BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029B13

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    216   4e-67   Nicotiana sylvestris
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    214   2e-66   Nicotiana tomentosiformis
ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    213   6e-66   
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    204   2e-62   Solanum tuberosum [potatoes]
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    193   1e-58   Cucumis melo [Oriental melon]
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    190   2e-57   Cucumis sativus [cucumbers]
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    186   6e-56   Nicotiana sylvestris
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    185   2e-55   Glycine max [soybeans]
emb|CDP07749.1|  unnamed protein product                                186   4e-55   Coffea canephora [robusta coffee]
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    182   3e-54   Prunus mume [ume]
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    182   3e-54   Nicotiana tomentosiformis
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    182   5e-54   Sesamum indicum [beniseed]
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    181   8e-54   Sesamum indicum [beniseed]
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             180   2e-53   Prunus persica
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    180   2e-53   
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    180   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    180   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    180   4e-53   Populus euphratica
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    179   5e-53   Morus notabilis
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...    178   9e-53   Glycine max [soybeans]
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    179   1e-52   Vitis vinifera
gb|KDP43451.1|  hypothetical protein JCGZ_16738                         179   1e-52   Jatropha curcas
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...    179   2e-52   Theobroma cacao [chocolate]
ref|XP_002314027.1|  zinc finger family protein                         178   2e-52   Populus trichocarpa [western balsam poplar]
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...    176   2e-52   Glycine soja [wild soybean]
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    177   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    177   4e-52   Malus domestica [apple tree]
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    177   5e-52   Citrus sinensis [apfelsine]
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg             176   8e-52   Citrus clementina [clementine]
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    176   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    175   2e-51   Fragaria vesca subsp. vesca
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g             179   3e-51   Phaseolus vulgaris [French bean]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    174   4e-51   Cucumis melo [Oriental melon]
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    174   4e-51   Nelumbo nucifera [Indian lotus]
gb|KJB25036.1|  hypothetical protein B456_004G173900                    174   6e-51   Gossypium raimondii
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    173   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002298442.1|  zinc finger family protein                         173   2e-50   Populus trichocarpa [western balsam poplar]
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg                173   2e-50   Erythranthe guttata [common monkey flower]
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                173   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    172   4e-50   Tarenaya hassleriana [spider flower]
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...    172   6e-50   Gossypium hirsutum [American cotton]
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    171   6e-50   Cucumis sativus [cucumbers]
gb|KJB22229.1|  hypothetical protein B456_004G036200                    171   1e-49   Gossypium raimondii
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    170   2e-49   
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    171   3e-49   Eucalyptus grandis [rose gum]
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    169   4e-49   Cicer arietinum [garbanzo]
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   6e-48   Tarenaya hassleriana [spider flower]
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    169   7e-48   Populus euphratica
gb|ACR56825.1|  At3g12630-like protein                                  164   3e-47   Solanum quitoense [lulo]
gb|ACR56824.1|  At3g12630-like protein                                  164   3e-47   Solanum hirtum
gb|ACR56827.1|  At3g12630-like protein                                  164   4e-47   Solanum hirtum
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg             162   2e-46   Eutrema salsugineum [saltwater cress]
emb|CDY52666.1|  BnaC01g38560D                                          161   4e-46   Brassica napus [oilseed rape]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    160   6e-46   Brassica rapa
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg             159   2e-45   Capsella rubella
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    159   3e-45   Brassica rapa
emb|CDY67538.1|  BnaUnng02260D                                          158   8e-45   Brassica napus [oilseed rape]
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                    157   1e-44   Arabis alpina [alpine rockcress]
emb|CDY08419.1|  BnaA05g26550D                                          157   2e-44   Brassica napus [oilseed rape]
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    156   6e-44   Camelina sativa [gold-of-pleasure]
emb|CDX73811.1|  BnaA03g32360D                                          155   1e-43   
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    155   1e-43   Brassica rapa
emb|CDY00788.1|  BnaC03g37720D                                          154   2e-43   
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...    154   3e-43   Medicago truncatula
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    152   8e-43   Elaeis guineensis
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    152   2e-42   
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622             150   5e-42   
ref|NP_566429.1|  E3 ligase SAP5                                        149   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    149   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    149   3e-41   Phoenix dactylifera
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    147   9e-41   Phoenix dactylifera
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    146   1e-39   
gb|EAZ45178.1|  hypothetical protein OsJ_29820                          144   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063521.1|  Os09g0486500                                       142   7e-39   
gb|EAZ09556.1|  hypothetical protein OsI_31833                          141   2e-38   Oryza sativa Indica Group [Indian rice]
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...    139   2e-37   
gb|AGQ04314.1|  SAP1                                                    136   1e-36   Oryza sativa f. spontanea
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240          137   1e-36   Sorghum bicolor [broomcorn]
gb|AGQ04316.1|  SAP1                                                    135   3e-36   Oryza glumipatula
gb|ADF80942.1|  zinc finger protein                                     135   5e-36   Phyllostachys praecox [zaozhu]
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    135   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAR83854.1|  induced stolon tip protein                              131   2e-35   Capsicum annuum
gb|ACM68451.1|  stress-associated protein 1                             130   4e-35   Solanum pennellii
gb|AGQ04315.1|  SAP1                                                    129   7e-34   Oryza rufipogon [common wild rice]
gb|AGQ04317.1|  SAP1                                                    129   7e-34   Oryza longistaminata [long-staminate rice]
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    129   1e-33   Elaeis guineensis
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    129   1e-33   Phoenix dactylifera
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940          129   2e-33   Sorghum bicolor [broomcorn]
gb|AGQ04319.1|  SAP1                                                    128   2e-33   Oryza meridionalis [Australian wild rice]
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    128   4e-33   Elaeis guineensis
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    128   9e-33   
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    126   1e-32   Phoenix dactylifera
ref|XP_002993103.1|  hypothetical protein SELMODRAFT_187216             127   1e-32   
ref|NP_001140650.1|  uncharacterized protein LOC100272725               126   2e-32   Zea mays [maize]
gb|AGQ04323.1|  SAP1                                                    125   2e-32   Oryza punctata
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    125   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    125   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    123   1e-31   Glycine max [soybeans]
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    124   1e-31   Cicer arietinum [garbanzo]
ref|NP_001058985.1|  Os07g0168800                                       124   1e-31   
ref|NP_001106263.1|  AN110                                              124   2e-31   
gb|AGQ04324.1|  SAP1                                                    122   2e-31   Oryza officinalis
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...    123   3e-31   
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   3e-31   Nicotiana sylvestris
gb|ABK90631.1|  zinc finger protein                                     122   4e-31   Aeluropus littoralis
ref|NP_001266661.1|  multiple stress-responsive zinc-finger prote...    122   6e-31   
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   7e-31   Nelumbo nucifera [Indian lotus]
gb|AFK36400.1|  unknown                                                 120   2e-30   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...    120   2e-30   Medicago truncatula
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g             120   2e-30   Phaseolus vulgaris [French bean]
dbj|BAK01503.1|  predicted protein                                      120   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03526.1|  predicted protein                                      120   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002513177.1|  zinc finger protein, putative                      119   3e-30   Ricinus communis
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...    119   5e-30   
ref|XP_010489793.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   7e-30   Camelina sativa [gold-of-pleasure]
gb|EEC76316.1|  hypothetical protein OsI_13859                          120   9e-30   Oryza sativa Indica Group [Indian rice]
gb|ACJ84133.1|  unknown                                                 119   1e-29   Medicago truncatula
ref|XP_008384536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   1e-29   
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...    121   1e-29   Triticum urartu
ref|NP_001275387.1|  zinc finger A20 and AN1 domain-containing st...    119   1e-29   Solanum tuberosum [potatoes]
dbj|BAJ94586.1|  predicted protein                                      118   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010031823.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   2e-29   Eucalyptus grandis [rose gum]
ref|XP_006361216.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    118   3e-29   Solanum tuberosum [potatoes]
dbj|BAJ88745.1|  predicted protein                                      117   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004228358.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   4e-29   
gb|EEE60081.1|  hypothetical protein OsJ_12913                          118   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   5e-29   Oryza brachyantha
ref|NP_001288688.1|  zinc finger A20 and AN1 domain-containing st...    117   5e-29   Zea mays [maize]
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg                117   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   6e-29   Sesamum indicum [beniseed]
gb|EYU18025.1|  hypothetical protein MIMGU_mgv1a014524mg                117   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_009376154.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_010531421.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   8e-29   Tarenaya hassleriana [spider flower]
gb|ACL01101.1|  zinc finger protein                                     116   8e-29   Phyllostachys edulis [kikko-chiku]
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   1e-28   
gb|KDP35279.1|  hypothetical protein JCGZ_09438                         115   1e-28   Jatropha curcas
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...    119   2e-28   Triticum urartu
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   2e-28   Nelumbo nucifera [Indian lotus]
gb|ABK21092.1|  unknown                                                 116   2e-28   Picea sitchensis
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   2e-28   Solanum tuberosum [potatoes]
gb|ACM68454.1|  stress-associated protein 4                             115   2e-28   Solanum pennellii
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...    120   2e-28   
gb|ADF80943.1|  zinc finger protein                                     115   2e-28   Phyllostachys vivax
ref|XP_010031824.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   2e-28   Eucalyptus grandis [rose gum]
ref|XP_009376157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_006660763.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   2e-28   Oryza brachyantha
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   3e-28   Glycine max [soybeans]
gb|ACJ83925.1|  unknown                                                 115   3e-28   Medicago truncatula
gb|ACM68453.1|  stress-associated protein 3                             115   3e-28   Solanum pennellii
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   4e-28   
gb|ACM68441.1|  stress-associated protein 4                             114   4e-28   Solanum lycopersicum
gb|KEH16280.1|  zinc finger A20 and AN1 domain stress-associated ...    114   7e-28   Medicago truncatula
gb|KEH16279.1|  zinc finger A20 and AN1 domain stress-associated ...    114   7e-28   Medicago truncatula
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-28   Nicotiana sylvestris
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-28   Vitis vinifera
ref|XP_008795703.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-28   Phoenix dactylifera
gb|ACM68440.1|  stress-associated protein 3                             114   7e-28   Solanum lycopersicum
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   7e-28   Cucumis melo [Oriental melon]
ref|NP_001051527.1|  Os03g0792900                                       114   8e-28   
ref|XP_004951572.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   8e-28   Setaria italica
gb|EPS60935.1|  induced stolon tip protein                              113   1e-27   Genlisea aurea
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-27   Nicotiana tomentosiformis
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   1e-27   Solanum tuberosum [potatoes]
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   1e-27   Sesamum indicum [beniseed]
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   Nicotiana tomentosiformis
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   Citrus sinensis [apfelsine]
ref|XP_008384532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   
ref|XP_004135920.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   
ref|XP_004158200.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   
ref|XP_010279014.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-27   Nelumbo nucifera [Indian lotus]
ref|NP_001058066.1|  Os06g0612800                                       113   2e-27   
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   3e-27   
ref|XP_008786424.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   3e-27   Phoenix dactylifera
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-27   Solanum tuberosum [potatoes]
ref|XP_002975420.1|  hypothetical protein SELMODRAFT_150464             112   3e-27   
ref|XP_009374543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-27   Pyrus x bretschneideri [bai li]
ref|XP_006650711.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   3e-27   Oryza brachyantha
gb|EYU31356.1|  hypothetical protein MIMGU_mgv1a014938mg                112   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_009596933.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   7e-27   Nicotiana tomentosiformis
ref|XP_011078867.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   7e-27   Sesamum indicum [beniseed]
ref|XP_010928496.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   7e-27   Elaeis guineensis
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   8e-27   Vitis vinifera
emb|CDP20562.1|  unnamed protein product                                111   8e-27   Coffea canephora [robusta coffee]
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   8e-27   
gb|ABI31653.1|  zinc finger protein                                     111   8e-27   Camellia sinensis [black tea]
gb|ACM68460.1|  stress-associated protein 10                            111   9e-27   Solanum pennellii
dbj|BAO74165.1|  zinc finger protein                                    111   9e-27   Cucurbita pepo subsp. ovifera
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein      111   9e-27   Zea mays [maize]
ref|XP_003597446.1|  Zinc finger A20 and AN1 domain-containing st...    111   1e-26   
ref|XP_009765432.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   1e-26   Nicotiana sylvestris
ref|XP_002304765.2|  zinc finger family protein                         111   1e-26   
gb|ACM68446.1|  stress-associated protein 9                             110   1e-26   Solanum lycopersicum
gb|EYU46288.1|  hypothetical protein MIMGU_mgv1a015852mg                110   1e-26   Erythranthe guttata [common monkey flower]
ref|NP_001130325.1|  LOC100191419                                       111   1e-26   Zea mays [maize]
gb|AAQ84334.1|  stress-associated protein 8                             111   1e-26   Oryza sativa Indica Group [Indian rice]
dbj|BAO74167.1|  zinc finger protein                                    111   1e-26   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_010545575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_011075194.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   1e-26   Sesamum indicum [beniseed]
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   1e-26   Fragaria vesca subsp. vesca
gb|ACF80251.1|  unknown                                                 111   1e-26   Zea mays [maize]
gb|ABK21003.1|  unknown                                                 111   2e-26   Picea sitchensis
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg             110   2e-26   Prunus persica
ref|XP_002323304.1|  hypothetical protein POPTR_0016s05220g             110   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009799138.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-26   Nicotiana sylvestris
gb|AAX14637.1|  zinc finger protein                                     110   2e-26   Zea mays [maize]
gb|ACJ86086.1|  unknown                                                 110   2e-26   Medicago truncatula
ref|XP_002297783.1|  zinc finger family protein                         110   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006842203.1|  hypothetical protein AMTR_s00078p00168800          110   2e-26   
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   2e-26   
ref|XP_008354997.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-26   
ref|XP_010673602.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   2e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP09861.1|  unnamed protein product                                110   3e-26   Coffea canephora [robusta coffee]
ref|NP_001288874.1|  zinc finger A20 and AN1 domain-containing st...    110   3e-26   Brassica rapa
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   3e-26   
gb|ABS72032.1|  putative AN1-like zinc finger protein                   107   3e-26   Olea europaea
ref|XP_006446073.1|  hypothetical protein CICLE_v10016944mg             110   3e-26   
ref|XP_004513637.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-26   
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-26   Solanum tuberosum [potatoes]
gb|EPS60974.1|  hypothetical protein M569_13826                         109   3e-26   Genlisea aurea
gb|ABK26062.1|  unknown                                                 110   3e-26   Picea sitchensis
dbj|BAJ90521.1|  predicted protein                                      109   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011090378.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-26   
ref|XP_004513638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   Cicer arietinum [garbanzo]
ref|XP_009365001.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Pyrus x bretschneideri [bai li]
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   
ref|XP_006656245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Oryza brachyantha
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Populus euphratica
dbj|BAO74166.1|  zinc finger protein                                    110   4e-26   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_010544224.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Tarenaya hassleriana [spider flower]
gb|KDO64800.1|  hypothetical protein CISIN_1g030300mg                   110   4e-26   Citrus sinensis [apfelsine]
ref|XP_010913141.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   Elaeis guineensis
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   4e-26   
emb|CBI16408.3|  unnamed protein product                                108   4e-26   Vitis vinifera
