   IAERYDW  71



>ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=438

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct  2    TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPLKYDQIRDILNGLAERFDW  61



>ref|XP_010439235.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=448

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            T   VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRP+++ QI  LLNG
Sbjct  5    TASCVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALLNG  64

Query  626  IAERFDW  646
            IAER+DW
Sbjct  65   IAERYDW  71



>ref|XP_010439231.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439232.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439233.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=448

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            T  +VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEK GFE  TLRP+K+ QI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNG  64

Query  626  IAERFDW  646
            IAER+DW
Sbjct  65   IAERYDW  71



>ref|XP_010439234.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=448

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  446  TEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNG  625
            T  +VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEK GFE  TLRP+K+ QI  LLNG
Sbjct  5    TASSVVTTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNG  64

Query  626  IAERFDW  646
            IAER+DW
Sbjct  65   IAERYDW  71



>ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = +2

Query  443  PTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            PT  A  VV+T+PLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI  L
Sbjct  44   PTSSASSVVATKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEVKTLRPIKYEQITAL  103

Query  617  LNGIAERFDW  646
            LNGIAER+ W
Sbjct  104  LNGIAERYGW  113



>ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  437  SPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAEL  616
            +P +  +VV T+PLTK+DLI Y  SGCKPKE WRIGTEHEKF FE  TLRP+K+ QI  L
Sbjct  2    APASASSVVVTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFCFEVKTLRPIKFEQITAL  61

Query  617  LNGIAERFDW  646
            LNGIAER+DW
Sbjct  62   LNGIAERYDW  71



>ref|XP_010448773.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010448774.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
             V +T+PLTK+DLIDY  SGCKPKE WRIGTEHEK GFE  TLRP+K+ QI  LLNGIAE
Sbjct  9    VVAATKPLTKEDLIDYHASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNGIAE  68

Query  635  RFDW  646
            R+DW
Sbjct  69   RYDW  72



>ref|XP_004971557.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=489

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAV--VSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGT  580
            RRR   + AASP  E+A     TEPLTK+DL+ YL SGCKP+  WRIGTEHEKFGF+  T
Sbjct  31   RRRFVAVAAASPLVEEAARATETEPLTKEDLVAYLASGCKPRSDWRIGTEHEKFGFQVET  90

Query  581  LRPMKYAQIAELLNGIAERF  640
            LRP+ Y QI +LLNGIA+RF
Sbjct  91   LRPINYMQIRDLLNGIADRF  110



>ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
Length=455

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  425  IVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ  604
            IVAA+P  ED++    PLTK DL+DYL SGCKPK +WRIGTEHEKFGF   TL+P+ Y Q
Sbjct  5    IVAAAPAAEDSITKAAPLTKLDLVDYLASGCKPKSRWRIGTEHEKFGFNKSTLKPLDYPQ  64

Query  605  IAELLNGIAERFDW  646
            I++L   + ERF+W
Sbjct  65   ISQLFEALCERFNW  78



>emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
Length=436

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            EPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct  1    EPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYEQIAELLNSIAERFEW  59



>ref|XP_007158499.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
 gb|ESW30493.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
Length=493

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  413  RHGLIVAASPPTEDA-VVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            R  +IVA  P  + A  ++ EPLTK  LI Y+ SGCKPK+ WRIGTEHEKFGFE  TLR 
Sbjct  39   RRSVIVATGPAIDQAPAIAQEPLTKDHLIHYMASGCKPKQSWRIGTEHEKFGFERNTLRS  98

Query  590  MKYAQIAELLNGIAERFDW  646
            + Y Q++ LLNGIAERFDW
Sbjct  99   INYKQLSALLNGIAERFDW  117



>ref|XP_001757520.1| predicted protein [Physcomitrella patens]
 gb|EDQ77577.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  428  VAASPPTEDA-VVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ  604
            V  SPP+ DA     EPLT++DL+ YL SGCKPKEKWRIGTEHEKFGF+   L+PM Y Q
Sbjct  11   VIGSPPSNDAGSYGGEPLTRQDLVGYLASGCKPKEKWRIGTEHEKFGFQLDNLQPMTYPQ  70

Query  605  IAELLNGIAERFDW  646
            I +LL G+A+RF+W
Sbjct  71   IKQLLEGLADRFEW  84



>ref|XP_010433942.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=447

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  461  VSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERF  640
            V T+PLTK+DLI Y  SGCKPKE WRIGTEHEKFGFE  TLRP+++ QI  LLNGIAER+
Sbjct  9    VVTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKFGFEIKTLRPIEFEQITALLNGIAERY  68

Query  641  DW  646
            DW
Sbjct  69   DW  70



>ref|XP_010439229.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010439230.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
             V +T+PLTK+DLI Y  SGCKPKE WRIGTEHEK GFE  TLRP+K+ QI  LLNGIAE
Sbjct  9    VVATTKPLTKEDLIAYFASGCKPKEMWRIGTEHEKIGFEVKTLRPIKFEQITALLNGIAE  68

Query  635  RFDW  646
            R+DW
Sbjct  69   RYDW  72



>gb|ADY17635.1| gamma-glutamylcysteine synthetase [Salix sachalinensis]
Length=301

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  488  DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            DLI YL SGCKPKE WRIGTEHEKFGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  2    DLIAYLASGCKPKENWRIGTEHEKFGFENGTLRPMKYEQIAELLHGIAERFDW  54



>ref|XP_006283598.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
 gb|EOA16496.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
Length=495

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 58/79 (73%), Gaps = 5/79 (6%)
 Frame = +2

Query  425  IVAASPPTEDAVVST-----EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP  589
            IVA +  +  A+ +T      PLTK+DLI +  SGCKPKE WRIGTE+EK GFE  TLRP
Sbjct  40   IVACNQGSNKAIANTCSVIETPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLRP  99