ref|XP_009618607.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Nicotiana tomentosiformis
gb|AFW87479.1|  zinc finger protein1                                    110   4e-26   
ref|XP_007145644.1|  hypothetical protein PHAVU_007G256400g             109   5e-26   Phaseolus vulgaris [French bean]
gb|ACM68459.1|  stress-associated protein 9                             109   5e-26   Solanum pennellii
gb|EPS60034.1|  hypothetical protein M569_14771                         109   5e-26   Genlisea aurea
ref|XP_009349757.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   6e-26   
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...    109   6e-26   Morus notabilis
gb|ADK63395.1|  AN1-like zinc finger protein                            109   6e-26   Brassica rapa
emb|CDY25219.1|  BnaC06g04440D                                          109   7e-26   Brassica napus [oilseed rape]
ref|XP_009147775.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   7e-26   Brassica rapa
gb|ACM68452.1|  stress-associated protein 2                             109   7e-26   Solanum pennellii
ref|XP_010540147.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   8e-26   Tarenaya hassleriana [spider flower]
gb|ACM68447.1|  stress-associated protein 10                            108   8e-26   Solanum lycopersicum
ref|XP_006381027.1|  hypothetical protein POPTR_0006s05520g             108   8e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009609312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   8e-26   Nicotiana tomentosiformis
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    108   9e-26   Nicotiana sylvestris
ref|XP_009783306.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   9e-26   Nicotiana sylvestris
ref|XP_007028890.1|  Zinc finger A20 and AN1 domain-containing st...    109   1e-25   
ref|XP_009593342.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Nicotiana tomentosiformis
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Elaeis guineensis
gb|EPS66139.1|  hypothetical protein M569_08638                         105   1e-25   Genlisea aurea
ref|XP_009354716.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_011080262.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Sesamum indicum [beniseed]
ref|XP_007014974.1|  Zinc finger A20 and AN1 domain-containing st...    108   1e-25   
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   1e-25   Vitis vinifera
ref|XP_008375158.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Malus domestica [apple tree]
emb|CBI16411.3|  unnamed protein product                                107   1e-25   Vitis vinifera
emb|CBI29889.3|  unnamed protein product                                107   1e-25   Vitis vinifera
gb|ACT53874.1|  zinc finger protein                                     108   1e-25   Saccharum officinarum [noble cane]
ref|XP_004955567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Setaria italica
gb|EYU18023.1|  hypothetical protein MIMGU_mgv1a015860mg                107   1e-25   Erythranthe guttata [common monkey flower]
gb|AFK43724.1|  unknown                                                 110   1e-25   Medicago truncatula
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                   108   1e-25   Citrus sinensis [apfelsine]
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg             108   1e-25   
ref|NP_001106260.1|  LOC100127534                                       108   2e-25   Zea mays [maize]
gb|EMS48637.1|  Zinc finger A20 and AN1 domain-containing stress-...    111   2e-25   Triticum urartu
ref|XP_002283050.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   2e-25   Vitis vinifera
ref|XP_011090386.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-25   Sesamum indicum [beniseed]
ref|XP_010907320.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   2e-25   Elaeis guineensis
gb|EEE56499.1|  hypothetical protein OsJ_05747                          108   2e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CDP13127.1|  unnamed protein product                                107   2e-25   Coffea canephora [robusta coffee]
gb|ABK92973.1|  unknown                                                 108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009776796.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-25   Nicotiana sylvestris
ref|XP_003633556.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-25   
ref|XP_008349975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-25   
ref|XP_007014975.1|  Zinc finger A20 and AN1 domain-containing st...    107   2e-25   
ref|NP_001046186.1|  Os02g0195600                                       107   2e-25   
ref|XP_010233975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   2e-25   
ref|XP_004249192.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-25   
ref|XP_004295198.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   3e-25   
gb|ABI23728.1|  stress-tolerance zinc finger protein                    107   3e-25   
ref|NP_001105248.1|  uncharacterized protein LOC542155                  109   3e-25   
ref|XP_010544226.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-25   
ref|XP_006647019.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   3e-25   
ref|XP_009591880.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-25   
dbj|BAG50058.1|  transcription factor C2H2                              107   3e-25   
ref|XP_006850157.1|  hypothetical protein AMTR_s00022p00239310          107   3e-25   
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   3e-25   
emb|CBI24865.3|  unnamed protein product                                106   3e-25   
ref|NP_001062181.1|  Os08g0504700                                       107   4e-25   
gb|ACM68455.1|  stress-associated protein 5                             107   4e-25   
ref|XP_009408498.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   4e-25   
gb|ABK24386.1|  unknown                                                 107   4e-25   
ref|XP_009620573.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-25   
ref|XP_001756532.1|  predicted protein                                  107   5e-25   
ref|XP_004951575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-25   
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   6e-25   
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   6e-25   
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   6e-25   
ref|XP_008373747.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   7e-25   
ref|XP_007052555.1|  Zinc finger A20 and AN1 domain-containing st...    106   7e-25   
ref|XP_009411822.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   7e-25   
ref|XP_011042076.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   7e-25   
dbj|BAO74169.1|  zinc finger protein                                    106   8e-25   
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   8e-25   
ref|XP_010025527.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   9e-25   
ref|XP_010928861.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   9e-25   
gb|ABN08135.1|  Zinc finger, AN1-type; Zinc finger, A20-type            106   9e-25   
emb|CDP10083.1|  unnamed protein product                                107   9e-25   
gb|KJB51967.1|  hypothetical protein B456_008G240900                    106   1e-24   
gb|ABD65463.1|  DNA binding/zinc ion binding protein                    106   1e-24   
gb|AFK43974.1|  unknown                                                 106   1e-24   
dbj|BAO74168.1|  zinc finger protein                                    106   1e-24   
ref|XP_011087449.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   1e-24   
ref|XP_006597247.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   1e-24   
ref|XP_011087441.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   1e-24   
gb|ABK21043.1|  unknown                                                 105   1e-24   
ref|XP_006424263.1|  hypothetical protein CICLE_v10029439mg             105   1e-24   
dbj|BAJ86013.1|  predicted protein                                      105   1e-24   
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-24   
ref|XP_006851496.1|  hypothetical protein AMTR_s00040p00148670          106   1e-24   
ref|XP_007028887.1|  Zinc finger A20 and AN1 domain-containing st...    105   1e-24   
emb|CDP20483.1|  unnamed protein product                                105   2e-24   
ref|XP_008783998.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-24   
gb|KCW62226.1|  hypothetical protein EUGRSUZ_H04886                     108   2e-24   
ref|XP_009795588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-24   
ref|XP_003625187.1|  Zinc finger A20 and AN1 domain-containing st...    107   2e-24   
gb|AIN39820.1|  hypothetical protein                                    105   2e-24   
ref|XP_008231312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   2e-24   
ref|XP_007218502.1|  hypothetical protein PRUPE_ppa012373mg             105   2e-24   
gb|AFK93416.1|  stress-response protein                                 105   2e-24   
gb|EMT31119.1|  Zinc finger A20 and AN1 domain-containing stress-...    105   2e-24   
gb|ABK25818.1|  unknown                                                 105   2e-24   
ref|XP_002513466.1|  zinc finger protein, putative                      105   2e-24   
ref|XP_003547098.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   3e-24   
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...    104   3e-24   
gb|AGH14257.1|  A20 and AN1 domain-containing stress-associated p...    104   3e-24   
gb|KDP43452.1|  hypothetical protein JCGZ_16739                         104   3e-24   
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   3e-24   
ref|NP_001236393.1|  uncharacterized protein LOC100500070               105   3e-24   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   3e-24   
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...    103   4e-24   
ref|XP_006850149.1|  hypothetical protein AMTR_s00022p00236720          103   4e-24   
ref|XP_009785364.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   4e-24   
ref|XP_006410805.1|  hypothetical protein EUTSA_v10017322mg             104   4e-24   
ref|XP_003574738.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   4e-24   
ref|XP_007145317.1|  hypothetical protein PHAVU_007G228900g             104   4e-24   
ref|XP_007202662.1|  hypothetical protein PRUPE_ppa012365mg             104   4e-24   
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...    104   4e-24   
ref|NP_001242495.1|  uncharacterized protein LOC100802969               104   5e-24   
ref|XP_007150082.1|  hypothetical protein PHAVU_005G125000g             103   6e-24   
ref|XP_009128643.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   6e-24   
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-24   
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   6e-24   
emb|CDP15398.1|  unnamed protein product                                103   7e-24   
ref|XP_003636648.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     107   7e-24   
ref|NP_001106259.1|  AN12                                               103   7e-24   
ref|XP_004493535.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   7e-24   
ref|XP_001779169.1|  predicted protein                                  103   7e-24   
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   7e-24   
ref|XP_011020305.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   9e-24   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...    103   1e-23   
ref|XP_001771457.1|  predicted protein                                  103   1e-23   
ref|XP_009388999.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-23   
gb|AAD38146.1|AF139499_1  unknown                                       103   1e-23   
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-23   
ref|XP_008240842.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-23   
ref|XP_011020304.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   1e-23   
ref|XP_008364799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-23   
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...    102   1e-23   
ref|XP_008219792.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-23   
gb|ACJ85990.1|  unknown                                                 103   2e-23   
ref|XP_004309600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   
gb|KDP22067.1|  hypothetical protein JCGZ_25898                         103   2e-23   
gb|KJB20838.1|  hypothetical protein B456_003G167800                    102   2e-23   
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...    102   2e-23   
ref|XP_007206007.1|  hypothetical protein PRUPE_ppa012347mg             102   2e-23   
ref|XP_006576194.1|  PREDICTED: uncharacterized protein LOC100527...    102   2e-23   
ref|XP_003542595.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   
gb|KHN18756.1|  Zinc finger A20 and AN1 domain-containing stress-...    101   2e-23   
ref|XP_009145588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   
ref|NP_001106266.1|  LOC100127541                                       102   2e-23   
ref|XP_002281372.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   
gb|KHG20851.1|  Zinc finger A20 and AN1 domain-containing stress-...    103   2e-23   
gb|KHN33337.1|  Zinc finger A20 and AN1 domain-containing stress-...    102   3e-23   
ref|XP_010053387.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   3e-23   
ref|XP_010553481.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   3e-23   
ref|XP_010538772.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   4e-23   
ref|XP_006603655.1|  PREDICTED: uncharacterized protein LOC100499...    102   4e-23   
ref|XP_007206046.1|  hypothetical protein PRUPE_ppa012588mg             101   4e-23   
ref|XP_007027699.1|  A20/AN1-like zinc finger family protein, put...    101   4e-23   
gb|KJB36067.1|  hypothetical protein B456_006G139100                    102   4e-23   
gb|EPS64266.1|  hypothetical protein M569_10515                         100   4e-23   
gb|KJB37574.1|  hypothetical protein B456_006G211300                    101   4e-23   
gb|EPS61935.1|  hypothetical protein M569_12860                         101   5e-23   
ref|XP_001756533.1|  predicted protein                                  101   5e-23   
ref|XP_003606132.1|  Zinc finger A20 and AN1 domain-containing st...    101   5e-23   
ref|XP_010529513.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   5e-23   
ref|XP_008782899.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   6e-23   
ref|XP_004798521.1|  PREDICTED: AN1-type zinc finger protein 6          101   6e-23   
ref|XP_001770822.1|  predicted protein                                  101   6e-23   
ref|XP_009412395.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   7e-23   
ref|XP_006288770.1|  hypothetical protein CARUB_v10002091mg             101   7e-23   
ref|XP_004969762.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   7e-23   
ref|XP_009412393.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   8e-23   
ref|XP_010494181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   8e-23   
ref|XP_009385326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   8e-23   
ref|NP_180326.1|  zinc finger A20 and AN1 domain-containing stres...    100   8e-23   
ref|XP_004506164.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   9e-23   
ref|XP_006490054.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   9e-23   
ref|XP_006590265.1|  PREDICTED: uncharacterized protein LOC100500...    101   9e-23   
gb|ACU19355.1|  unknown                                                 100   9e-23   
ref|NP_565844.1|  zinc finger A20 and AN1 domain-containing stres...    100   1e-22   
ref|XP_009385134.1|  PREDICTED: zinc finger AN1 domain-containing...    100   1e-22   
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640          100   1e-22   
emb|CDY13347.1|  BnaC06g14100D                                          100   1e-22   
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g             100   1e-22   
ref|XP_009411960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   1e-22   
ref|XP_002298087.1|  zinc finger family protein                         100   1e-22   
ref|XP_004365991.2|  zinc finger protein                                100   1e-22   
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...    100   1e-22   
ref|XP_002312908.1|  zinc finger family protein                         100   1e-22   
gb|EMT02223.1|  Zinc finger A20 and AN1 domain-containing stress-...    100   1e-22   
ref|NP_001236983.1|  uncharacterized protein LOC100499857               100   1e-22   
ref|XP_009148741.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   1e-22   
ref|XP_004516195.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   1e-22   
ref|XP_011044990.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   1e-22   
emb|CDY66222.1|  BnaAnng21800D                                          100   2e-22   
ref|XP_006870970.1|  PREDICTED: AN1-type zinc finger protein 6 is...    100   2e-22   
ref|NP_194013.1|  A20/AN1-like zinc finger family protein               100   2e-22   
ref|XP_011029113.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   2e-22   
ref|XP_010458672.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   2e-22   
gb|EPS63774.1|  zinc finger protein                                     100   2e-22   
ref|XP_009143596.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    2e-22   
ref|NP_001237386.1|  uncharacterized protein LOC100306347               100   2e-22   
gb|EPY73931.1|  AN1-type zinc finger protein 5                        99.0    2e-22   
ref|NP_192941.1|  zinc finger A20 and AN1 domain-containing stres...    100   2e-22   
ref|XP_009416000.1|  PREDICTED: zinc finger AN1 domain-containing...  99.4    2e-22   
ref|XP_004324566.1|  PREDICTED: AN1-type zinc finger protein 6-li...    100   2e-22   
ref|XP_006304261.1|  hypothetical protein CARUB_v10010492mg           99.8    3e-22   
ref|XP_009351048.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    3e-22   
ref|XP_007131998.1|  hypothetical protein PHAVU_011G058100g           99.8    3e-22   
ref|XP_010108100.1|  Zinc finger A20 and AN1 domain-containing st...  99.4    3e-22   
ref|XP_004594633.1|  PREDICTED: AN1-type zinc finger protein 6 is...  99.8    3e-22   
ref|XP_003554427.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.4    3e-22   
gb|AHA84193.1|  multiple stress-responsive zinc-finger protein        99.4    4e-22   
gb|EFA78520.1|  putative zinc finger protein                          98.6    4e-22   
ref|XP_010913090.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    4e-22   
ref|XP_009137282.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    4e-22   
ref|XP_005708852.1|  zinc finger (AN1-like) family protein            99.8    4e-22   
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...  98.6    4e-22   
gb|ACT78956.1|  zinc finger protein                                   99.4    4e-22   
emb|CDX84135.1|  BnaC04g08970D                                        98.6    4e-22   
ref|NP_190848.1|  zinc finger A20 and AN1 domain-containing stres...  99.0    5e-22   
ref|XP_007447131.1|  PREDICTED: AN1-type zinc finger protein 6 is...  99.4    5e-22   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    5e-22   
ref|XP_010515753.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    5e-22   
ref|NP_001229848.1|  AN1-type zinc finger protein 6 isoform d         99.4    5e-22   
gb|KJB12093.1|  hypothetical protein B456_002G229200                  99.0    5e-22   
dbj|BAH19860.1|  AT4G12040                                            99.0    5e-22   
ref|XP_010102314.1|  Zinc finger A20 and AN1 domain-containing st...    100   6e-22   
ref|XP_002160663.2|  PREDICTED: AN1-type zinc finger protein 6-like   98.6    6e-22   
ref|XP_006363713.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    6e-22   
ref|XP_006396803.1|  hypothetical protein EUTSA_v10029014mg           99.0    6e-22   
emb|CDX67537.1|  BnaA07g15770D                                        98.2    6e-22   
ref|XP_004278382.1|  PREDICTED: AN1-type zinc finger protein 6 is...  99.0    6e-22   
ref|XP_010089848.1|  Zinc finger A20 and AN1 domain-containing st...  98.6    6e-22   
ref|XP_004149261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.2    6e-22   
gb|EYU27074.1|  hypothetical protein MIMGU_mgv1a014905mg              98.6    7e-22   
ref|XP_011046278.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    7e-22   
ref|XP_010036460.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    8e-22   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    8e-22   
ref|XP_010943705.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.2    8e-22   
ref|XP_006189680.1|  PREDICTED: AN1-type zinc finger protein 6 is...  98.6    8e-22   
ref|XP_006421467.1|  hypothetical protein CICLE_v10006050mg           98.6    8e-22   
ref|XP_008334127.1|  PREDICTED: AN1-type zinc finger protein 5-like   99.4    8e-22   
ref|XP_004421951.1|  PREDICTED: AN1-type zinc finger protein 6 is...  98.6    9e-22   
ref|XP_002116218.1|  hypothetical protein TRIADDRAFT_50857            98.6    9e-22   
emb|CDX73602.1|  BnaC08g24010D                                        98.2    9e-22   
ref|XP_008791733.1|  PREDICTED: zinc finger AN1 domain-containing...  98.2    9e-22   
gb|KJB83686.1|  hypothetical protein B456_013G258400                  97.8    9e-22   
ref|XP_010558994.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    9e-22   
ref|XP_001761755.1|  predicted protein                                98.2    9e-22   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485           98.6    1e-21   
ref|XP_010912823.1|  PREDICTED: zinc finger AN1 domain-containing...  97.8    1e-21   
gb|KDO57217.1|  hypothetical protein CISIN_1g030304mg                 98.2    1e-21   
gb|KDO57216.1|  hypothetical protein CISIN_1g030304mg                 98.2    1e-21   
gb|EMS62344.1|  Zinc finger A20 and AN1 domain-containing stress-...  97.1    1e-21   
ref|XP_004658309.1|  PREDICTED: AN1-type zinc finger protein 6 is...  98.2    1e-21   
ref|XP_008804197.1|  PREDICTED: zinc finger AN1 domain-containing...  97.4    1e-21   
ref|NP_001237029.1|  uncharacterized protein LOC100527251             97.8    1e-21   
emb|CDP10084.1|  unnamed protein product                              99.8    1e-21   
gb|EPS65249.1|  hypothetical protein M569_09529                       97.1    1e-21   
ref|XP_004387551.1|  PREDICTED: AN1-type zinc finger protein 6 is...  98.2    1e-21   