Query  590  MKYAQIAELLNGIAERFDW  646
            MKY QIA LLNGIAERFDW
Sbjct  100  MKYEQIASLLNGIAERFDW  118



>emb|CDX94156.1| BnaC07g37900D [Brassica napus]
Length=491

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
            + ++TEPLTK+DLI Y +SGCK KE WRIGTEHEK GF+  TLRP+KY QI  LLNGI+E
Sbjct  52   SALATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPIKYEQITALLNGISE  111

Query  635  RFDW  646
            RFDW
Sbjct  112  RFDW  115



>emb|CDY63259.1| BnaA03g58670D [Brassica napus]
Length=491

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
            + ++TEPLTK+DLI Y +SGCK KE WRIGTEHEK GF+  TLRP+ Y QI  LLNGI+E
Sbjct  52   SALATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPITYEQITALLNGISE  111

Query  635  RFDW  646
            RFDW
Sbjct  112  RFDW  115



>ref|XP_009137312.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
 ref|XP_009137313.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=491

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAE  634
            + ++TEPLTK+DLI Y +SGCK KE WRIGTEHEK GF+  TLRP+ Y QI  LLNGI+E
Sbjct  52   SALATEPLTKEDLIAYFSSGCKTKEMWRIGTEHEKIGFDVKTLRPITYEQITALLNGISE  111

Query  635  RFDW  646
            RFDW
Sbjct  112  RFDW  115



>ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
Length=438

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
             EPLTK DL+DYL SGCKPK KWRIGTEHEKFGF   +L P+ Y QIA+LL G+AERF+W
Sbjct  2    AEPLTKLDLVDYLASGCKPKSKWRIGTEHEKFGFRMSSLEPIDYDQIAQLLEGLAERFNW  61



>ref|XP_004971558.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase A, 
chloroplastic-like [Setaria italica]
Length=445

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +2

Query  440  PPTEDAVVSTE--PLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAE  613
            PP E+AV +T+  PL K DL+ +L SGCKP+  WRIGTEHEKFGF+  TLRP+ Y QI +
Sbjct  35   PPVEEAVRATDTVPLAKWDLVAHLASGCKPRHDWRIGTEHEKFGFQVQTLRPINYDQITQ  94

Query  614  LLNGIAERFDW  646
            L NGIA+RF W
Sbjct  95   LFNGIADRFGW  105



>ref|XP_010440635.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=443

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +PLTK+DLI +  SGCKPKE WRIGTE+EK GFE  TL PMKY Q+A LL+GIAERF+W
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEW  115



>ref|XP_010440632.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010440634.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=492

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +PLTK+DLI +  SGCKPKE WRIGTE+EK GFE  TL PMKY Q+A LL+GIAERF+W
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEW  115



>ref|XP_010435330.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010435331.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=492

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +2

Query  470  EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +PLTK+DLI +  SGCKPKE WRIGTE+EK GFE  TL PMKY Q+A LL+GIAERF+W
Sbjct  57   KPLTKEDLIAFFASGCKPKEMWRIGTENEKLGFEVKTLCPMKYEQVAALLSGIAERFEW  115



>gb|AES94042.2| gamma glutamyl cysteine synthetase [Medicago truncatula]
Length=239

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  503  LTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            +  GCKPKEKWRIGTEHEKFGFEF TLRP+ Y QI+ LLNGIA RFDW
Sbjct  1    MVHGCKPKEKWRIGTEHEKFGFEFDTLRPINYQQISALLNGIAARFDW  48



>ref|XP_001778732.1| predicted protein [Physcomitrella patens]
 gb|EDQ56430.1| predicted protein [Physcomitrella patens]
Length=502

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 4/81 (5%)
 Frame = +2

Query  410  RRHGLIVAASPPTEDAVVST----EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFG  577
            R    IVA+SP  E+A        + LTK+DL+D+L SGCKPK +WRIGTEHEK GF+  
Sbjct  41   RHTSHIVASSPAVEEAAAKAAARGKDLTKEDLVDFLRSGCKPKSEWRIGTEHEKLGFQLD  100

Query  578  TLRPMKYAQIAELLNGIAERF  640
            TL+ M + QI++LL+G+A RF
Sbjct  101  TLKRMTFDQISKLLDGMASRF  121



>ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=488

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY-AQIAELLNGIA  631
            A V T PLTK DL++YL SG KPK +WRIGTEHEKFG++   LRPM+Y A +  LL  + 
Sbjct  49   AAVQTTPLTKADLVEYLRSGSKPKSEWRIGTEHEKFGYQKSNLRPMEYDAHV--LLEALV  106

Query  632  ERFDW  646
             RFDW
Sbjct  107  RRFDW  111



>ref|XP_006851854.1| hypothetical protein AMTR_s00041p00090560 [Amborella trichopoda]
 gb|ERN13321.1| hypothetical protein AMTR_s00041p00090560 [Amborella trichopoda]
Length=144

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  347  SWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPK  526
            SWNS +A    RS     G+RR    IVAASPPT+DA+V+T+PLTK+DL+ YL SGCKPK
Sbjct  59   SWNSLRARWLSRSQ--TTGWRRAGCYIVAASPPTDDALVATDPLTKEDLVSYLASGCKPK  116

Query  527  EKWR  538
            E WR
Sbjct  117  EAWR  120



>ref|XP_005844806.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
 gb|EFN52704.1| hypothetical protein CHLNCDRAFT_26566 [Chlorella variabilis]
Length=477

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 6/80 (8%)
 Frame = +2

Query  407  RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR  586
            RRR  +   A+ P      +T+ LTK DL+ YL SGCKP+++WRIGTEHEK G+     R
Sbjct  26   RRRVAVRGVAAEP------ATQRLTKDDLVAYLESGCKPRDQWRIGTEHEKLGYNVADGR  79