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 136/177 (77%), Gaps = 12/177 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaa-------gsss  289
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPATNNMCQKCF+ATTAA          S+
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSA  60

Query  290  aaIHHKFGEKQPRSG-FRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
              I HKF EK  RS    R S  R+SP+ K   +RT     + +  +E++ +   PPAKR
Sbjct  61   VTIPHKFAEKLARSERSARFSSLRSSPERKSDLERT----SQHLTVKEDKLKESEPPAKR  116

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENPVVK
Sbjct  117  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVVK  173



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 131/182 (72%), Gaps = 22/182 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaa-------gsss  289
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPATNNMCQKCF+ATTAA          S 
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSV  60

Query  290  aaIHHKFGEKQPRS------GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS  451
              I HKF EK  RS         R SPER S DL+R       + +K         +   
Sbjct  61   VTIPHKFAEKLARSERSARFSLLRSSPERKS-DLERTSQHLTVKEDKM--------KESV  111

Query  452  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPV  631
            PPAKREVNRCSGCRRKVGLTGFRCRCG+LFCGEHRYSDRHDCSYDYK+AGRDAIARENPV
Sbjct  112  PPAKREVNRCSGCRRKVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKSAGRDAIARENPV  171

Query  632  VK  637
            VK
Sbjct  172  VK  173



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 136/181 (75%), Gaps = 12/181 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsss-------  289
            MAQ+T KEETEFK VPETITLC+NNCGVTGNPATNNMCQKCF+ATTAA  +SS       
Sbjct  1    MAQRTEKEETEFKAVPETITLCINNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGTS  60

Query  290  aaIHHKFGEKQPRS-GFRRLSPERTSPDLKRREDRTVAR----GEKTVeeeeeeeeNRSP  454
              I H F EK  RS    R S  R+SPD K   DR        G+  + +EE++ +   P
Sbjct  61   VTIPHNFAEKLVRSEKSARFSSLRSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLP  120

Query  455  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENPVV
Sbjct  121  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENPVV  180

Query  635  K  637
            K
Sbjct  181  K  181



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 135/181 (75%), Gaps = 13/181 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsss-------  289
            MAQ+T KEETEFK VPETITLC+N CGVTGNPATNNMCQKCF+ATTAA  +SS       
Sbjct  1    MAQRTEKEETEFKAVPETITLCIN-CGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSA  59

Query  290  aaIHHKFGEKQPRS-GFRRLSPERTSPDLKRREDRTVAR----GEKTVeeeeeeeeNRSP  454
              I HKF EK  RS    R S  R+ PD K   DR        G+  + +EE++ +   P
Sbjct  60   VTIPHKFAEKLVRSEKSARFSSLRSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLP  119

Query  455  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC+YDYK AGR+AIARENPVV
Sbjct  120  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENPVV  179

Query  635  K  637
            K
Sbjct  180  K  180



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 127/170 (75%), Gaps = 19/170 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKV PETITLCVNNCG+TGNPATNNMCQKCF+ATT  A      +  KF
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPATNNMCQKCFNATTTTAS-----MAMKF  54

Query  311  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
             GEK PRS   R SPE+          R V+   + +   +  + + S  AKREVNRCSG
Sbjct  55   SGEKSPRSTISR-SPEKF---------RFVSESRRIITAADRPKPDES--AKREVNRCSG  102

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENPVVK
Sbjct  103  CRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENPVVK  152



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 127/170 (75%), Gaps = 19/170 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKV PETITLCVNNCG+TGNP TNNMCQKCF+ATTA A      +  KF
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPTTNNMCQKCFNATTATAS-----MAIKF  54

Query  311  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
             GEK PRS   R SPE+          R V+   + +   +  + + S  AKREVNRCSG
Sbjct  55   SGEKSPRSTTSR-SPEKF---------RFVSESRRIITAADRPKPDES--AKREVNRCSG  102

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENPVVK
Sbjct  103  CRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENPVVK  152



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   186 bits (473),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 120/170 (71%), Gaps = 20/170 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPE-TITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ+T KEETE+KVV E TITLCV NCGV GNPATNNMCQ C ++T+A++   +    HK
Sbjct  1    MAQRTEKEETEYKVVHEKTITLCVKNCGVIGNPATNNMCQNCSNSTSASSSKVAYP--HK  58

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
            F     RS         TS DLK   DR V   +K         +    PAKREVNRCSG
Sbjct  59   FANILTRS---------TSSDLKNYVDRAVKDDDKV--------KESVSPAKREVNRCSG  101

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY+ AGR+AIAR+NP+VK
Sbjct  102  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNPLVK  151



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 116/169 (69%), Gaps = 15/169 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A+TA    +        
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTATTSGA--------  51

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                   G    SP   S    R + R+       V +    ++     AKR VNRCSGC
Sbjct  52   ------GGAGIASPATRSGVSARPQKRSFPEEPSPVADPPSSDQTTPSEAKRVVNRCSGC  105

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENPV++
Sbjct  106  RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVIR  154



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 126/183 (69%), Gaps = 15/183 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH--  304
            MAQKT KEETEFKVVPETIT CVNNCGVTGNPATNNMCQKCF+AT++A+ SSS++     
Sbjct  1    MAQKTEKEETEFKVVPETITPCVNNCGVTGNPATNNMCQKCFNATSSASTSSSSSSSSST  60

Query  305  ------------KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNR  448
                        KFGEK PRS   +      + DL     R +    K            
Sbjct  61   SSSVTSSVAGAIKFGEKSPRSSSSKRLSPERTTDLAEIR-RDLKEEVKEASSAHATAPAT  119

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
            +   KREVNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  120  AAAVKREVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  179

Query  629  VVK  637
            VVK
Sbjct  180  VVK  182



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 126/172 (73%), Gaps = 18/172 (10%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaa-IHH  304
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A++A   ++S++ +  
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  305  KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
            KF GEK PRS     S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            SGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  107  SGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  158



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 118/171 (69%), Gaps = 24/171 (14%)
 Frame = +2

Query  131  MAQKTGKEETEF-KVVPE-TITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ+T KEETE+ KVV E T+TLCV +CGV GNPATNNMCQ CF+A+++          H
Sbjct  1    MAQRTEKEETEYNKVVREKTLTLCVKSCGVIGNPATNNMCQNCFNASSSKVA-----YPH  55

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
            KF     RS         TS DLK+  DR V   +K         +    PAK EVNRCS
Sbjct  56   KFANILTRS---------TSSDLKKYVDRAVKDDDKA--------KESVSPAKSEVNRCS  98

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GCRRK+GLTGFRCRCGELFCGEHRYSDRHDCSYDY+ AGR+AIAR+NP+VK
Sbjct  99   GCRRKLGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNPLVK  149



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score =   182 bits (461),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 120/177 (68%), Gaps = 22/177 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagss--------  286
            MAQKT KEETEFKVVPETI+LCVN CGV GN A NN+CQKCF+ TTA+  +S        
Sbjct  1    MAQKTEKEETEFKVVPETISLCVN-CGVAGNSAANNLCQKCFNTTTASTAASAAATSPGG  59

Query  287  saaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
            +  +++ F EK  RS     SPER         D  +   E             +PP KR
Sbjct  60   AKHVNNVFVEKSFRS--ITCSPERKFDSADTSGDLKIEAAEV-----------EAPPVKR  106

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR AIARENPVVK
Sbjct  107  QVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGRQAIARENPVVK  163



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score =   181 bits (460),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 118/186 (63%), Gaps = 33/186 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKVVPETITLCV  CGV GN ATNN+CQ C+S   AA+ S+        
Sbjct  1    MAQRTEKEETEFKVVPETITLCVK-CGVAGNSATNNLCQTCYSTPAAASTSAVGTPAASA  59

Query  311  GEKQPRSGF-----------------RRLSPERTSPDLKRREDRTVARGEKTVeeeeeee  439
            G  +P++                   R L+   TS DLK+    T               
Sbjct  60   GGPKPKNHVFVGKSFRSSSSTRSSLERSLNMSETSGDLKKEASETA--------------  105

Query  440  eNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAR  619
             + +PP KREVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK AGR+AIAR
Sbjct  106  -DVAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIAR  164

Query  620  ENPVVK  637
            ENPVVK
Sbjct  165  ENPVVK  170



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 125/172 (73%), Gaps = 18/172 (10%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaa-IHH  304
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A++A   ++S++ +  
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  305  KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
            KF GEK PRS     S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            SGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  107  SGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  158



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 124/173 (72%), Gaps = 18/173 (10%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaa---I  298
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA ++S++   I
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSAAI  61

Query  299  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 EK PRS     + E   P  ++     +AR ++T             P +R VNR
Sbjct  62   LKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVNR  107

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  108  CSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  160



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 123/174 (71%), Gaps = 19/174 (11%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA ++S++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSSAA  61

Query  308  F----GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
                  EK PRS     + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  161



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 123/174 (71%), Gaps = 19/174 (11%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA +++++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAAATSSSSAA  61

Query  308  F----GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
                  EK PRS     + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  161



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 119/189 (63%), Gaps = 37/189 (20%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsa----------------  262
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPATNNMCQKCF+A                
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNATTSTSNSSSSSTATSM  59

Query  263  --ttaaagsssaaIHHKFGEKQPRSGFRR--LSPERTSPDLKRREDRTVARGEKTVeeee  430
                 A   S+  I    GEK  RS   R  +   + SP+    ++R+ A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPEKASDKERSCA----------  109

Query  431  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDA  610
                  S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+A
Sbjct  110  ------SHVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREA  163

Query  611  IARENPVVK  637
            IARENPVVK
Sbjct  164  IARENPVVK  172



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 121/170 (71%), Gaps = 6/170 (4%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH-K  307
            MAQ+T KEETEFKV PE ITLCVNNCGV GNPATNNMCQ CF+ATT  A +S++   + K
Sbjct  1    MAQRTEKEETEFKV-PEKITLCVNNCGVIGNPATNNMCQNCFNATTTTAAASTSTTANLK  59

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
            F  ++  S     S   T     RR         KT  +    EE+ + PAKR VNRCSG
Sbjct  60   FSGEKSSSSAISSSSRPTD----RRSASPAENSRKTTADSARSEEDEAVPAKRVVNRCSG  115

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYK+ GR+AIARENPVVK
Sbjct  116  CRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKSVGREAIARENPVVK  165



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score =   178 bits (452),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 117/169 (69%), Gaps = 12/169 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A T +  ++S A     
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTAFTTSTATTSGAGGAGI  59

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                 RSG      +R+ P+         +  + T              AKR VNRCSGC
Sbjct  60   ASPATRSGISARPLKRSFPEEPSPPADPPSSDQTT-----------PSEAKRVVNRCSGC  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENPV++
Sbjct  109  RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVIR  157



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 120/174 (69%), Gaps = 14/174 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaI---H  301
            MAQKT KEETEFKV PET+ LCVNNCG TGNPATNNMCQKCFSA+ +AA +++A      
Sbjct  1    MAQKTEKEETEFKV-PETLALCVNNCGFTGNPATNNMCQKCFSASASAAAAAAAGALKSS  59

Query  302  HKF--GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
            HK   G    RS   R SPER     +   DRT        +             KREVN
Sbjct  60   HKVSGGAADARSSSAR-SPERMDSLAETSLDRTK-------DAASAAAVEEVGKVKREVN  111

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCRRKVGLTGFRCRCG+LFC EHRY+DRH+CSYDYK AGR+AIARENPVVK
Sbjct  112  RCSGCRRKVGLTGFRCRCGDLFCAEHRYTDRHECSYDYKTAGREAIARENPVVK  165



>gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 125/179 (70%), Gaps = 11/179 (6%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+ATT+ + S++       
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATTSTSNSATVTAAVPA  59

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRT----------VARGEKTVeeeeeeeeNRSPPA  460
                  +     +   +  ++ R+  R+          + +  + V+   + E++ +  A
Sbjct  60   NTTSTTTTTSSAAVVSSGSEILRKSPRSSLSRSPIRDPLRQTNQKVQTSTDREKSDAAVA  119

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +REVNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AI RENPVVK
Sbjct  120  RREVNRCSGCRRKVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKAAGREAITRENPVVK  178



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 126/193 (65%), Gaps = 32/193 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH--  304
            MAQ+T KEETEFKV PET+TLC+NNCGVTGNPATNNMCQKCF+ATTA   SSS++     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCINNCGVTGNPATNNMCQKCFNATTATPSSSSSSSSSAT  59

Query  305  ----------------KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeee  436
                            KF + Q      R +P R+    + R D +      TV      
Sbjct  60   SPSATGGAIAGGASIPKFSDDQSS----RSTPSRSQ---QNRSDSSPPTTAATVTNSRTT  112

Query  437  eeNRS---PPA---KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAA  598
              NRS   P A   K+ VNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCSYDYK A
Sbjct  113  AWNRSGNDPAAAAEKKVVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKTA  172

Query  599  GRDAIARENPVVK  637
            GR+AIARENPVVK
Sbjct  173  GREAIARENPVVK  185



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 118/189 (62%), Gaps = 37/189 (20%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsa----------------  262
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPATNNMCQKCF+A                
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNASTSTSNSSSSSTATSM  59

Query  263  --ttaaagsssaaIHHKFGEKQPRSGFRR--LSPERTSPDLKRREDRTVARGEKTVeeee  430
                 A   S+  I    GEK  RS   R  +   + SP+    ++R+ A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPETASDKERSCAYH--------  111

Query  431  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDA  610
                     AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+A
Sbjct  112  --------VAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREA  163

Query  611  IARENPVVK  637
            IARENPVVK
Sbjct  164  IARENPVVK  172



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 111/169 (66%), Gaps = 40/169 (24%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A+TA    +  A     
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGA---GI  56

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                 RSG        T+P                              AKR VNRCSGC
Sbjct  57   ASPATRSG--------TTPS----------------------------EAKRVVNRCSGC  80

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENPV++
Sbjct  81   RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENPVIR  129



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 123/173 (71%), Gaps = 19/173 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaa----I  298
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA +SS++    I
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  299  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 EK PRS     S E  +   ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAQAETFRKTTALEIARSDES-------------PNRRVVNR  105

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCRRKVGLTGFRCRCG+LFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  106  CSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  158



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   177 bits (448),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 122/173 (71%), Gaps = 19/173 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaa----I  298
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA +SS++    I
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  299  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 EK PRS     S E      ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAPVETFRKTTASEIARSDES-------------PNRRVVNR  105

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  106  CSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  158



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 122/176 (69%), Gaps = 12/176 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+AT     S+ A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGG  59

Query  311  GEKQPRS-GFRRLSPE---RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA---KRE  469
            G          + S E   R+ P +  R   + A G  T  + +E  + R   A   KR 
Sbjct  60   GGGGGSGVAIIKFSSEKSLRSRPII--RSGSSDAAG--TTGQNQELTDRREKEANVEKRV  115

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENPV+K
Sbjct  116  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIK  171



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 123/177 (69%), Gaps = 13/177 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+AT     S+ A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTSG  59

Query  311  GEKQPRS--GFRRLSPE---RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA---KR  466
            G     S     + S E   R+ P +  R   + A G  T  + +E  + R   A   KR
Sbjct  60   GGGGGGSGVAIIKFSSEKSLRSRPII--RSGSSDAAG--TTGQNQELTDRREKEANVEKR  115

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENPV+K
Sbjct  116  VVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIK  172



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 119/175 (68%), Gaps = 13/175 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETE KV P+T+TLCVNNCGVTGNPATNNMCQKCF+ATTA+A SS  +     
Sbjct  1    MAQRTEKEETEVKV-PDTLTLCVNNCGVTGNPATNNMCQKCFNATTASAVSSPPSAAAAN  59

Query  311  GEKQPR--SGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA----KREV  472
                     G     P R S  L+   DR+     K +        NR   A    K+ V
Sbjct  60   NNNNSVKDGGLIAKKPARCSA-LRSSSDRSGLSAAKVI-----ISRNRGNDAVEEEKKIV  113

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            NRCSGCRRKVGLTGFRCRCGELFC EHRYS RHDCSYDYKAAGR+AIARENPVVK
Sbjct  114  NRCSGCRRKVGLTGFRCRCGELFCAEHRYSARHDCSYDYKAAGREAIARENPVVK  168



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 118/177 (67%), Gaps = 22/177 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH---  301
            MAQ+T KEETEFKV P+T+T CVNNCGVTGNPATNNMCQKCF+ATT+   + + A     
Sbjct  1    MAQRTEKEETEFKV-PDTLTHCVNNCGVTGNPATNNMCQKCFNATTSTPTTVATATTSST  59

Query  302  ----HKF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
                 KF GEK PRS   R     +    K        R E++               +R
Sbjct  60   TAAVFKFSGEKVPRSSSFRFDAPPSETIRKAAASAESTRSEES-------------SMRR  106

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  107  VVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  163



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 120/177 (68%), Gaps = 12/177 (7%)
 Frame = +2

Query  107  LVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagss  286
            L +F    MAQKT  EETEFKV PETITLCVNNCGVTGNPATNNMCQ CF+A TA+  ++
Sbjct  130  LTLFSSSSMAQKTENEETEFKV-PETITLCVNNCGVTGNPATNNMCQNCFTAFTASTATT  188

Query  287  saaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
            S+A          RS               R + R+      +  +    ++N    AKR
Sbjct  189  SSAASAGISSPSARSVAS-----------ARPQKRSFPEEPSSAADPPSSDQNAPSEAKR  237

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENPVV+
Sbjct  238  VVNRCSGCRRKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVR  294



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 120/173 (69%), Gaps = 15/173 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETE KV PETITLCVNNCG TGNP TNNMCQKCF+ATTA A +++ +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  311  GEKQPR-SGFRRLSPERTSP---DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 + SG + L     SP   D  R   R ++           +       AKR+VNR
Sbjct  60   ISSSRKLSGEKSLRSRSRSPVLMDSVRDNSRNMS----------MDRFKSEESAKRQVNR  109

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGRDAIARENPVVK
Sbjct  110  CSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENPVVK  162



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score =   174 bits (441),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 117/170 (69%), Gaps = 15/170 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP TNNMCQ CF A+             KF
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPL------KF  52

Query  311  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
             G+ +PRS   R SPER+    +    R V + + T   E       S   +REVNRCSG
Sbjct  53   SGKDKPRSSSVR-SPERSDRPAEPEILREVTKRDTTAAAEVT-----SSVVRREVNRCSG  106

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRRKVGLTGFRCRCG+LFC EHRYSDRH+CSYDYKAAGR+AI+RENPVVK
Sbjct  107  CRRKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKAAGREAISRENPVVK  156



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCFSATTAA  SSS++ ++  
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSTNNTA  59

Query  311  ----GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS---PPAKRE  469
                 +K  RS   R    R+  D                        NRS      K+ 
Sbjct  60   TSATDDKSSRSTPTRSQDNRS--DSAPPTTAATTATATATTNSPMTASNRSGYDTAEKKS  117

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VNRCSGCR++VGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR+AIARENPVVK
Sbjct  118  VNRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENPVVK  173



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 118/170 (69%), Gaps = 14/170 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP TNNMCQ CF A+             KF
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPL------KF  52

Query  311  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
             G+ +PRS   R SPER+    + R  + V + + T   E       +   KREVNRCSG
Sbjct  53   SGKDKPRSSSVR-SPERSDRPAETRIFKEVTKRDTTAASEA----ASAAVVKREVNRCSG  107

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRRKVGLTGFRCRCGELFC EHRYSDRH+CS+DYKAAGR+AIARENPVVK
Sbjct  108  CRRKVGLTGFRCRCGELFCSEHRYSDRHECSFDYKAAGREAIARENPVVK  157



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 123/189 (65%), Gaps = 35/189 (19%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaags---------  283
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPATNNMCQKCF+A+T+ +           
Sbjct  1    MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSSTTTTTT  59

Query  284  -----------ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeee  430
                       S+  I     EK  RS   R SP +      +R+ +T +  E++     
Sbjct  60   TITFAATTNGVSTNEILKFTSEKSLRSSISR-SPAKD----HQRQPKTASDKERS-----  109

Query  431  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDA  610
                + S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK  GR+A
Sbjct  110  ----DSSSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREA  165

Query  611  IARENPVVK  637
            IARENPVVK
Sbjct  166  IARENPVVK  174



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 120/181 (66%), Gaps = 21/181 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK-  307
            MAQKTG EETEFKVVPE+I LCV  CGV GN A NN+CQKCFS+TTA A +S+ A     
Sbjct  1    MAQKTGNEETEFKVVPESIALCV-KCGVPGNSAANNLCQKCFSSTTAEASTSAVAAAPAS  59

Query  308  -----------FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP  454
                       FGEK  RS     S      +L      TV   EK          + +P
Sbjct  60   SSGGAKPKSLVFGEKSFRSRSSTRSSPERRLNLP----VTVLDLEKN----PSAVADAAP  111

Query  455  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            PAKREVNRC+GCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK AGR+AIARENPVV
Sbjct  112  PAKREVNRCTGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENPVV  171

Query  635  K  637
            K
Sbjct  172  K  172



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 123/186 (66%), Gaps = 32/186 (17%)
 Frame = +2

Query  131  MAQKTGKEETEF-KVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssa-----  292
            MAQKT KEETE+ KVVPETI+LCV  CGV GN ATNN+C  CF++T  AA +++A     
Sbjct  1    MAQKTEKEETEYSKVVPETISLCVK-CGVAGNCATNNLCHTCFNSTAPAAAAAAAAAAGG  59

Query  293  ----aIHHKFGEKQPRSGF-------RRLSPERTSPDLKRREDRTVARGEKTVeeeeeee  439
                A  H F EK  RS         +R+ P  TS DL++ +D   A             
Sbjct  60   DKLPAASHVFVEKSFRSSSSVRLLPEKRIIPAETSRDLRKLDDSPAAEA-----------  108

Query  440  eNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAR  619
               + P KREVNRCSGCRRKVGLTGFRCRCG+LFC +HRYSDRHDCSYDYK+AGR+AI R
Sbjct  109  ---ALPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDCSYDYKSAGREAIER  165

Query  620  ENPVVK  637
            ENPVVK
Sbjct  166  ENPVVK  171



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 122/191 (64%), Gaps = 41/191 (21%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaI----  298
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCF+ATTA++ SSS +     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFNATTASSSSSSVSSIAGA  59

Query  299  ------------HHKFGEKQPRS-GFRRLSPERT--SP---DLKRREDRTVARGEKTVee  424
                             +K  RS   R LS +R+  SP    + R  +  V   EK V  
Sbjct  60   NNVVKEGGVGVGGGPISKKTARSSALRSLSKDRSDLSPVKVIIGRNRESDVTEVEKIV--  117

Query  425  eeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGR  604
                            NRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKA GR
Sbjct  118  ----------------NRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAVGR  161

Query  605  DAIARENPVVK  637
            + IARENPVVK
Sbjct  162  ETIARENPVVK  172



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 120/178 (67%), Gaps = 14/178 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCFSATTAA  SSS++     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSSSTNN  59

Query  311  ------GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS---PPAK  463
                   +K  RS   R    R+          T      +         NRS      K
Sbjct  60   TATSATDDKSSRSTPTRSQDNRSDSAPPTTAATTATATTNS----PMTASNRSGYDTAEK  115

Query  464  REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            + VNRCSGCR++VGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR+AIARENPVVK
Sbjct  116  KSVNRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENPVVK  173



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 119/173 (69%), Gaps = 15/173 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETE KV PETITLCVNNCG TGNP TNNMCQKCF+ATTA A +++ +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  311  GEKQPR-SGFRRLSPERTSP---DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 + SG +       SP   D  R   R ++           +       AKR+VNR
Sbjct  60   ISSSRKLSGEKSSRSRSRSPVLMDSVRDSSRNIS----------MDRFKSEESAKRQVNR  109

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGRDAIARENPVVK
Sbjct  110  CSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENPVVK  162



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETEFKV PET+TLCVN+CGV GNPATNNMCQ CF+ATT  + ++  +     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNDCGVIGNPATNNMCQNCFNATTPKSTAAVVSSSTGG  59

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                  S   + S   TS  + +R D +  +    V       +      K+ VNRCSGC
Sbjct  60   ASSGGVSILNQRST--TSRSINKRSDLSPPKTTTFVRSSGSRYDPEPGTEKKVVNRCSGC  117

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCGELFC +HRYSDRHDCSYDYK  GR+AIARENPVVK
Sbjct  118  RKRVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIARENPVVK  166



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 122/175 (70%), Gaps = 20/175 (11%)
 Frame = +2

Query  128  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH-  304
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKC +A +AAA +++++    
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCXNAASAAAAAATSSSSSA  61

Query  305  ---KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  472
               KF  EK PRS              ++     +AR ++T             P +R V
Sbjct  62   AILKFSAEKSPRSSSSFSFEAAAE-TCRKTTASEIARSDET-------------PNRRVV  107

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            NRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENPVVK
Sbjct  108  NRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENPVVK  162



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 123/193 (64%), Gaps = 34/193 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH--  304
            MAQ+T KEETEFKV PE +TLCVNNCG  GNPATNNMCQKCF+A+++++ SS+       
Sbjct  1    MAQRTEKEETEFKV-PEALTLCVNNCGFAGNPATNNMCQKCFNASSSSSSSSTTTSTTAS  59

Query  305  ---------------------KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTV  418
                                 KF  E+  RSG    SP+R+   +      T A    + 
Sbjct  60   TASSAPTTSSSAGLTGGPSVLKFSAERIHRSGPFSRSPDRSGLAMGMIRRDTGASPPSST  119

Query  419  eeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAA  598
                      S  A+REVNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCSYDYKAA
Sbjct  120  ---------ESNSARREVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAA  170

Query  599  GRDAIARENPVVK  637
            GR+AIARENPVVK
Sbjct  171  GREAIARENPVVK  183



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 118/175 (67%), Gaps = 23/175 (13%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVT--GNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ+T  EETEFKV PETIT+C+NNCGVT  GN ATNNMCQ CF+A+TA   S+      
Sbjct  1    MAQRTENEETEFKV-PETITVCINNCGVTVTGNAATNNMCQNCFTASTATTSSTVG----  55

Query  305  KFGEKQPRSGFRRL----SPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  472
                +  RSG   +    SP+R+ P+         +  + T+             AKR V
Sbjct  56   -ISSQSSRSGVISVNSVRSPKRSLPEESSEITDRNSSDQTTI-----------SEAKRVV  103

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +RCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENPV++
Sbjct  104  SRCSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHDCSFDYKAAGREAIARENPVIR  158



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 117/197 (59%), Gaps = 43/197 (22%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsa----------------  262
            MAQ+T  EETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF+A                
Sbjct  1    MAQRTENEETEFKV-PETLTLCVNNCGVTGNPANNNMCQKCFNATTATSSSSSAAASASA  59

Query  263  ------------ttaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARG  406
                             G+    +     +K  RS   R S +R+ P L +    T+ R 
Sbjct  60   SSLPSAAATSASNGVKDGAFGLGVGGPISKKSLRSSAIR-SSDRSGPYLAKV---TIIRN  115

Query  407  EKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYD  586
             ++               K+ VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYD
Sbjct  116  RES----------DGTEEKKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYD  165

Query  587  YKAAGRDAIARENPVVK  637
            YKAAGR+AIARENPVVK
Sbjct  166  YKAAGREAIARENPVVK  182



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score =   169 bits (427),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 11/179 (6%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPATNNMCQKCF+A+T+ +  SS   +   
Sbjct  65   MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSTTSNTTA  123

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVA----------RGEKTVeeeeeeeeNRSPPA  460
                  +     +   T+  LK   ++++             ++     ++E  + S  A
Sbjct  124  ATTTTITFAATTNGVSTNEILKFTSEKSLRSSISRSLAKDHQKQPKTASDKERSDSSSVA  183

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            K+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK  GR+AIARENPVVK
Sbjct  184  KKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENPVVK  242



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 112/156 (72%), Gaps = 17/156 (11%)
 Frame = +2

Query  197  VNNCGVTGNPATNNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSP  352
             +NCG TGNPATNNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S 
Sbjct  2    AHNCGFTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSL  61

Query  353  ERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRC  529
             R+S  DLK+  DRTV   ++  E          PPAKREV+RCSGCRRKVGLTGFRCRC
Sbjct  62   LRSSSQDLKKVGDRTVKEEDQLKESL--------PPAKREVSRCSGCRRKVGLTGFRCRC  113

Query  530  GELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GELFCGEHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  114  GELFCGEHRYSDRHDCSYDYKTAGREAIARENPVVK  149



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 111/154 (72%), Gaps = 17/154 (11%)
 Frame = +2

Query  203  NCGVTGNPATNNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSPER  358
            NCGVTGNPATNNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S  R
Sbjct  1    NCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLLR  60

Query  359  TSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
            +S  DLK+  DR V   ++  E          PPAKREVNRCSGCRRKVGLTGFRCRCGE
Sbjct  61   SSSQDLKKVGDRKVKEEDQLKESL--------PPAKREVNRCSGCRRKVGLTGFRCRCGE  112

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LFCGEHRYSDRHDC+YDYK AGR+AIARENPVVK
Sbjct  113  LFCGEHRYSDRHDCNYDYKTAGREAIARENPVVK  146



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 111/155 (72%), Gaps = 17/155 (11%)
 Frame = +2

Query  200  NNCGVTGNPATNNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSPE  355
            +NCGVTGNPATNNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S  
Sbjct  4    HNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLL  63

Query  356  RTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  532
            R+S  DLK+  DRT    ++  E          PPAKREVNRCSGCRRKVGLTGFRCRCG
Sbjct  64   RSSSQDLKKVGDRTXKEEDQLKESL--------PPAKREVNRCSGCRRKVGLTGFRCRCG  115

Query  533  ELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            ELFCGEHRYSDRHDC YDYK AGR+AIARENPVVK
Sbjct  116  ELFCGEHRYSDRHDCXYDYKTAGREAIARENPVVK  150



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 115/175 (66%), Gaps = 30/175 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETIT------LCVNNCGVTGNPATNNMCQKCFsattaaagsssa  292
            MAQ+T KEETE KV+    T      LC NNCGVT NPATNNMCQKCF+A+ AAAG  S 
Sbjct  1    MAQRTEKEETEVKVLESLATTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVESG  60

Query  293  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  472
            ++     ++  RS   R +P +    ++ RE   V R ++T                  V
Sbjct  61   SML----KRSARSVNLRSTPAKVV--IRSREIDPVKRDQQT------------------V  96

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENPVVK  151



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 115/172 (67%), Gaps = 27/172 (16%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL---CVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH  301
            MAQ+T KEETEFKV+    T    C NNCGVT NPATNNMCQKCF+A+ AAAG  S +I 
Sbjct  1    MAQRTEKEETEFKVLETLTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSIL  60

Query  302  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
                ++  RS   R +P +    ++ RE   V R ++T                  +NRC
Sbjct  61   ----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INRC  96

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            SGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  97   SGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENPVVK  148



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 115/173 (66%), Gaps = 28/173 (16%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL----CVNNCGVTGNPATNNMCQKCFsattaaagsssaaI  298
            MAQ+T KEETEFKV+    T     C NNCGVT NPATNNMCQKCF+A+ AAAG  S +I
Sbjct  1    MAQRTEKEETEFKVLETLTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSI  60