Query  587  PMKYAQIAELLNGIAERFDW  646
             + Y QIA LL  I ERF+W
Sbjct  80   RLTYEQIAALLTRIGERFNW  99



>ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
Length=489

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 3/63 (5%)
 Frame = +2

Query  461  VSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY-AQIAELLNGIAER  637
             +T  LTKKDL+ YL SGCKPK +  IGTEHEKFG++   LRPM+Y A +A+LL+ + +R
Sbjct  52   TATNALTKKDLVAYLESGCKPKSQ--IGTEHEKFGYQLANLRPMEYDAHVAKLLHALVDR  109

Query  638  FDW  646
            FDW
Sbjct  110  FDW  112



>gb|ADX30738.2| truncated gamma-glutamyl-cysteine synthetase, partial [Populus 
x canadensis]
Length=415

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  533  WRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            WRIGTEHEKFGFE GTLRPMKY QIAELL+GIAERFDW
Sbjct  1    WRIGTEHEKFGFEIGTLRPMKYEQIAELLHGIAERFDW  38



>ref|XP_007513078.1| glutamate--cysteine ligase [Bathycoccus prasinos]
 emb|CCO16636.1| glutamate--cysteine ligase [Bathycoccus prasinos]
Length=521

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +2

Query  434  ASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAE  613
            A+PP+E       P +++++ID+L SGCKPKE WRIGTEHEKFGF       M YA I  
Sbjct  56   AAPPSEGGP-KKPPASREEMIDFLRSGCKPKENWRIGTEHEKFGFSLTDNSRMPYAVIDY  114

Query  614  LLNGIAERFDW  646
            +L+G+ ER+ W
Sbjct  115  VLSGLVERYGW  125



>ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
Length=479

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  467  TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            TEPL K++L+DYL SGC+P+  WRIGTEHEK GF       M Y QIA++L  +  RF W
Sbjct  43   TEPLLKQELVDYLKSGCRPRSAWRIGTEHEKLGFNLADNSRMNYDQIAQVLRKLEARFGW  102



>ref|XP_005646648.1| plant glutamate cysteine ligase in complex with Mg2+ and L-glutamate 
[Coccomyxa subellipsoidea C-169]
 gb|EIE22104.1| plant glutamate cysteine ligase in complex with Mg2+ and L-glutamate 
[Coccomyxa subellipsoidea C-169]
Length=452

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  434  ASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAE  613
            ++ P+  A  +T+ LTK+DL+ YL SGCKP+EKWRIGTEHEK G+       + Y  I +
Sbjct  2    SAAPSTIAPEATQQLTKEDLVKYLASGCKPREKWRIGTEHEKLGYNTADNSRIGYDVIQK  61

Query  614  LLNGIAERFDW  646
            LL G+ +RF W
Sbjct  62   LLQGLCDRFGW  72



>ref|XP_009138281.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Brassica rapa]
Length=82

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            RIGTEHEKFGFE  TLRPMKY QIA+LLN IAERF+W
Sbjct  11   RIGTEHEKFGFEVNTLRPMKYDQIAKLLNSIAERFEW  47



>ref|XP_009138279.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=91

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            RIGTEHEKFGFE  TLRPMKY QIA+LLN IAERF+W
Sbjct  11   RIGTEHEKFGFEVNTLRPMKYDQIAKLLNSIAERFEW  47



>emb|CDY32005.1| BnaC06g15830D [Brassica napus]
Length=199

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  EDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFE  571
            E++VV+TE LT++DLI Y  SGCKPK+KWRIGTEHEKFGFE
Sbjct  55   EESVVATESLTREDLIAYFASGCKPKQKWRIGTEHEKFGFE  95



>emb|CDY45302.1| BnaA03g52750D [Brassica napus]
Length=194

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            RIGTEHEKFGFE  TLRPMKY QIA+LLN IAERF+W
Sbjct  114  RIGTEHEKFGFEVNTLRPMKYDQIAKLLNSIAERFEW  150



>ref|XP_009138280.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=89

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  539  IGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            IGTEHEKFGFE  TLRPMKY QIA+LLN IAERF+W
Sbjct  10   IGTEHEKFGFEVNTLRPMKYDQIAKLLNSIAERFEW  45



>gb|KIY94325.1| glutamate--cysteine ligase [Monoraphidium neglectum]
Length=324

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +2

Query  422  LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA  601
            +I  A+ P E   V   P+T++DLI++++SGCK +++WRIGTEHEK GF     R M Y 
Sbjct  3    IICPANAPQEGPAV---PVTREDLIEHISSGCKTRDRWRIGTEHEKLGFRVADKRRMDYD  59

Query  602  QIAELLNGIAERFDW  646
            +I ++   +  RF W
Sbjct  60   EIRQVFGKLESRFGW  74



>ref|XP_006851855.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
 gb|ERN13322.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
Length=439

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  536  RIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            RIGTEHEKFGFEFG+LRP++Y QIA+LL G+AERFDW
Sbjct  26   RIGTEHEKFGFEFGSLRPLRYDQIADLLTGLAERFDW  62



>ref|WP_041643346.1| glutamate--cysteine ligase, partial [Magnetococcus marinus]
Length=451

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +2

Query  455  AVVSTEPLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLN  622
            A+    P+T+ D L+ YL +GC PKE+WRIGTEHEKFGF    L P+ Y   A I  LLN
Sbjct  3    AIDLATPVTRFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGEAGIGRLLN  62

Query  623  GIAERFDW  646
             +A+R+ W
Sbjct  63   SMADRYGW  70



>gb|ABK46164.1| glutamate--cysteine ligase [Magnetococcus marinus MC-1]
Length=465

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +2

Query  455  AVVSTEPLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLN  622
            A+    P+T+ D L+ YL +GC PKE+WRIGTEHEKFGF    L P+ Y   A I  LLN
Sbjct  3    AIDLATPVTRFDQLVTYLEAGCTPKEQWRIGTEHEKFGFRKRDLTPIPYEGEAGIGRLLN  62

Query  623  GIAERFDW  646
             +A+R+ W
Sbjct  63   SMADRYGW  70



>gb|AFC88288.1| gamma-glutamylcysteine synthetase [Chlamydomonas sp. ICE-L]
Length=483

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  476  LTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            LTK+DLI++L  GCKP+ KWRIGTEHEK GF       M + QIA++L  +  RF W
Sbjct  50   LTKEDLINHLRGGCKPRHKWRIGTEHEKLGFNLRDNSRMNHDQIAKMLRKLESRFGW  106



>ref|WP_031555060.1| glutamate--cysteine ligase [Parvularcula oceani]
Length=446

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 12/72 (17%)
 Frame = +2

Query  440  PPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIA  610
            PP ED           +L  YL SGCKPK++WR+GTEHEKFGF   TL P+ ++    I 
Sbjct  2    PPIEDI---------SELSAYLASGCKPKDQWRLGTEHEKFGFLRDTLEPLPFSGERSIQ  52

Query  611  ELLNGIAERFDW  646
             +L+G+A+RF W
Sbjct  53   SVLSGLADRFGW  64



>ref|WP_043871177.1| glutamate--cysteine ligase [Celeribacter indicus]
 gb|AJE49000.1| glutamate--cysteine ligase [Celeribacter indicus]
Length=456

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +2

Query  479  TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            +  DL+ YL SGCKP++ W+IGTEHEKFG+   TL P+ YA    I  +L GI +RF W
Sbjct  13   SHDDLVAYLMSGCKPRDAWKIGTEHEKFGYCKDTLAPLPYAGERSIKAILEGIQDRFGW  71



>ref|WP_031448324.1| glutamate--cysteine ligase [Caulobacteraceae bacterium PMMR1]
Length=456

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = +2

Query  452  DAVVSTE-PLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELL  619
            D ++  + PLT KDL  YL SGCKP   +RIG EHEKFGF  GTLRP+ Y     I  LL
Sbjct  2    DGIIQDDRPLTLKDLAAYLASGCKPPADFRIGAEHEKFGFRHGTLRPVAYDGPDGIRALL  61

Query  620  NGIAERFDW  646
             G+  RF W
Sbjct  62   EGMM-RFGW  69



>gb|KCZ49144.1| glutamate--cysteine ligase [Hyphomonas sp. CY54-11-8]
Length=459

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = +2

Query  443  PTEDAVVSTEPLT--KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQI  607
            PT D +  T P    K +L++YL +GCKP E WRIGTEHEKFGF    L P+ Y   A +
Sbjct  4    PTSD-IDETSPRIAGKHELVEYLEAGCKPSEDWRIGTEHEKFGFLRENLAPLPYEGKASV  62

Query  608  AELLNGIAERFDW  646
              +L G+ +RF W
Sbjct  63   LAMLEGLRDRFGW  75



>ref|WP_027840020.1| glutamate--cysteine ligase [Mastigocoleus testarum]
Length=459

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   ++  + +K +LI+Y  +G KP+++WR+GTEHEKFGF    LRP+ Y   A + 
Sbjct  4    PTSDIDETSRRIASKSELIEYFEAGNKPRDQWRVGTEHEKFGFLREGLRPLPYEGEASVL  63

Query  611  ELLNGIAERFDW  646
             +L G+ +RFDW
Sbjct  64   AILEGLRDRFDW  75



>ref|WP_035537514.1| glutamate--cysteine ligase [Hyphomonas oceanitis]
Length=459

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   S+  + +K +L+ YL +G KP+  WRIGTEHEKFGF    LRP+ Y   A I 
Sbjct  4    PTADIDESSARIESKTELVAYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIL  63

Query  611  ELLNGIAERFDW  646
             +L G+ + FDW
Sbjct  64   AMLEGLRDTFDW  75



>gb|KDA02929.1| glutamate--cysteine ligase [Hyphomonas oceanitis SCH89]
Length=471

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   S+  + +K +L+ YL +G KP+  WRIGTEHEKFGF    LRP+ Y   A I 
Sbjct  16   PTADIDESSARIESKTELVAYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIL  75

Query  611  ELLNGIAERFDW  646
             +L G+ + FDW
Sbjct  76   AMLEGLRDTFDW  87



>ref|WP_020057893.1| glutamate--cysteine ligase [alpha proteobacterium SCGC AAA076-C03]
Length=454

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +2

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            L +YL SGCKP + WRIGTEHEKFGF+  TL+P+ Y     I  +L G+ + FDW
Sbjct  17   LSEYLESGCKPTKDWRIGTEHEKFGFDKSTLKPLPYEGSCSIKSMLEGLRDTFDW  71



>gb|KCZ62975.1| glutamate--cysteine ligase [Hyphomonas sp. L-53-1-40]
Length=459

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   +++ ++ K +L++Y  +G KPK  WRIGTEHEKFGF    LRP+ Y   A + 
Sbjct  4    PTSDIDENSQRISGKSELVEYFEAGNKPKADWRIGTEHEKFGFLREGLRPLPYEGEASVL  63

Query  611  ELLNGIAERFDW  646
             +L G+ +RFDW
Sbjct  64   AILEGLRDRFDW  75



>ref|WP_026986595.1| glutamate--cysteine ligase [Fodinicurvata fenggangensis]
Length=455

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +2

Query  470  EPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAER  637
            +P+T K+ L+ YL +G KP   WRIGTEHEKFGFE  TL+ + Y   A I  +L G+AER
Sbjct  10   DPITGKEQLVRYLETGAKPAADWRIGTEHEKFGFERTTLKSLPYEGTASIRAILEGMAER  69

Query  638  FDW  646
            F W
Sbjct  70   FGW  72



>ref|WP_034763127.1| glutamate--cysteine ligase [Hyphomonas sp. CY54-11-8]
Length=445