Query  299  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 ++  RS   R +P +    ++ RE   V R ++T                  +NR
Sbjct  61   L----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INR  96

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  97   CSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENPVVK  149



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 111/176 (63%), Gaps = 27/176 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV------NNCGVTGNPATNNMCQKCFsattaaagsssa  292
            MAQ+T KEETEFKV+    T         NNCGVT NPATNNMCQKCF+A+  +A +S  
Sbjct  1    MAQRTEKEETEFKVLETLTTTTAATLLCTNNCGVTANPATNNMCQKCFNASLVSAATSGV  60

Query  293  aIHH-KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
             +      ++  RS   R SP +    ++ RE   V R ++ V                 
Sbjct  61   VVDTGSILKRSARSVNLRSSPAKVV--IRPREMDAVKRDQQVV-----------------  101

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             NRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  102  -NRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  156



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 114/176 (65%), Gaps = 31/176 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPATNNMCQKCFsattaaagsss  289
            MAQ+T KEETEFKV+    T        C NNCGVT NPATNNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  290  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
             +      ++  RS   R SP +    ++ RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  152



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 116/176 (66%), Gaps = 31/176 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPE-------TITLCVNNCGVTGNPATNNMCQKCFsattaaagsss  289
            MAQ+T KEETEFKV+         T TLC NNCGVT NPATNNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLESLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  290  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
             +      ++  RS   R +P +    ++ RE   V R ++T                  
Sbjct  61   GSTL----KRASRSVNLRPTPAKVV--IRPREIDPVKRDQQT------------------  96

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIARENPVVK
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENPVVK  152



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 113/177 (64%), Gaps = 32/177 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV-------NNCGVTGNPATNNMCQKCFsattaaagsss  289
            MAQ+T KEETEFKV+    +          NNCGVT NPATNNMCQKCF+A+ A A + S
Sbjct  1    MAQRTEKEETEFKVLETLSSSTATTTTLCSNNCGVTANPATNNMCQKCFNASIAVASADS  60

Query  290  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRRE-DRTVARGEKTVeeeeeeeeNRSPPAKR  466
             +I     ++  RS    L   +T   ++ RE D +V R ++                  
Sbjct  61   GSIL----KRSARSV--NLRSSQTKVVIRNREIDSSVKRDQQI-----------------  97

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  98   -VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  153



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 114/176 (65%), Gaps = 31/176 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPATNNMCQKCFsattaaagsss  289
            MAQ+T KEETEFKV+    T        C NNCGVT NPATNNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  290  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
             +      ++  RS   R SP +    ++ RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIARENPVVK
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENPVVK  152



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 108/179 (60%), Gaps = 30/179 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPATNNMCQKCFsattaaag  280
            MAQ+T KEETEFKV+    T             NNCGVT NPATNNMCQKCF+A+  + G
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNMCQKCFNASLVSTG  60

Query  281  sssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA  460
                       ++  RS   R SP +    ++ RE   V R ++ V              
Sbjct  61   VVVVDSGSSVLKRPARSVNLRSSPAKVV--IRPREIDAVKRDQQIV--------------  104

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
                NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  105  ----NRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  159



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 111/175 (63%), Gaps = 30/175 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPATNNMCQKCFsattaaagsssa  292
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+TNNMCQKCF+A+ +    +  
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPT--  58

Query  293  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  472
                   ++  RS   R +P R    ++ RE   V R                   ++ V
Sbjct  59   ----PIVKRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTV  96

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIARENPVVK
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENPVVK  151



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 111/175 (63%), Gaps = 30/175 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPATNNMCQKCFsattaaagsssa  292
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+TNNMCQKCF+A+ +    +  
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPT--  58

Query  293  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  472
                   ++  RS   R +P R    ++ RE   V R                   ++ +
Sbjct  59   ----PIVKRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTI  96

Query  473  NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIARENPVVK
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHECSYDYKTAGREAIARENPVVK  151



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 107/174 (61%), Gaps = 32/174 (18%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITL-----CVNNCGVTGNPATNNMCQKCFsattaaagsssaa  295
            MAQ+T KEETEFKV+    T      C NNCGVT +P+TNNMCQKCF+A           
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTLCSNNCGVTASPSTNNMCQKCFNAGIDPT------  54

Query  296  IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
                  ++  RS   R +P + +  ++ RE   V R                   ++ VN
Sbjct  55   ---PIAKRSARSVSLRSTPAKAA--IRPRETDPVKRDHH----------------QQTVN  93

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  94   RCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENPVVK  147



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 103/176 (59%), Gaps = 27/176 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPET-------ITLCVNNCGVTGNPATNNMCQKCFsattaaagsss  289
            MAQ+T  EETEFKVV ET       I LC+ NCGV GNP+TNNMCQ CF+A+T     SS
Sbjct  1    MAQRTENEETEFKVVSETLQQTTTIINLCIKNCGVVGNPSTNNMCQNCFTASTTILPPSS  60

Query  290  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
            +         +  S         T  DL           EKTV              KR 
Sbjct  61   SRSVRSPKRSRQESSSSSEEEGSTDHDLV---------DEKTV-----------SEVKRV  100

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            V+RCSGCRRKVGL GFRCRCGELFC +HRYSDRHDC YDYK  GR+ IARENPV++
Sbjct  101  VSRCSGCRRKVGLAGFRCRCGELFCADHRYSDRHDCGYDYKKVGREEIARENPVIR  156



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 108/169 (64%), Gaps = 18/169 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+    E E +V PET TLCVNNCG  GNPATNNMCQ CF A   A+ SS        
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFASSSS---PPSCS  52

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
            G ++PRS   RL      PD      R    G             R  PA R+VNRC+GC
Sbjct  53   GHEKPRSAPFRL------PDPAAEGGRGRVEGPAAKAVAAA---TRLAPA-RQVNRCAGC  102

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGR+AIARENP+V+
Sbjct  103  RKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAIARENPLVR  151



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 107/169 (63%), Gaps = 15/169 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+    E E +V PET+TLCVNNCG  GNPATNNMCQ CF A    + S  +    + 
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFTSPSPPS----RS  51

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
            G ++P S     +P R SPD      R  A       +           + R VNRC+GC
Sbjct  52   GHEKPSS-----TPTR-SPDPAVEAGRGGAESPAAKTDAATAAAAVGVASARRVNRCAGC  105

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG LFC EHRYSDRHDCS+DYKAAGR+AIARENPVV+
Sbjct  106  RKRVGLTGFRCRCGNLFCVEHRYSDRHDCSFDYKAAGREAIARENPVVR  154



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 106/174 (61%), Gaps = 26/174 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNC-----GVTGNPATNNMCQKCFsattaaagsssaa  295
            MAQ+T KEETEFKV+    T           GVT NPATNNMCQKCF+A+  +A +    
Sbjct  1    MAQRTEKEETEFKVLDTLTTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE  60

Query  296  IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
                  ++  RS   R SP +    ++ RE   V R ++                   VN
Sbjct  61   -SGSILKRSARSVNLRSSPAKVV--IRTREIDAVKRDQQI------------------VN  99

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  100  RCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  153



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 108/173 (62%), Gaps = 24/173 (14%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNC----GVTGNPATNNMCQKCFsattaaagsssaaI  298
            MAQ+T KEETEFKV+    T     C    GVT NPATNNMCQKCF+A+  +A +     
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE-  59

Query  299  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                 ++  RS   R SP +    ++ RE   V + ++ +                 VNR
Sbjct  60   SGSILKRSARSVNLRSSPAKVV--IRPREIDAVKKRDQQI-----------------VNR  100

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  101  CSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  153



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 109/183 (60%), Gaps = 34/183 (19%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAT-NNMCQKCFsattaaa  277
            MAQ+T KEETEFKV+    T             NNCGVT NPAT NNMCQKCF+A+  +A
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  60

Query  278  gsssaaIHHKFGEKQPRSGFRRLSPERTSPD---LKRREDRTVARGEKTVeeeeeeeeNR  448
             +    +         RS   R    R+SP    ++ RE   V R ++            
Sbjct  61   TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDAVKRDQQI-----------  107

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
                   VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  108  -------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  160

Query  629  VVK  637
            VVK
Sbjct  161  VVK  163



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 110/169 (65%), Gaps = 16/169 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+    E E +V PET TLCVNNCG  GNPATNNMCQ CF A   AA SS  +     
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFAAPSSPPSCSS--  53

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
              ++PRS     +P R SPD         ARG     +        +  AKR VNRC+GC
Sbjct  54   -HEKPRS-----APAR-SPDPAAEGGWGEARGPPAKPDAAAAAAGVT-LAKR-VNRCAGC  104

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGR+AI RENPVV+
Sbjct  105  RKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAITRENPVVR  153



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 104/169 (62%), Gaps = 19/169 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+    E E +V PET+TLCVNNCG  GNPATNNMCQ CF A   A+ S  +   H  
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFASPSPPSRSSH--  53

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
             EK   +  R L P   +            R        + +         R V+RC+GC
Sbjct  54   -EKASSAPARSLDPAAEA-----------GREGAEGPAGKADAAAAVVSPARRVSRCAGC  101

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG+LFC +HRYSDRHDCS+DYKAAGR+AIARENPVV+
Sbjct  102  RKRVGLTGFRCRCGKLFCAQHRYSDRHDCSFDYKAAGREAIARENPVVR  150



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 108/183 (59%), Gaps = 34/183 (19%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAT-NNMCQKCFsattaaa  277
            MAQ+T KEETEFKV+    T             NNCGVT NPAT NNMCQKCF+A+  +A
Sbjct  44   MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  103

Query  278  gsssaaIHHKFGEKQPRSGFRRLSPERTSPD---LKRREDRTVARGEKTVeeeeeeeeNR  448
             +    +         RS   R    R+SP    ++ RE   V R ++            
Sbjct  104  TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDPVKRDQQI-----------  150

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
                   VNRCSGCR+KVGLTGFRCRCGELFC EHRYS RHDCSYDYK AGR+AIARENP
Sbjct  151  -------VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSGRHDCSYDYKTAGREAIARENP  203

Query  629  VVK  637
            VVK
Sbjct  204  VVK  206



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 98/169 (58%), Gaps = 12/169 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K++   ++    ITLC N+CG  GNPAT N+CQ CF A TA   S S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATAFTSSPSSLSSPVL  60

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  109  RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVR  157



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   142 bits (359),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 99/169 (59%), Gaps = 12/169 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K++   ++    ITLC N+CG  GNPAT N+CQ CF A TA+  S S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL  60

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  109  RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVR  157



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 98/169 (58%), Gaps = 12/169 (7%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ   K++   ++    ITLC N+CG  GNPAT N+CQ CF A TA+  S S+      
Sbjct  1    MAQGDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL  60

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  109  RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVR  157



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 102/171 (60%), Gaps = 8/171 (5%)
 Frame = +2

Query  131  MAQKTGK--EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ+  K  E TE  +    ITLC N+CG  GNPAT N+CQ CF A++++   S+A+   
Sbjct  1    MAQRDKKVEEPTEVHLHAAEITLCANSCGFPGNPATKNLCQNCFLASSSSPSPSAASPPS  60

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
                      F +L P   +  L +     +A         + +       +K  VNRC 
Sbjct  61   PSSSPAAFPLFDKLRPAAVASPLLQAAPVYMAVDRPAAGPADPKA------SKSSVNRCH  114

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR++VGLTGFRCRCGE+FCG HRYSDRHDCSYDYK+A RDAIARENPVV+
Sbjct  115  NCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENPVVR  165



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 90/151 (60%), Gaps = 12/151 (8%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  110  GEHRYSDRHGCSYDYKSAARDAIARDNPVVR  140



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 99/172 (58%), Gaps = 10/172 (6%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC NNCG  GNPAT N+CQ CFSA TA+  SS ++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSAATASRSSSPSSPTSSS  59

Query  311  GEK---QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
                  QPR     L        L   +   V +  + V                 VNRC
Sbjct  60   SASAVSQPRPA--ALVDAAAVELLASADAAAVGQSMEVVAAAPAATAA----RSSAVNRC  113

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            S CR++VGLTGFRCRCGELFCG HRYSDRH CSYDYK AGRDAIARENPVV+
Sbjct  114  SSCRKRVGLTGFRCRCGELFCGAHRYSDRHGCSYDYKGAGRDAIARENPVVR  165



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 90/151 (60%), Gaps = 12/151 (8%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDY++A RDAIAR+NPVV+
Sbjct  110  GEHRYSDRHGCSYDYQSAARDAIARDNPVVR  140



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 99/177 (56%), Gaps = 27/177 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC N CG  GNPAT N+CQ CFSA +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANGCGFPGNPATQNLCQNCFSAASASTSSPPSPSSSSS  59

Query  311  GEK-------QPRSGFRRLSP-ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
                       P     R +P E  SP + R     V  G                  K 
Sbjct  60   SSSSSSLPGLSPVVDKPRPAPVELASPAVDRAPAVEVKAG------------------KT  101

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             VNRCS CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  102  SVNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAATRDAIARDNPVVR  158



>ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 106/169 (63%), Gaps = 21/169 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE +    PET+TLCVNNCG  GNPATNNMCQ CF A+T AA  +  +     
Sbjct  1    MAQRE-KEEAKLHA-PETLTLCVNNCGFPGNPATNNMCQSCFQASTIAASPAPHSC----  54

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                PRS     SPER +   + R+ RT       V               R+V+RC  C
Sbjct  55   ---SPRSALPIRSPERAA---EERDARTSEAPAAAVSAPA---------PARQVSRCFSC  99

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG+LFCGEHRYSDRHDCSYDYKAA R AIAR NPVV+
Sbjct  100  RKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKAAARAAIARANPVVR  148



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  410  KTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY  589
            K V++E+++ ++  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY
Sbjct  6    KKVKQEDDQLKDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY  65

Query  590  KAAGRDAIARENPVVK  637
            K AGR+AIARENPVVK
Sbjct  66   KTAGREAIARENPVVK  81



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  452  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPV  631
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENPV
Sbjct  19   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENPV  78

Query  632  VK  637
            VK
Sbjct  79   VK  80



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 88/151 (58%), Gaps = 10/151 (7%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
            P             E+                   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPV----------EEMASALATATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  111

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  112  GEHRYSDRHGCSYDYKSAARDAIARDNPVVR  142



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 91/155 (59%), Gaps = 20/155 (13%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  365  P----DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  532
            P    ++        A   KT                  VNRCS CR++VGLTGFRCRCG
Sbjct  62   PPPVEEVSSALATAPAPAAKT----------------SAVNRCSRCRKRVGLTGFRCRCG  105

Query  533  ELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             LFCGEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  106  HLFCGEHRYSDRHGCSYDYKSAARDAIARDNPVVR  140



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 96/169 (57%), Gaps = 17/169 (10%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+                 + 
Sbjct  5    SQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCY---------------KDYF  48

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVee-eeeeeeNRSPPAKREVNRCSGC  490
              + ++    L     +   K  E      GE  VE   EE   +   PAK+  NRCS C
Sbjct  49   LSKSKASIETLVVPPPAEAKKVEEKAAGGDGEAKVESFAEEGAPSGESPAKKPTNRCSFC  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             +KVGL GF+CRCGE+FC  HRYSD+H+C++DYK AG+DAIA+ NP+VK
Sbjct  109  NKKVGLMGFKCRCGEVFCSLHRYSDKHNCAFDYKGAGQDAIAKANPLVK  157



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 19/170 (11%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCYKDC--------------FL  49

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVA-RGEKTVeeeeeeeeNRS-PPAKREVNRCSG  487
             K   S    + P   S + K+ E++ +   GE  V    EE  +    PAK   NRCS 
Sbjct  50   SKSKASIETSVVP--PSAEAKKAEEKPLGGNGEAKVGSFAEEGASSGESPAKETPNRCSF  107

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            C ++VGL GF+CRCGELFC  HRYSD+H+C++DY+ AG+DAIA+ NPVVK
Sbjct  108  CNKRVGLMGFKCRCGELFCSLHRYSDKHNCAFDYRGAGQDAIAKANPVVK  157



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 101/181 (56%), Gaps = 24/181 (13%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH---  301
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++ S+S +     
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFQAATASSASASVSPPSPS  60

Query  302  ---------HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP  454
                      KF E+Q         P  T+    R  ++  A                  
Sbjct  61   SSLSPSPAVFKFDEQQ------HARPSATAVFADRPAEQPPAPASARPIRTTSTS-----  109