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  482  KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            K +L++YL +GCKP E WRIGTEHEKFGF    L P+ Y   A +  +L G+ +RF W
Sbjct  4    KHELVEYLEAGCKPSEDWRIGTEHEKFGFLRENLAPLPYEGKASVLAMLEGLRDRFGW  61



>ref|WP_008438534.1| glutamate--cysteine ligase [Rhodanobacter thiooxydans]
 gb|EIL97239.1| glutamate--cysteine ligase [Rhodanobacter thiooxydans LCS2]
Length=455

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNG  625
            AV ST    ++ L+DYL +G KP+E WRIGTEHEKFGF    LRP  +     I  LL G
Sbjct  6    AVKSTPIQGRQQLVDYLAAGEKPREAWRIGTEHEKFGFRTDDLRPPAFEGERGIRALLEG  65

Query  626  IAERFDW  646
            IA R+ W
Sbjct  66   IATRYGW  72



>ref|WP_011457023.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
 gb|ABD56826.1| glutamate--cysteine ligase [Jannaschia sp. CCS1]
Length=456

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +2

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            L +YL+ GCKPK  WRIGTEHEKFGF   TL+P+ Y     +  +L G+ +RFDW
Sbjct  17   LAEYLSDGCKPKADWRIGTEHEKFGFCRDTLQPIPYEGARSVRAVLEGLRDRFDW  71



>ref|WP_002725375.1| glutamate--cysteine ligase [Phaeospirillum molischianum]
 emb|CCG39711.1| gamma-glutamylcysteine synthetase (Glutamate--cysteine ligase) 
[Phaeospirillum molischianum DSM 120]
Length=455

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +2

Query  455  AVVSTEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLN  622
            AV S EP+T  + L++ L +GCKPKE WRIGTEHEKFGF    L+P+ Y     I  +LN
Sbjct  5    AVPSAEPVTGTRQLVEALEAGCKPKEAWRIGTEHEKFGFTLEDLKPLPYEGPRGIKTMLN  64

Query  623  GI  628
            G+
Sbjct  65   GL  66



>ref|WP_009572338.1| glutamate--cysteine ligase [Celeribacter baekdonensis]
 gb|EKE70709.1| glutamate--cysteine ligase [Celeribacter baekdonensis B30]
Length=456

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = +2

Query  488  DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            DL+++   GCKP+E W+IGTEHEKFG+   TL P+ YA    I  LL G+ +RF W
Sbjct  16   DLVNFFAEGCKPRENWKIGTEHEKFGYCKDTLNPLPYAGDRSIKALLEGLQDRFGW  71



>ref|WP_018998172.1| glutamate--cysteine ligase [Hirschia maritima]
Length=458

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +2

Query  479  TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            TK +LI +L  GCKP+E+WRIGTEHEKFGF     RP+ Y   + +  +L G+ +RF+W
Sbjct  17   TKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNRPLPYDGDSSVRAVLEGLRDRFEW  75



>ref|WP_013960367.1| glutamate--cysteine ligase [Roseobacter litoralis]
 gb|AEI92424.1| glutamate--cysteine ligase [Roseobacter litoralis Och 149]
Length=456

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+T  D ++ YL SGCKPKE+WRIGTEHEKFG+   TL P+ Y     I  +L G+ + F
Sbjct  10   PITSYDQMVSYLASGCKPKEEWRIGTEHEKFGYCKDTLLPLPYEGDRSIQAVLEGLRDTF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_025898136.1| glutamate--cysteine ligase [Sneathiella glossodoripedis]
Length=455

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +2

Query  473  PLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+T K  LI++  SGCKPK+ WRIGTEHEKFGF+  TL+P+ Y     I  +L G+ +RF
Sbjct  11   PITSKSQLIEFAQSGCKPKKDWRIGTEHEKFGFDLKTLQPLPYEGPNGIKAMLEGL-QRF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_018304101.1| glutamate--cysteine ligase [Wenxinia marina]
 gb|KIQ70357.1| glutamate--cysteine ligase, plant type [Wenxinia marina DSM 24838]
Length=456

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            + L +YL  GCKPK++WRIGTEHEKFGF   + RP+ YA    I  +L+G+ +RF W
Sbjct  15   EQLAEYLAEGCKPKDQWRIGTEHEKFGFCTDSHRPLPYAGERSIHAVLSGLRDRFGW  71



>dbj|BAE52827.1| Gamma-glutamylcysteine synthetase [Magnetospirillum magneticum 
AMB-1]
Length=463

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = +2

Query  440  PPTEDAVVSTEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QI  607
            P +  A  S EP+  K  L++YL SGCKPK+ WRIGTEHEKFGF    L+P+ Y     I
Sbjct  8    PMSAPAKPSGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPVPYGGDKGI  67

Query  608  AELLNGIA  631
              +L+G+ 
Sbjct  68   KAMLDGLV  75



>ref|WP_034815788.1| glutamate--cysteine ligase [Hyphomonas sp. L-53-1-40]
Length=452

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  482  KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            K +L++Y  +G KPK  WRIGTEHEKFGF    LRP+ Y   A +  +L G+ +RFDW
Sbjct  11   KSELVEYFEAGNKPKADWRIGTEHEKFGFLREGLRPLPYEGEASVLAILEGLRDRFDW  68



>ref|WP_012568753.1| glutamate--cysteine ligase [Rhodospirillum centenum]
 gb|ACJ00977.1| glutamate--cysteine ligase [Rhodospirillum centenum SW]
Length=455

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +2

Query  470  EPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAER  637
            EP+T ++ L+++L +GCKP ++WRIGTEHEKF F     RP+ Y     I  +LN +A+R
Sbjct  10   EPITDRRQLVEHLEAGCKPADRWRIGTEHEKFAFRRADKRPLPYDGPDGIGAILNALADR  69

Query  638  FDW  646
            + W
Sbjct  70   YGW  72



>ref|WP_022727621.1| glutamate--cysteine ligase [Fodinicurvata sediminis]
Length=455

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +2

Query  470  EPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAER  637
            +P+T K+ L+ YL +G KP   WRIGTEHEKFGFE  TL+ + Y   A I  +L G++ER
Sbjct  10   DPITGKEQLVRYLETGAKPAADWRIGTEHEKFGFERTTLQSLPYDGTASIRAILEGMSER  69

Query  638  FDW  646
            F W
Sbjct  70   FGW  72



>emb|CEG00964.1| Glutamate--cysteine ligase, plant, partial [Ostreococcus tauri]
Length=473

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  443  PTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLN  622
            P+   V  +  LT++  + Y+  GCKP+E +RIGTEHEK GF+  TLR M Y  +  +L 
Sbjct  22   PSTPCVKGSAALTREACVAYVREGCKPREMFRIGTEHEKLGFDAATLRRMDYPVVRHVLT  81

Query  623  GIAERFDW  646
             + +R+ W
Sbjct  82   SLVDRYGW  89



>ref|WP_035612545.1| glutamate--cysteine ligase [Hyphomonas johnsonii]
 gb|KCZ93869.1| glutamate--cysteine ligase [Hyphomonas johnsonii MHS-2]
Length=459

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   ++  + +K +LI YL +G KP+  WRIGTEHEKFGF    LRP+ Y   A + 
Sbjct  4    PTSDVDEASPRIESKAELIAYLAAGSKPQADWRIGTEHEKFGFLTDGLRPLPYEGTASVC  63

Query  611  ELLNGIAERFDW  646
             +L G+ +RF W
Sbjct  64   AMLEGLRDRFGW  75



>ref|WP_034744831.1| glutamate--cysteine ligase [Hyphomonas chukchiensis]
Length=459

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   S+  + +K +L++YL +G KP+  WRIGTEHEKFGF    LRP+ Y   A I 
Sbjct  4    PTADIDESSARIESKTELVEYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIR  63

Query  611  ELLNGIAERFDW  646
             +L G+ + F W
Sbjct  64   AMLEGLRDTFGW  75



>ref|WP_013383393.1| glutamate--cysteine ligase [Ketogulonicigenium vulgare]
 gb|ADO41742.1| glutamate/cysteine ligase [Ketogulonicigenium vulgare Y25]
Length=445

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + L ++L  GCKPKE WRIGTEHEKFGF      P+ YA I +++  + +RF W
Sbjct  15   EQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYAGINQIMTRLIDRFGW  68



>ref|WP_014537450.1| glutamate--cysteine ligase [Ketogulonicigenium vulgare]
 ref|YP_005793973.1| hypothetical protein KVU_0138 [Ketogulonicigenium vulgare WSH-001]
 gb|AEM39977.1| hypothetical protein KVU_0138 [Ketogulonicigenium vulgare WSH-001]
Length=445

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW  646
            + L ++L  GCKPKE WRIGTEHEKFGF      P+ YA I +++  + +RF W
Sbjct  15   EQLAEFLAKGCKPKENWRIGTEHEKFGFVTADHAPLPYAGINQIMTRLIDRFGW  68



>ref|WP_028092401.1| glutamate--cysteine ligase [Donghicola xiamenensis]
Length=456

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            +DL +YL SGCKPKE WRIGTEHEKFGF   +  P+ Y     I  +L G+ +RF W
Sbjct  15   EDLAEYLASGCKPKEDWRIGTEHEKFGFIKDSHLPLPYEGEKSILTVLEGLRDRFGW  71



>ref|WP_007427205.1| glutamate--cysteine ligase [Oceaniovalibus guishaninsula]
 gb|EKE43719.1| glutamate--cysteine ligase [Oceaniovalibus guishaninsula JLT2003]
Length=456

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +2

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            L DY+ SGCKPK  WRIGTEHEKFG+   TL+P+ Y     +  +L G+ +RF W
Sbjct  17   LADYMASGCKPKADWRIGTEHEKFGYCRDTLKPLPYHGPRSVEAVLTGLRDRFGW  71



>ref|WP_012654088.1| glutamate--cysteine ligase [Agrobacterium vitis]
 gb|ACM38846.1| glutamate--cysteine ligase [Agrobacterium vitis S4]
Length=457

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTK-KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERF  640
            PLT  +D+  Y+  GCKPKE +RIGTEHEKFGF    L P+ Y   A I+ LLNG+  R 
Sbjct  10   PLTSIEDMAAYMAEGCKPKETFRIGTEHEKFGFFTADLSPVPYFGEASISALLNGMQARL  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>gb|KCZ53527.1| glutamate--cysteine ligase [Hyphomonas chukchiensis]
Length=471

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = +2

Query  443  PTEDAVVSTEPL-TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIA  610
            PT D   S+  + +K +L++YL +G KP+  WRIGTEHEKFGF    LRP+ Y   A I 
Sbjct  16   PTADIDESSARIESKTELVEYLDAGSKPRADWRIGTEHEKFGFTTADLRPLPYEGKASIR  75

Query  611  ELLNGIAERFDW  646
             +L G+ + F W
Sbjct  76   AMLEGLRDTFGW  87



>ref|WP_028098740.1| glutamate--cysteine ligase [Dongia sp. URHE0060]
Length=454

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 5/63 (8%)
 Frame = +2

Query  470  EPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ---IAELLNGIAER  637
            EP+T K  L++Y +SG KPK  WRIGTEHEKF F+  TLRP+ Y     I  +LNG+  R
Sbjct  10   EPITSKAQLVEYFSSGSKPKSAWRIGTEHEKFVFDAKTLRPVSYDAPNGIGAILNGLT-R  68

Query  638  FDW  646
            F W
Sbjct  69   FGW  71



>ref|WP_011570131.1| glutamate--cysteine ligase [Roseobacter denitrificans]
 gb|ABG33521.1| glutamate-cysteine ligase [Roseobacter denitrificans OCh 114]
Length=456