Query  455  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
             +   VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDC +DYKA GRDAIARENPVV
Sbjct  110  -SSSSVNRCQSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCCFDYKAVGRDAIARENPVV  168

Query  635  K  637
            +
Sbjct  169  R  169



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 90/151 (60%), Gaps = 13/151 (9%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A TA+  S S+       +K PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL-DKPPRPAAPLVEPQAPL  60

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  61   PPPVEEMASALAPAPAPVVKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  108

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  109  GEHRYSDRHGCSYDYKSAARDAIARDNPVVR  139



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 97/171 (57%), Gaps = 21/171 (12%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCY--------------KDYFL  49

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVARGE---KTVeeeeeeeeNRSPPAKREVNRCS  484
             K   S    L P    P   ++ ++  A G+   K     EE   +   P K+  NRCS
Sbjct  50   SKSKASIETLLVP---PPVEAKKVEKKSAGGDGEAKDGSFTEEGAPSGGAPVKKPPNRCS  106

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             C +KVGL GF+CRCGE+FC  HRYSD+HDC++DY+ AG+DAIA+ NPVVK
Sbjct  107  FCNKKVGLMGFKCRCGEVFCSVHRYSDKHDCAFDYRGAGQDAIAKANPVVK  157



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 91/168 (54%), Gaps = 16/168 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ++ KE  E    PE   LCVNNCG  GN  TNNMC KC+         +   +  K 
Sbjct  1    MAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVEKK-  59

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                    F   S     P    +ED   A     V + +  +E   PP+    NRC  C
Sbjct  60   -------AFAAASSSMV-PLEPAKEDEVPAAA---VVDSQAAQEPPKPPS----NRCLSC  104

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            R+KVGLTGF+CRCG  FC  HRY+D H+CS+DYKAAGR+ IA++NPVV
Sbjct  105  RKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNPVV  152



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 93/171 (54%), Gaps = 16/171 (9%)
 Frame = +2

Query  122  VLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH  301
            ++ MAQ++ KE  E    PE   LCVNNCG  GN  TNNMC KC+         +   + 
Sbjct  43   LVAMAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVE  102

Query  302  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
             K         F   S     P    +ED   A     V + +  +E   PP+    NRC
Sbjct  103  KK--------AFAAASSSMV-PLEPAKEDEVPAAA---VVDSQAAQEPPKPPS----NRC  146

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
              CR+KVGLTGF+CRCG  FC  HRY+D H+CS+DYKAAGR+ IA++NPVV
Sbjct  147  LSCRKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNPVV  197



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 97/170 (57%), Gaps = 19/170 (11%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCY--------------KDYFL  49

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVA-RGE-KTVeeeeeeeeNRSPPAKREVNRCSG  487
             K   S    L P     + K+ E++     GE K     +E   +   P K+  NRCS 
Sbjct  50   SKSKASVETLLVPPPV--EAKKVEEKPAGGDGEAKGGSFTDEAAPSEGSPVKKPPNRCSF  107

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            C ++VGL GF+CRCGE+FC  HRYSD+HDC++DY+ AG+DAIA+ NPVVK
Sbjct  108  CNKRVGLMGFKCRCGEVFCSLHRYSDKHDCAFDYRGAGQDAIAKANPVVK  157



>ref|XP_002993103.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
 gb|EFJ05851.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
Length=176

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 99/171 (58%), Gaps = 4/171 (2%)
 Frame = +2

Query  131  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ++ K E E     +PE   LC NNCG  G+ AT N+C KC+   +++  + +     
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAETMITTT  60

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
                    +       E  +     R   T+A G  T+  E++   ++  P  R  NRC 
Sbjct  61   TTTAAACATATPAAKEEALAAIATSRTSTTIATGATTLVTEDDSSASQEKP--RLPNRCL  118

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+++GLTGF+CRCG++FC  HRYSD+H+CS+DYKAAGR+AIA+ NPVVK
Sbjct  119  ACRKRLGLTGFKCRCGDVFCSMHRYSDKHNCSFDYKAAGREAIAKANPVVK  169



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 99/169 (59%), Gaps = 0/169 (0%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++ +S++      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASSSASASVSPPPP  60

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                      +   ++   + + R        E+            +P +   V RC  C
Sbjct  61   SSSSSSPAVLQFDEQQQQQNPRPRAPAASGPTEEPPRPARASAPAPAPASSSSVRRCQTC  120

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NPVV+
Sbjct  121  RKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVR  169



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 84/151 (56%), Gaps = 13/151 (9%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A +A                 P        P R +
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASA---------STSSLSSLPGLSPVLDKPPRPA  52

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
              L   +       E+ V         ++      VNRCS CR++V LTGFRCRCG LFC
Sbjct  53   TPLVESQAPLPPPVEEMVSAPAPALAAKT----SAVNRCSRCRKRVSLTGFRCRCGHLFC  108

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  109  GEHRYSDRHGCSYDYKSAARDAIARDNPVVR  139



>ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 104/170 (61%), Gaps = 23/170 (14%)
 Frame = +2

Query  131  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ+   EE E ++   E++ LC+NNCG  G+PATNNMCQ CF A+ AAA SS       
Sbjct  1    MAQR---EEKEMELHAHESLALCINNCGFPGDPATNNMCQTCFQASPAAASSSL------  51

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                 PRS  RR +P   SPD     DR   +G  T                R+VNRC  
Sbjct  52   -----PRSCSRRSAPSIRSPDPA---DRAEEQGAPTAALASPAPA-----PARKVNRCLS  98

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VG TGFRCRCGELFCGEHRYSDRHDC YDYKAA R AIAR NP+V+
Sbjct  99   CRKRVGFTGFRCRCGELFCGEHRYSDRHDCGYDYKAAARAAIARANPIVR  148



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 100/174 (57%), Gaps = 16/174 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagss-saaIH  301
            MAQ++ K+ET+      PE   LC NNCG  G+ ATNN+C KC+            A+  
Sbjct  1    MAQESWKKETDETECQTPEGPILCANNCGFFGSAATNNLCSKCYRDMFMKQQQQFKASTV  60

Query  302  HKFGEK-QPRSGFRRLSPERTSPDLKRREDR-TVARGEKTVeeeeeeeeNRSPPAKREVN  475
                EK Q  S   +L P     +    E++ T+  G  T E       N+ PP     N
Sbjct  61   TPVAEKVQATSTLVQLEPVVGRVNNNNIEEKLTLQEGSSTYET------NKQPP-----N  109

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RC  C+++VGLTGF+CRCG +FCG HRYS++H CSYDY++AGRDAIA+ NPVVK
Sbjct  110  RCLACQKRVGLTGFKCRCGGIFCGVHRYSEKHGCSYDYRSAGRDAIAKANPVVK  163



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 95/170 (56%), Gaps = 41/170 (24%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  K +TEFKV PE I   +N C  T    T+      F                 F
Sbjct  1    MAQKAQKNDTEFKV-PEPI---INPCTTTTTTTTSISEPSRF-----------------F  39

Query  311  GEKQPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                P +  R  SP+R+ P D + + D+T                  S   KR VNRCSG
Sbjct  40   DATTPATSSR--SPKRSLPLDEESQTDQTT-----------------SSEPKRAVNRCSG  80

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENPVVK
Sbjct  81   CRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVK  130



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 98/172 (57%), Gaps = 22/172 (13%)
 Frame = +2

Query  131  MAQK-TGKEETEFKVVPETITL--CVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH  301
            MA K T KEETEFKV PETIT   C+N         T        + TT +    S    
Sbjct  1    MAHKITKKEETEFKV-PETITPSPCINIQTAATTTVTAATTTVTAATTTTSISEPSRFFE  59

Query  302  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
             K      RS     SP+R+ P     +D T  + + T           S  AKR VNRC
Sbjct  60   DK---STARSATSSRSPKRSHPS----DDDTQVQPQTT-----------SSEAKRAVNRC  101

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            SGCRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GR+AIARENPVV+
Sbjct  102  SGCRRRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTVGREAIARENPVVR  153



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 92/169 (54%), Gaps = 17/169 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ++ K E+E  V  PE   LCVNNCG  G+  TNNMC KC+         ++  +  K
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKK  60

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                     F   S  +T  +  + ++   A  E     +E        P K   NRC  
Sbjct  61   --------AFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQE--------PPKPPSNRCLS  104

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            CR+KVGLTGF+CRCG  FC  HRY++ HDC++DYK AGRD IA++NPVV
Sbjct  105  CRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNPVV  153



>ref|NP_001106263.1| AN110 [Zea mays]
 gb|ABS83249.1| AN110 [Zea mays]
Length=174

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 98/169 (58%), Gaps = 2/169 (1%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA+A +S +      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASASASVSPPPPSS  60

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                    F     ++   + + R     A G              +P +   V RC  C
Sbjct  61   SSSPAVLQFDDQQQQQQQQNPRPRA--PAASGPTEEPPRPARAPAPAPASSSSVRRCQTC  118

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NPVV+
Sbjct  119  RKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVR  167



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 89/151 (59%), Gaps = 14/151 (9%)
 Frame = +2

Query  185  ITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  364
            ITLC N+CG  GNPAT N+CQ CF A +A+  S S+         +P        P   +
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSPSSLAGLSPVLDKP--------PRPAT  53

Query  365  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  544
            P ++ +        E          +  +      VNRCS CR++VGLTGFRCRCG LFC
Sbjct  54   PLVEAKAPLPPPAEEMASAPAPAPAKTSA------VNRCSRCRKRVGLTGFRCRCGHLFC  107

Query  545  GEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GEHRYSDRH CSYDYK+A RDAIAR+NPVV+
Sbjct  108  GEHRYSDRHGCSYDYKSAARDAIARDNPVVR  138



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 99/171 (58%), Gaps = 15/171 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF A  A+   SS++     
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSSSS  60

Query  311  --GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
              G   P     R  P     +L R         E               PA+  VNRCS
Sbjct  61   LPGVSAPTPVIDRPRPAPLEAELARPAVDLAPATEAK-------------PARTSVNRCS  107

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR++VGLTGFRCRCG++FCGEHRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  108  SCRKRVGLTGFRCRCGDMFCGEHRYSDRHGCSYDYKAAARDAIARDNPVVR  158



>ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=151

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 100/171 (58%), Gaps = 29/171 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  KEETE KV P++I L   N  V+  P  +N  QK  S +T++  +   +  +  
Sbjct  1    MAQKREKEETELKV-PQSIPL--PNLPVSSQPHADN--QKPASPSTSSVRAPEISDLNFS  55

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG-  487
            G    RS     SPE++  +  RR    V R                    RE NRCSG 
Sbjct  56   GTDDSRSSSGARSPEKSDLEEIRR---LVKR-------------------PREANRCSGI  93

Query  488  -CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRRKVGL GFRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIARENPVV+
Sbjct  94   GCRRKVGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENPVVR  144



>gb|ABK90631.1| zinc finger protein [Aeluropus littoralis]
Length=159

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 88/170 (52%), Gaps = 21/170 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ++ K+E+     PE   LC+NNCG  G+  TNNMC KC+          +  +  K 
Sbjct  1    MAQESWKQESH---APEAPILCINNCGFFGSSMTNNMCSKCYRDFVKLMEMDAPVVDKKL  57

Query  311  GEKQPRSG--FRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
                  S   F     + T PD    +D+  A+                 P K   NRCS
Sbjct  58   ITTASSSTVPFETAKQDDTVPDAAAMDDKQPAQE----------------PPKPPSNRCS  101

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
             CR+KVGLTGF+CRCG  FC  HRY+D H+C++DYK   R+ IA++NPVV
Sbjct  102  TCRKKVGLTGFQCRCGGTFCSLHRYTDSHECTFDYKKVAREQIAKQNPVV  151



>ref|NP_001266661.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 gb|ACG38807.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
Length=167

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 100/178 (56%), Gaps = 27/178 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH--  304
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++ +S +      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASSSASVSPPPPSS  60

Query  305  -------KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAK  463
                   +F ++Q     R  +P  + P  +       +    +                
Sbjct  61   SSSPAVLQFDDQQQNP--RPCAPAASGPTEEPPRPARASAPASSS---------------  103

Query  464  REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
              V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NPVV+
Sbjct  104  -SVRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNPVVR  160



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 83/154 (54%), Gaps = 15/154 (10%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            P    LC NNCG  G PATNN+C KC+                 F  KQ +     +  E
Sbjct  18   PNAPILCSNNCGFFGTPATNNLCSKCY---------------RDFFLKQSKVAAASVVAE  62

Query  356  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
            R   +    +   V  G++      EE      P K   NRCS CR++VGLTGF+CRCG+
Sbjct  63   RKVEEPIVEKAGQVGVGQEAKATLSEEGTTSGDPGKLPANRCSFCRKRVGLTGFKCRCGQ  122

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             FC  HRY+D+H+C +DYK AG+DAIA+ NPVVK
Sbjct  123  TFCSLHRYTDKHNCLFDYKTAGQDAIAKANPVVK  156



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141

Query  629  VVK  637
            VVK
Sbjct  142  VVK  144



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141

Query  629  VVK  637
            VVK
Sbjct  142  VVK  144



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 90/170 (53%), Gaps = 41/170 (24%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  K +T+FKV PE IT C           +                         F
Sbjct  1    MAQKAQKNDTDFKV-PEPITPCATATAAAATSISEP--------------------SRFF  39

Query  311  GEKQPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                P +  R  SP+R+ P +     DRTVA                S P KR VNRCSG
Sbjct  40   DAATPATSSR--SPKRSLPLEDAANADRTVA----------------SEP-KRAVNRCSG  80

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRR+VGLTGFRCRCG+LFC EHRY+DRHDCSYDYK  GR+AIARENPVVK
Sbjct  81   CRRRVGLTGFRCRCGDLFCAEHRYTDRHDCSYDYKTVGREAIARENPVVK  130



>dbj|BAK01503.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 93/170 (55%), Gaps = 17/170 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ++ KE  +  V  PE   LCVNNCG  GN  T NMC KC+  T  A   ++  + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPILCVNNCGFFGNRMTENMCSKCYRDTAKAKRMATL-VENK  59

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                   S    ++  +       +E + VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPLVAEMKDEASGSAKEGKQVAEEEAP-----------KPPS----NRCLS  104

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR+KVGLTGF+CRCG+ FC  HRY+D HDC +DYK AGR+ IA++NPVVK
Sbjct  105  CRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNPVVK  154



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 94/169 (56%), Gaps = 13/169 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF             +    
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCF-------------LAGPA  47

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                  S         ++P L R     V         +       + PA+  VNRCS C
Sbjct  48   STSPSSSSSSLPGASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSC  107

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG++FCGEHRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  108  RKRVGLTGFRCRCGDVFCGEHRYSDRHGCSYDYKAAARDAIARDNPVVR  156



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +2

Query  458  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            AKR+VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GR+AIARENPVVK
Sbjct  74   AKRDVNRCSGCRRKVGLTGFRCRCGDLFCWEHRYSDRHDCSYDYKTVGREAIARENPVVK  133



>gb|EMT17725.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Aegilops tauschii]
Length=161

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 92/170 (54%), Gaps = 17/170 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ++ KE  +  V  PE   +C+NNCG  GN  T NMC KC+  T  A   +   + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKSMALL-VENK  59

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                   S    ++  +       +E + VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPMVAEIKDEASASAKEGKRVAEEEAP-----------KPPS----NRCLS  104

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR+KVGLTGF+CRCG+ FC  HRY+D HDC +DYK AGR+ IA++NPVVK
Sbjct  105  CRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNPVVK  154



>ref|XP_010489793.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=152

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 92/162 (57%), Gaps = 31/162 (19%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPATNNMCQKCFsattaaag  280
            MAQ+T KEETEFKV+    T             NNCGVT NPATNNMCQKCF+A+  +A 
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNMCQKCFNASLVSAT  60

Query  281  sssaaIHHKFGEKQ-PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP  457
            +S          K+  RS   R SP +    ++ RE   V R ++               
Sbjct  61   ASVVVDSGSSVLKRSARSVNLRSSPAKVV--IRPREIDAVKRDQQI--------------  104

Query  458  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSY  583
                VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDC Y
Sbjct  105  ----VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCIY  142



>gb|EEC76316.1| hypothetical protein OsI_13859 [Oryza sativa Indica Group]
Length=205