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+T  D ++ YL SGCKPKE WRIGTEHEKFG+   TL P+ Y     I  +L G+ + F
Sbjct  10   PITSYDQMVGYLASGCKPKEDWRIGTEHEKFGYCKDTLLPLPYEGDRSIRAMLEGLRDTF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_008208925.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
 gb|EBA15112.1| glutamate--cysteine ligase [Roseobacter sp. SK209-2-6]
Length=456

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 3/57 (5%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            + L +YL SGCKP++ WRIGTEHEKFG+   TL+P+ YA    I  +L G+ ++F W
Sbjct  15   EQLAEYLASGCKPRDAWRIGTEHEKFGYCKDTLKPLPYAGERSIQAVLEGLRDKFGW  71



>ref|WP_043745404.1| glutamate--cysteine ligase [Magnetospirillum magneticum]
Length=455

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 4/60 (7%)
 Frame = +2

Query  464  STEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIA  631
            S EP+  K  L++YL SGCKPK+ WRIGTEHEKFGF    L+P+ Y     I  +L+G+ 
Sbjct  8    SGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPVPYGGDKGIKAMLDGLV  67



>emb|CCQ74722.1| Glutamate--cysteine ligase [Magnetospira sp. QH-2]
Length=450

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  458  VVSTEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY  598
            + ++EP+T ++ L++YL SGCKP+++W+IGTEHEKF ++  TL+P++Y
Sbjct  1    MAASEPITDRRQLVEYLASGCKPRDQWKIGTEHEKFAYDLETLKPLEY  48



>ref|WP_043136175.1| glutamate--cysteine ligase [Ponticoccus sp. UMTAT08]
 gb|KHQ55136.1| Glutamate--cysteine ligase [Ponticoccus sp. UMTAT08]
Length=456

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+T  D L +YL SGCKPK++WRIGTEHEKFG+   +L+P+ Y     I  +L G+ +R 
Sbjct  10   PITSHDQLAEYLASGCKPKDQWRIGTEHEKFGYCKDSLKPLPYDGERSIRAVLEGLRDRH  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_044559775.1| glutamate--cysteine ligase [Azospirillum sp. B4]
Length=455

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +2

Query  434  ASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQ  604
            ++PP       T+   +++LI+YL  G KP + WRIGTEHEKF F  G  RP+ Y     
Sbjct  2    SAPPKSPGAPITD---RRELIEYLEQGNKPADAWRIGTEHEKFAFRLGDNRPLPYEGEQG  58

Query  605  IAELLNGIAERFDW  646
            I  +L  +A RFDW
Sbjct  59   IGRILTEMASRFDW  72



>ref|WP_038005861.1| MULTISPECIES: glutamate--cysteine ligase [Thalassobacter]
 gb|KGK79423.1| glutamate--cysteine ligase [Thalassobacter stenotrophicus]
 gb|KGL01630.1| glutamate--cysteine ligase [Thalassobacter sp. 16PALIMAR09]
Length=456

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+T  D L  YL  GCKPKE WRIGTEHEKFG+   +L+P+ Y     I  +L G+  R+
Sbjct  10   PITHHDQLAQYLADGCKPKEDWRIGTEHEKFGYCKDSLKPLPYDGDRSIKAVLEGLQHRY  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_015826863.1| glutamate--cysteine ligase [Hirschia baltica]
 gb|ACT58713.1| glutamate/cysteine ligase [Hirschia baltica ATCC 49814]
Length=458

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +2

Query  479  TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW  646
            +K +LI +L  GCKP+E+WRIGTEHEKFGF     +P+ Y   A +  +L G+ +RF+W
Sbjct  17   SKDELIAHLAKGCKPREEWRIGTEHEKFGFLKDGNQPVPYDGHASVRSMLEGLRDRFNW  75



>ref|WP_036637388.1| glutamate--cysteine ligase [Paenirhodobacter enshiensis]
 gb|KFI26491.1| glutamate--cysteine ligase [Paenirhodobacter enshiensis]
Length=448

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            + L +Y+ SG KP   WRIGTEHEKFGF+  TLRP+ YA    I  LL G+  RF W
Sbjct  15   EQLAEYIASGEKPAADWRIGTEHEKFGFDTKTLRPLPYAGETSIEALLQGLRTRFGW  71



>ref|WP_009870063.1| COG3572: Gamma-glutamylcysteine synthetase [Magnetospirillum 
magnetotacticum]
 gb|KIL99647.1| Glutamate--cysteine ligase [Magnetospirillum magnetotacticum 
MS-1]
Length=455

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 4/60 (7%)
 Frame = +2

Query  464  STEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIA  631
            S EP+  K  L++YL SGCKPK+ WRIGTEHEKFGF    L+P+ Y     +  +L+G+ 
Sbjct  8    SGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDLKPLPYEGGHGVKAMLDGLV  67



>ref|WP_021132910.1| gamma-glutamylcysteine synthetase [Phaeospirillum fulvum]
 gb|EPY01008.1| gamma-glutamylcysteine synthetase [Phaeospirillum fulvum MGU-K5]
Length=455

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  455  AVVSTEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLN  622
            AV S EP+T  + L++ L +GCKP E WRIGTEHEKFGF    L+P+ Y     I  +LN
Sbjct  5    AVPSAEPVTGTRQLVEALEAGCKPSEAWRIGTEHEKFGFTLEDLKPLPYEGPRGIKTMLN  64

Query  623  GI  628
            G+
Sbjct  65   GL  66



>emb|CAM77119.1| Glutamate--cysteine ligase, plant [Magnetospirillum gryphiswaldense 
MSR-1]
Length=455