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 101/178 (57%), Gaps = 20/178 (11%)
 Frame = +2

Query  110  VVFLVLRMAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaags  283
            V  + L MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+  T  A   
Sbjct  39   VQLVFLTMAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTV  98

Query  284  ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAK  463
            ++        EK+P      LS      ++      +VA G++ +EE+        PP+ 
Sbjct  99   ATVV------EKKP---LASLSSTPLVAEVTDGGSGSVADGKQVMEED-----TPKPPS-  143

Query  464  REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
               NRC  CR+KVGLTGF+CRCG  FC  HRY+D H C++DYK AGR+ IA++NP+VK
Sbjct  144  ---NRCLSCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQAGREQIAKQNPLVK  198



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
            S  AKR VNRCSGCR++VGLTGF CRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141

Query  629  VVK  637
            VVK
Sbjct  142  VVK  144



>ref|XP_008384536.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008349466.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 79/162 (49%), Gaps = 0/162 (0%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LCVNNCG  G+ AT NMC KC          +  A           S
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
                  P   +P +  +      +   +         +   P      RCS C ++VGLT
Sbjct  64   SINANEPVIAAPPVDIQSQPVAPQTISSQPSFSFGSGSSGEPKPEGPKRCSSCNKRVGLT  123

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF CRCG LFC  HRYSD+HDC YDY+ AGRDAIA+ NPVVK
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCPYDYRTAGRDAIAKANPVVK  165



>gb|EMS47592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Triticum urartu]
Length=267

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 93/171 (54%), Gaps = 17/171 (10%)
 Frame = +2

Query  128  RMAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            +MAQ++ KE  +  V  PE   +C+NNCG  GN  T NMC KC+  T  A   +   + +
Sbjct  106  KMAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKKMALL-VEN  164

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
            K       S    ++  +       +E + VA  E              PP+    NRC 
Sbjct  165  KTAAAVASSPTPMVAEIKDEASASAKEGKQVAEEEAP-----------KPPS----NRCL  209

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+KVGLTGF+CRCG+ FC  HRY+D HDC +DYK AGR+ IA++NPVVK
Sbjct  210  SCRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNPVVK  260



>ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
8-like [Solanum tuberosum]
 gb|AFW90615.1| stress-associated protein 3 [Solanum tuberosum]
 gb|AFX66985.1| stress-associated protein 3 [Solanum tuberosum]
Length=171

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH----KFGEK  319
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  320  QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCR  493
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  494  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NPVVK
Sbjct  117  KKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANPVVK  164



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 91/168 (54%), Gaps = 16/168 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            M Q + KE  E    PE   LCVNNCG  G+  TNNMC KC+     A       I    
Sbjct  1    MTQDSWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATT-----IAAPV  55

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
             EK       ++    +S ++   + +    G   + + +  +E   PP+    NRC  C
Sbjct  56   AEK-------KVFTVASSSNVTLEQAKADEVGAVPLVDSQAAQEPPKPPS----NRCLSC  104

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            R+KVGLTGF+CRCG  FC  HRY+D H+CS+DYK AGR+ IA++NPVV
Sbjct  105  RKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKKAGREQIAKQNPVV  152



>ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X1 [Eucalyptus grandis]
Length=196

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 94/186 (51%), Gaps = 12/186 (6%)
 Frame = +2

Query  95   ISDCLVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaa  274
            I  CL  F   R+ +K   +ET  +  PE   LC+NNCG  G+PAT NMC KC       
Sbjct  11   IERCLFQFSRWRI-EKMEHDETGCQAPPEGPILCINNCGFFGSPATMNMCSKCHKDMLLK  69

Query  275  agsssaaIHHKFGEKQPRSGFRRLSP---ERTSPDLKRREDRTVARGEK--TVeeeeeee  439
               +  A       +   S      P         L   E +T+ +     +V     E+
Sbjct  70   QEQAKLAASSIAAAENGSSSTTASEPVFAASVDTQLNTVEPKTIPKQPACDSVTVATVEK  129

Query  440  eNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAR  619
                P       RCS C ++VGLTGF CRCG +FCG HRYSD+HDC +DY++AGR+AIA+
Sbjct  130  PKEGP------TRCSSCNKRVGLTGFSCRCGNIFCGTHRYSDKHDCPFDYRSAGRNAIAK  183

Query  620  ENPVVK  637
             NPV+K
Sbjct  184  ANPVIK  189



>ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Solanum tuberosum]
Length=171

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH----KFGEK  319
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  320  QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCR  493
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  494  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +KVG+TGF+CRCG ++CG HRYSD+HDC +DY++AG+DAIA+ NPVVK
Sbjct  117  KKVGITGFKCRCGNIYCGAHRYSDKHDCLFDYRSAGQDAIAKANPVVK  164



>dbj|BAJ88745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 93/169 (55%), Gaps = 13/169 (8%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF             +    
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCF-------------LAGPA  47

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                  S         ++P L R     V         +       + PA+  VNRCS C
Sbjct  48   STSPSSSSSSLPGASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSC  107

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGFRCRCG++FCG HRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  108  RKRVGLTGFRCRCGDVFCGGHRYSDRHGCSYDYKAAARDAIARDNPVVR  156



>ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 ref|XP_004228359.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
Length=171

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 87/167 (52%), Gaps = 13/167 (8%)
 Frame = +2

Query  155  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH----KFGEKQ  322
            ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G   
Sbjct  5    ETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSA  64

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  496
               G     P    PD       T+      +   +    +  P  K +V  NRC  C++
Sbjct  65   SEKGMVIAGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKK  117

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NPVVK
Sbjct  118  KVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANPVVK  164



>gb|EEE60081.1| hypothetical protein OsJ_12913 [Oryza sativa Japonica Group]
Length=205

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 100/178 (56%), Gaps = 20/178 (11%)
 Frame = +2

Query  110  VVFLVLRMAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaags  283
            V  + L MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+  T  A   
Sbjct  39   VQLVFLTMAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTV  98

Query  284  ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAK  463
            ++        EK+P      LS      ++      +VA G++ +EE+        PP+ 
Sbjct  99   ATVV------EKKP---LASLSSTPLVTEVTDGGSGSVADGKQVMEED-----TPKPPS-  143

Query  464  REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
               NRC  CR+KVGLTGF+CRCG  FC  HRY+D H C++DYK  GR+ IA++NP+VK
Sbjct  144  ---NRCLSCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNPLVK  198



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 89/169 (53%), Gaps = 18/169 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            MAQ++ K E+E  V  PE   LCVNNCG  G+  TNNMC KC+                 
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKVTTMVPVV----  56

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
                  +  F   S  +T  +  + ++   A  E         ++    P K   NRC  
Sbjct  57   -----DKKVFTAASSSKTPLEPAKPDEVPAAAVED--------KQEAQEPPKPPSNRCLS  103

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            CR+KVGLTGF+CRCG  FC  HRY++ H+C++DYK AGRD IA++NPVV
Sbjct  104  CRKKVGLTGFQCRCGGTFCSTHRYTEAHNCTFDYKKAGRDQIAKQNPVV  152



>ref|NP_001288688.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1-like [Zea mays]
 gb|ACG49173.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 tpg|DAA40383.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=161

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 90/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC NNCG  GNPAT N+CQ CFSA+ + +  +S++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSASRSPSSPTSSSSSLAS  59

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
               QPR           +           A G+ T           S   KR        
Sbjct  60   AASQPRP---AALVVDAAAVEALAAPAAAAVGQATEAAARASASRCSSCRKR--------  108

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
               VGLTGFRCRCGELFCG HRYSDRH CSYDY+ A RDAIARENPVV+
Sbjct  109  ---VGLTGFRCRCGELFCGAHRYSDRHGCSYDYRGAARDAIARENPVVR  154



>gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
 gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
Length=174

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 90/169 (53%), Gaps = 12/169 (7%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF------sattaaagsssaaIHHKFG  313
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+            A SS   I +   
Sbjct  4    DETGCQASPEGPLLCVNNCGFFGSAANMNMCSKCYKDLILKQEQAKFAASSIENIVNGSS  63

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP-AKREVNRCSGC  490
               P      +  E  +      E +++     ++        +  PP AK   ++CS C
Sbjct  64   SGTPTEQDSVIVAESANIPTPSVEAKSI-----SLPSVINASTSDEPPRAKEGPSKCSSC  118

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +++VGLTGF+CRCG  FCG HRYSD+HDC +DY+ AGRDAIA+ NPVVK
Sbjct  119  KKRVGLTGFKCRCGSTFCGSHRYSDKHDCPFDYRTAGRDAIAKANPVVK  167



>ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X1 [Sesamum indicum]
 ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X2 [Sesamum indicum]
Length=160

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 91/162 (56%), Gaps = 11/162 (7%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EE  F+  PE   LCVNNCG  G+PAT NMC KC+   +    +  +          P S
Sbjct  3    EEHGFQA-PEGHRLCVNNCGFFGSPATQNMCSKCYRDLSIKKSADFSTP----STAPPPS  57

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
               +LS   +SPD       TVA     +  +++ +           NRCS CR+KVGLT
Sbjct  58   TAAQLS--LSSPDKAESSVATVAAQSPPMPVQQQAQPQPQ----PPTNRCSTCRKKVGLT  111

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GFRCRCG  FCG HRY ++H C++D+KA GR+AIA+ NPVVK
Sbjct  112  GFRCRCGITFCGSHRYPEKHGCTFDFKAMGREAIAKANPVVK  153



>gb|EYU18025.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
 gb|EYU18026.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
Length=186

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 86/176 (49%), Gaps = 14/176 (8%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH---------  304
            EET  +  PE   LC NNCG  G+ A  NMC KC+         +  A            
Sbjct  4    EETGCQTAPEGPILCANNCGFFGSAANMNMCSKCYKDQVLKQEQAKVAASSIENIVNGSS  63

Query  305  --KFGEKQPRSGFRRLSP---ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  469
                      +G  + S    E  +  +   E +T+      V           P AK  
Sbjct  64   SSSSSSSSTSTGVEKESAVIAESGNVKIDLVEVKTITAPSLNVSSTPAVVAAVEPKAKEG  123

Query  470  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
              RCS C+++VGLTGF+CRCG ++CG HRYSD+HDC +DY+ AGRDAIA+ NPVVK
Sbjct  124  PARCSSCKKRVGLTGFKCRCGNMYCGSHRYSDKHDCPFDYRTAGRDAIAKANPVVK  179



>ref|XP_009376154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379441.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379442.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 80/162 (49%), Gaps = 0/162 (0%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LC+NNCG  G+ AT NMC KC          +  A           S
Sbjct  4    EETGCQAAPEGPILCLNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
                  P   +  +  +    V +   +         +   P      RCS C ++VGLT
Sbjct  64   STNANEPVVAASPVDIQSQTVVPKTISSQPSFSFGSGSSGEPKPEGPKRCSSCNKRVGLT  123

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF CRCG LFC  HRYSD+HDC+YDY+ AGRDAIA+ NPVVK
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCAYDYRTAGRDAIAKANPVVK  165



>ref|XP_010531421.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=161

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 89/168 (53%), Gaps = 18/168 (11%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            +QK   EET  +     I LC NNCG  G P TNN+C KC+         +        G
Sbjct  5    SQKRKLEETSHESQTAPI-LCANNCGFFGGPNTNNLCSKCYREFLLNQSKAIDDNTVVVG  63

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCR  493
            +++         PE   P L  RE   +  GE           N   P     NRCS CR
Sbjct  64   KEKGIDQTTGKKPENNEP-LGYRETGRIWEGE-----------NSEKP-----NRCSLCR  106

Query  494  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            ++VGLTGF+CRCG  FC +HRYSD+H+C +DYK+AG+DAIA+ NPVVK
Sbjct  107  KRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKSAGQDAIAKANPVVK  154



>gb|ACL01101.1| zinc finger protein [Phyllostachys edulis]
Length=164

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 99/180 (55%), Gaps = 34/180 (19%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF A +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  311  GE-----------KQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP  457
                          +PR     L+    SP + R     V  G                 
Sbjct  60   SSSSSLPGLSPVVDKPRPAPMELA----SPAVDRAPAVEVKAG-----------------  98

Query  458  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             K  VNRCS CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  99   -KTSVNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAARDAIARDNPVVR  157



>ref|XP_004249448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum lycopersicum]
Length=159

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 92/171 (54%), Gaps = 21/171 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  311  GEKQPRSGFRRLS--PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
            G+++P       S  P  ++  +   ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+KVGLTGF+CRCG  FCG HRY + H CS+D+K+ GR+AIA+ NPVVK
Sbjct  102  ACRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANPVVK  152



>gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 84/149 (56%), Gaps = 33/149 (22%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  370
             CVNNCG  GN  TNN+C KC+                KF  KQP+    +   E T   
Sbjct  11   YCVNNCGFFGNAKTNNLCSKCY---------------KKFLLKQPQ----QTQIESTIA-  50

Query  371  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  550
                    VA GE+T        ENR P A    NRCS CR++VGLTGF CRCG+ FC  
Sbjct  51   -------PVAGGEQT---GANSSENRPPAA---ANRCSFCRKRVGLTGFNCRCGQTFCSL  97

Query  551  HRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            HRYSD+H+C +DYK+AG+DAIA+ NP+VK
Sbjct  98   HRYSDKHNCVFDYKSAGQDAIAKANPIVK  126



>gb|EMS48100.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Triticum urartu]
Length=327

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 88/168 (52%), Gaps = 17/168 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ++ KE  E    PE   LCVNNCG  G+  TNNMC KC+     A   ++  +    
Sbjct  169  MAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMAAPVVE---  225

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                 +      S   T    K  E   VA  +    +E         P K   NRC  C
Sbjct  226  -----KVFSVASSSSVTLEQAKADEVPAVAVADSQAAQE---------PPKPPSNRCLSC  271

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            R+KVGLTGF+CRCG  FC  HRY+D H+C++DYK AGR+ IA++NPVV
Sbjct  272  RKKVGLTGFQCRCGGTFCSMHRYADSHECTFDYKKAGREQIAKQNPVV  319



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 87/160 (54%), Gaps = 24/160 (15%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKC----FsattaaagsssaaIHHKFGEKQPRS-GF  337
             P    LC NNCG  G+PATNN+C KC    F   + A  + +     K GE    + G 
Sbjct  17   TPNVPILCANNCGFFGSPATNNLCSKCYRDFFLKQSKAVAALTVVAEKKVGESIVETKGQ  76

Query  338  RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  517
              + PE  +  +   E+ T +                  P K   NRCS C+++VGLTGF
Sbjct  77   SGVGPEAKATLV---EEGTTS----------------GDPGKLPANRCSFCKKRVGLTGF  117

Query  518  RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +CRCG+ FC  HRYSD+H+C +DYK AG+DAIA+ NPVVK
Sbjct  118  KCRCGQTFCSLHRYSDKHNCLFDYKTAGQDAIAKANPVVK  157



>gb|ABK21092.1| unknown [Picea sitchensis]
 gb|ABR17716.1| unknown [Picea sitchensis]
Length=181

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCF---sattaaagsssaaIHHKFGEKQPRSGFRR  343
             PE  TLC NNCG  G+ AT N+C KC+       A A S+ AA+   F    P      
Sbjct  17   APEGHTLCANNCGFFGSSATRNLCSKCYRDLIMKEAQATSAMAAVEKSFAAGSPMDEVPL  76

Query  344  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP-PAKREVNRCSGCRRKVGLTGFR  520
             SP+      + +    VA G  +V+  +    + SP P     NRC  CR++VGLTGF+
Sbjct  77   SSPDAIVQQNRVQISAAVA-GVSSVQLADSGSSSSSPQPPAETPNRCFSCRKRVGLTGFK  135

Query  521  CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRC   FCG HRY+++H CS+D+KAAGR+AIA+ NPVVK
Sbjct  136  CRCENTFCGLHRYAEKHSCSFDFKAAGREAIAKANPVVK  174



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 83/166 (50%), Gaps = 26/166 (16%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             P+   LCVNNCG  G  AT NMC KC+                    KQ ++ F   S 
Sbjct  10   APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  54

Query  353  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSP-------PAKREVNRCSGCRRK  499
            E     +S    +  D  V   E   E      +  +P        AK   NRCS CRR+
Sbjct  55   ESFVNGSSSASVKAVDVAVTVQEGPAESLVIPTQVAAPVESVQVEKAKEGPNRCSTCRRR  114