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = +2

Query  464  STEPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIA  631
            S EP+T +  L D+L SG KPKE WRIGTEHEKF F    LRP+ Y     I  LL+G+ 
Sbjct  8    SLEPITSRAQLADWLASGSKPKENWRIGTEHEKFAFTTDDLRPLPYDGPRGIKALLDGLV  67

Query  632  ERFDW  646
             RF W
Sbjct  68   -RFGW  71



>ref|WP_028287925.1| glutamate--cysteine ligase [Oceanicola nanhaiensis]
Length=456

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +2

Query  485  KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            + L +YL +GCKPKE WRIGTEHEKFG+   +L+P+ Y     I  +L G+ +RF W
Sbjct  15   EQLAEYLAAGCKPKEDWRIGTEHEKFGYCKDSLKPLPYEGERSIQAVLEGLRDRFGW  71



>ref|WP_027494082.1| glutamate--cysteine ligase [Rhodanobacter sp. OR444]
Length=455

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNG  625
            AV ST    ++ L DYL +G KP E WRIGTEHEKFGF    LRP  +     I  LL G
Sbjct  6    AVKSTPIAGRQQLADYLAAGEKPHEAWRIGTEHEKFGFRTDDLRPPPFEGERGIRALLEG  65

Query  626  IAERFDW  646
            IA R+ W
Sbjct  66   IAVRYGW  72



>ref|WP_024082207.1| Glutamate--cysteine ligase, chloroplastic [Magnetospirillum gryphiswaldense]
 emb|CDL01298.1| Glutamate--cysteine ligase, chloroplastic [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=455

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = +2

Query  464  STEPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIA  631
            S EP+T +  L D+L SG KPKE WRIGTEHEKF F    LRP+ Y     I  LL+G+ 
Sbjct  8    SLEPITSRAQLADWLASGSKPKENWRIGTEHEKFAFTTDDLRPLPYDGPRGIKALLDGLV  67

Query  632  ERFDW  646
             RF W
Sbjct  68   -RFGW  71



>ref|WP_008614793.1| gamma-glutamylcysteine synthetase [Magnetospirillum sp. SO-1]
 gb|EME71167.1| gamma-glutamylcysteine synthetase [Magnetospirillum sp. SO-1]
Length=455

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 4/59 (7%)
 Frame = +2

Query  464  STEPLT-KKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGI  628
            S EP+  K  L++YL SGCKPK+ WRIGTEHEKFGF     +P+ Y     I  +L+G+
Sbjct  8    SGEPIAGKHQLVEYLESGCKPKDAWRIGTEHEKFGFSLDDFKPLPYGGERGIKAMLDGL  66



>ref|WP_043917987.1| glutamate--cysteine ligase [Jannaschia aquimarina]
 gb|KIT17099.1| Glutamate--cysteine ligase GshA [Jannaschia aquimarina]
Length=462

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +2

Query  491  LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW  646
            L  Y+ +GCKP+++WRIGTEHEKFGF   TLRP+ Y     I  +L G+ +RF W
Sbjct  17   LAGYMEAGCKPRDQWRIGTEHEKFGFCEDTLRPLPYDGPRSIRAVLEGLRDRFGW  71



>ref|WP_041270803.1| glutamate--cysteine ligase [Frateuria aurantia]
Length=455

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERF  640
            P+ K+  LIDYL +G KP+E WRIGTEHEKFGF    LR   +   A I  LL  +AER+
Sbjct  11   PIVKRQQLIDYLAAGEKPQENWRIGTEHEKFGFRHADLRAPAFEGDAGIDVLLRQLAERY  70

Query  641  DW  646
             W
Sbjct  71   GW  72



>ref|WP_036701928.1| glutamate--cysteine ligase [Paracoccus sp. 10990]
 gb|KGJ20679.1| glutamate--cysteine ligase [Paracoccus sp. 10990]
Length=455

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+ ++D L  Y+ SG KP+E WRIGTEHEKFGF + TL P+ Y     I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_007256884.1| glutamate--cysteine ligase [Oceanicola granulosus]
 gb|EAR50361.1| glutamate--cysteine ligase [Oceanicola granulosus HTCC2516]
Length=456

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+  +D L  YL  GCKPKE WRIGTEHEKFG+   TL+P+ Y     I  +L G+ +R+
Sbjct  10   PIEHRDQLAAYLEEGCKPKEDWRIGTEHEKFGYCRDTLKPLPYEGDRSIRAMLEGLRDRY  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_036707793.1| glutamate--cysteine ligase [Paracoccus sp. 5503]
 gb|KGJ22973.1| glutamate--cysteine ligase [Paracoccus sp. 5503]
Length=455

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+ ++D L  Y+ SG KP+E WRIGTEHEKFGF + TL P+ Y     I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



>ref|WP_019463764.1| glutamate--cysteine ligase [Dyella japonica]
 gb|AIF46720.1| glutamate--cysteine ligase [Dyella japonica A8]
Length=455

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +2

Query  455  AVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNG  625
            AV ST   +++ L+DYL +G KP++ WRIGTEHEKFGF   TLRP  +     I  LL  
Sbjct  6    AVKSTPIDSRQQLVDYLAAGEKPRDAWRIGTEHEKFGFLTDTLRPPTFEGDRGIRVLLET  65

Query  626  IAERFDW  646
            +A R+ W
Sbjct  66   LATRYGW  72



>ref|WP_036733683.1| glutamate--cysteine ligase [Paracoccus sp. 39524]
 gb|KGJ17397.1| glutamate--cysteine ligase [Paracoccus sp. 39524]
Length=455

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +2

Query  473  PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERF  640
            P+ ++D L  Y+ SG KP+E WRIGTEHEKFGF + TL P+ Y     I  +L G+ +RF
Sbjct  10   PIERRDQLAAYIASGEKPREAWRIGTEHEKFGFLWDTLEPLPYDGERSIRAMLEGMRDRF  69

Query  641  DW  646
             W
Sbjct  70   GW  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000