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VGLTGF CRCG LFC  HRYSD+H+C YDY  AG+DAIA+ NPVVK
Sbjct  115  VGLTGFNCRCGNLFCSAHRYSDKHECPYDYHKAGQDAIAKANPVVK  160



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 84/166 (51%), Gaps = 26/166 (16%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             P+   LCVNNCG  G  AT NMC KC+                    KQ ++ F   S 
Sbjct  4    APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  48

Query  353  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRK  499
            E     +S    +  D  V   E   E      +  +P    +V       NRCS CRR+
Sbjct  49   ESFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAAPVESEQVEKAKEGPNRCSTCRRR  108

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VGLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NPVVK
Sbjct  109  VGLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANPVVK  154



>gb|EMT32776.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Aegilops tauschii]
Length=394

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 92/176 (52%), Gaps = 16/176 (9%)
 Frame = +2

Query  107  LVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagss  286
            +++  +  MAQ++ KE  E    PE   LCVNNCG  G+  TNNMC KC+     A   +
Sbjct  227  VLIGPLAAMAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMA  286

Query  287  saaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  466
            +  +  K       S         T    K  E   VA  +    +E         P K 
Sbjct  287  APVVEKKVFSVASSS-------SVTLEQAKADEVPAVAVADSQAAQE---------PPKP  330

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
              NRC  CR+KVGLTGF+CRCG  FC  HRY+D H+C++DYK AGR+ IA++NPVV
Sbjct  331  PSNRCLSCRKKVGLTGFQCRCGGTFCSMHRYADSHECTFDYKKAGREQIAKQNPVV  386



>gb|ADF80943.1| zinc finger protein [Phyllostachys vivax]
Length=163

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 98/171 (57%), Gaps = 17/171 (10%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF A +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  311  GEKQPRSGFRRLSPERTSP-DLKRRE-DRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
                       +   R +P +L     DR  A   K                K  VNRCS
Sbjct  60   SSSSLPGLSPVVDKPRPAPVELASPAVDRVPAVEVKA--------------GKTSVNRCS  105

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+++GLTGFRCRCGELFCGEHRYSDRH CSYDYKAA RDAIAR+NPVV+
Sbjct  106  SCRKRLGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAARDAIARDNPVVR  156



>ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 ref|XP_010031825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 gb|KCW51205.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51206.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51207.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51208.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51209.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
Length=171

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 86/167 (51%), Gaps = 11/167 (7%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LC+NNCG  G+PAT NMC KC          +  A       +   S
Sbjct  4    DETGCQAPPEGPILCINNCGFFGSPATMNMCSKCHKDMLLKQEQAKLAASSIAAAENGSS  63

Query  332  GFRRLSP---ERTSPDLKRREDRTVARGEK--TVeeeeeeeeNRSPPAKREVNRCSGCRR  496
                  P         L   E +T+ +     +V     E+    P       RCS C +
Sbjct  64   STTASEPVFAASVDTQLNTVEPKTIPKQPACDSVTVATVEKPKEGP------TRCSSCNK  117

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF CRCG +FCG HRYSD+HDC +DY++AGR+AIA+ NPV+K
Sbjct  118  RVGLTGFSCRCGNIFCGTHRYSDKHDCPFDYRSAGRNAIAKANPVIK  164



>ref|XP_009376157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376158.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376159.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376160.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379443.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379444.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379445.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379446.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=169

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 87/164 (53%), Gaps = 7/164 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LCVNNCG  G+ AT NMC KC          +  A    FG    R+
Sbjct  4    EETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQAKLAAS-SFGSIVNRT  62

Query  332  GFRRLSPERTSPDLKRR--EDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  505
                 +    S D++    E +T++    +         +   P   +  RC+ C ++VG
Sbjct  63   SSINANEHVASVDVQPHPMEPKTLS----SQPSFSFGSGSSGEPKPEDPKRCNTCNKRVG  118

Query  506  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LTGF CRCG LFC  HRYSD+HDCSYDY  AG+DAIA+ NPVVK
Sbjct  119  LTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVK  162



>ref|XP_006660763.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Oryza brachyantha]
Length=166

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 94/174 (54%), Gaps = 20/174 (11%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF                  
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFL--------------AAS  45

Query  311  GEKQPRSGFRRLSP-----ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
                  +    LSP      R +  L   +    A   + +       E ++P     VN
Sbjct  46   ASTSSPASLPGLSPVLDKAARPATSLVEAQAAPAAAPVEELASPAPALEVKAPAKTSAVN  105

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCS CR++VGLTGFRCRCG LFCGEHRYSDRH C YDYKAA RDAIAR+NPVV+
Sbjct  106  RCSRCRKRVGLTGFRCRCGYLFCGEHRYSDRHGCGYDYKAAARDAIARDNPVVR  159



>ref|XP_003540534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=135

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = +2

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            KR V+RCS CRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENPVVK
Sbjct  70   KRVVSRCSCCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENPVVK  128



>gb|ACJ83925.1| unknown [Medicago truncatula]
 gb|AFK35119.1| unknown [Medicago truncatula]
 gb|AFK43343.1| unknown [Medicago truncatula]
 gb|AES67697.2| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=172

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            ++T  +  PE   LC+NNCG  G+ AT NMC KC          A  ++++I +      
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              SG            +   E + ++  E  V    EE   + P  K    RCS C ++V
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIIS-AEPLVASGSEESLEKKP--KDGPKRCSNCNKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG L+C  HRYSD+HDC +DY+ AGRDAIA+ NPVVK
Sbjct  121  GLTGFNCRCGNLYCAVHRYSDKHDCPFDYRTAGRDAIAKANPVVK  165



>gb|ACM68453.1| stress-associated protein 3 [Solanum pennellii]
Length=171

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 86/167 (51%), Gaps = 13/167 (8%)
 Frame = +2

Query  155  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH----KFGEKQ  322
            ET  + + E   LC+NNCG  G+ A  NMC KC+         +   +        G   
Sbjct  5    ETGCQPLREGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLDVSSIENLVNGSSA  64

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  496
               G     P    PD       T+      +   +    +  P  K +V  NRC  C++
Sbjct  65   SEKGMVIAGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKK  117

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NPVVK
Sbjct  118  KVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANPVVK  164



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 83/166 (50%), Gaps = 26/166 (16%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             P+   LCVNNCG  G  AT NMC KC+                    KQ ++ F   S 
Sbjct  10   APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  54

Query  353  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRK  499
            E     +S    +  D  V   E   E      +   P    +V       NRCS CRR+
Sbjct  55   ESFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRR  114

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VGLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NPVVK
Sbjct  115  VGLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANPVVK  160



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 83/165 (50%), Gaps = 26/165 (16%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            P+   LCVNNCG  G  AT NMC KC+                    KQ ++ F   S E
Sbjct  5    PQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSIE  49

Query  356  R----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRKV  502
                 +S    +  D  V   E   E      +   P    +V       NRCS CRR+V
Sbjct  50   SFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRV  109

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NPVVK
Sbjct  110  GLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANPVVK  154



>gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=177

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 84/154 (55%), Gaps = 3/154 (2%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LCVNNCG  G  AT NMC KC+  T         A           S  + ++  
Sbjct  20   PELPILCVNNCGFFGRAATMNMCSKCYKDTQLMQEQEKLAAASVENLVSGGSMKQVVTDG  79

Query  356  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
              +  ++  E +TV+     +  +    EN     K   +RC+ CR++VGLTGF C+CG 
Sbjct  80   AVNVQIENVEVKTVS---AEISGDSSSSENLETKVKTGPSRCATCRKRVGLTGFTCKCGN  136

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LFC  HRYSD+HDC +DY++ GRDAIA+ NPV+K
Sbjct  137  LFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIK  170



>gb|KEH16279.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=169

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 84/154 (55%), Gaps = 3/154 (2%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LCVNNCG  G  AT NMC KC+  T         A           S  + ++  
Sbjct  12   PELPILCVNNCGFFGRAATMNMCSKCYKDTQLMQEQEKLAAASVENLVSGGSMKQVVTDG  71

Query  356  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
              +  ++  E +TV+     +  +    EN     K   +RC+ CR++VGLTGF C+CG 
Sbjct  72   AVNVQIENVEVKTVS---AEISGDSSSSENLETKVKTGPSRCATCRKRVGLTGFTCKCGN  128

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LFC  HRYSD+HDC +DY++ GRDAIA+ NPV+K
Sbjct  129  LFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIK  162



>ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 88/168 (52%), Gaps = 12/168 (7%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T             K       +
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDTILKQE------QAKLAATSIEN  57

Query  332  GFRRLSPERTSPDLKRREDRTVARGE-KTVeeeeeeeeNRSPPA-----KREVNRCSGCR  493
                 +     P +    D   A  E K+V        + +  A     K   +RCS C+
Sbjct  58   LVNGSNASEKGPVVVDSVDMQPAVLETKSVVALSSPPSSSAGEAAELKTKVGPSRCSSCK  117

Query  494  RKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +KVGLTGF+CRCG L+CG HRYSD+HDC +DY++AGRDAIA+ NPVVK
Sbjct  118  KKVGLTGFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANPVVK  165



>ref|XP_002285530.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_002285528.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
Length=172

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+PAT NMC KC          A  ++++I        
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMMLKQEQAKLAASSIDSIVNGSS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              +G            +  +E + ++         E   E +    K   NRCS C+++V
Sbjct  64   SNNGKEPAIASTVDVQVDAKEPKIISVQSSFSFGSEGSGEAKP---KEGPNRCSTCKKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  121  GLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANPVVK  165



>ref|XP_008795703.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795704.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  343
             PE   LC+NNCG  G+ AT NMC KC          A  +S++I+         SG   
Sbjct  10   TPEAPILCINNCGFFGSAATMNMCSKCHKDLILKQEQAKLASSSINGIVNGSGSSSGKEP  69

Query  344  LSPERTSPDLKRREDRTVAR--GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  517
            +  E  +  +   E +T++    + TV  E  E + +  P     NRCS CR++VGLTGF
Sbjct  70   IVSENANVAVGPVEPKTISAHLSDSTVISEGGETKVKVGP-----NRCSTCRKRVGLTGF  124

Query  518  RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRCG LFC  HRYS+ H+C +DY+ AGRDAIA+ NPV+K
Sbjct  125  NCRCGNLFCATHRYSEEHNCPFDYRTAGRDAIAKANPVIK  164



>gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum]
Length=171

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = +2

Query  179  ETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH----KFGEKQPRSGFRRL  346
            E   LC+NNCG  G+ A  NMC KC+         +  A+        G      G    
Sbjct  13   EGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSASEKGMVIA  72

Query  347  SPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRRKVGLTGFR  520
             P    PD       T+      +   +    +  P  K +V  NRC  C++KVG+TGF+
Sbjct  73   GPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKKKVGITGFK  125

Query  521  CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NPVVK
Sbjct  126  CRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANPVVK  164



>ref|XP_010555326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
 ref|XP_010555327.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=162

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 21/170 (12%)
 Frame = +2

Query  134  AQKTGKEET--EFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHK  307
            +QK   EET  E +  P   T+C NNCG  G P T+N+C KC+         + A     
Sbjct  5    SQKRKLEETSHEPQAAP---TICANNCGFFGCPNTSNLCSKCYRDFLLKQSKTIAKNTVA  61

Query  308  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
             G+++   G  + + +   P+    +   +  GE +V           PP   + NRCS 
Sbjct  62   VGKEK---GIEQTTEK---PENNESQPGKIWDGENSVR----------PPPPLKSNRCSS  105

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGF+CRCG  FC +HRYSD+H+C +DYK  G+DAIA+ NPVVK
Sbjct  106  CRKRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKTVGQDAIAKANPVVK  155



>ref|XP_008461274.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis melo]
Length=172

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNASSTVEK---VKESPNRCSSCRKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NPVVK
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANPVVK  165



>ref|NP_001051527.1| Os03g0792900 [Oryza sativa Japonica Group]
 sp|Q852K5.1|SAP6_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 6; Short=OsSAP6 [Oryza sativa Japonica 
Group]
 gb|AAO37974.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAQ83587.1| putative zinc finger transcription factor ZFP38 [Oryza sativa 
Japonica Group]
 gb|ABF99304.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99305.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99306.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13441.1| Os03g0792900 [Oryza sativa Japonica Group]
 gb|AEP20529.1| zinc finger protein [Oryza sativa Japonica Group]
Length=160

 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 97/171 (57%), Gaps = 20/171 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+  T  A   ++     
Sbjct  1    MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTVATVV---  57

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
               EK+P      LS      ++      +VA G++ +EE+        PP+    NRC 
Sbjct  58   ---EKKP---LASLSSTPLVTEVTDGGSGSVADGKQVMEED-----TPKPPS----NRCL  102

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+KVGLTGF+CRCG  FC  HRY+D H C++DYK  GR+ IA++NP+VK
Sbjct  103  SCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNPLVK  153



>ref|XP_004951572.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Setaria italica]
 ref|XP_004951573.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Setaria italica]
Length=171

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 81/154 (53%), Gaps = 0/154 (0%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC          +  A            G +  +  
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAQLAASSIDSIVNGGDGVKGPAIA  70

Query  356  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
             T+  +  + +      +  V  E  E     P AK   NRC+ CR++VGLTGF CRCG 
Sbjct  71   ATAEVVFAQVEEKAIFVQPPVVAETSEAAAVIPKAKEGPNRCATCRKRVGLTGFNCRCGN  130

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            ++C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  131  MYCAVHRYSDKHDCHFDYRTAARDAIAKANPVVK  164



>gb|EPS60935.1| induced stolon tip protein [Genlisea aurea]
Length=156

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 96/174 (55%), Gaps = 30/174 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQKT  +E EFKV PETI+LCV+          + +C KC  +           ++H F
Sbjct  1    MAQKTKNDEPEFKVTPETISLCVDC-------VDSCLCHKCIISAATP-------VNHLF  46

Query  311  GEKQPRSGFRRLSP-----ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
             +++ RS     +P     E    DLK                          P +R VN
Sbjct  47   TDEESRSISSPPAPSSIIPETRGDDLKHSGAGETEAEAAAAR-----------PLERSVN  95

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDC YDY+AA R AIARENPVVK
Sbjct  96   RCSGCRKKVGLTGFRCRCGELFCAEHRYSDRHDCRYDYRAAARAAIARENPVVK  149



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 89/177 (50%), Gaps = 30/177 (17%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T                 KQ ++
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDTIL---------------KQEQA  48

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP---------------PAKR  466
                 S E         E   V  G   V+    E ++                   AK 
Sbjct  49   KLAATSIENLVNGSIASEKGPVVVGSVDVQPAMLETKSVVVLSSPPSSSAGEAAELKAKV  108

Query  467  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
              +RCS C++KVGLTGF+CRCG L+CG HRYSD+HDC +DY++AGRDAIA+ NPVVK
Sbjct  109  GPSRCSSCKKKVGLTGFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANPVVK  165



>ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum tuberosum]
Length=159

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 90/172 (52%), Gaps = 23/172 (13%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  311  GEKQPRSGF---RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
            G+++P       +   P ++S  L   E   V   E+  E           P   + NRC
Sbjct  44   GQQKPIDSLFPPQLPIPSQSSSVLVLPEPAAV---EEKPEVVIAAVTAAVQPMPAQSNRC  100

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            S CR+KVGL GF+CRCG  FCG HRY + H CS+D+K+ GR+AIA+ NPVVK
Sbjct  101  SACRKKVGLIGFKCRCGTTFCGTHRYPEIHGCSFDFKSMGREAIAKANPVVK  152



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 87/172 (51%), Gaps = 20/172 (12%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+             I  +   K   S
Sbjct  4    DETGCQPPPEGPILCVNNCGFFGSAANMNMCSKCYKDL----------ILKQEQAKLAAS  53

Query  332  GFRRLSPERTSPDLKR---------REDRTVARGEKTVeeeeeeeeNRSPPAKRE-VNRC  481
                +    +S + +          + D   A+               + P  +E  NRC
Sbjct  54   SIENIVNGSSSGNEQESVVADAAIMQTDLVEAKAISLPSINTSSFAEAAEPKTKEGPNRC  113

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            S C+++VGLTGF+CRCG LFCG HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  114  STCKKRVGLTGFKCRCGYLFCGSHRYSDKHDCPFDYRTAARDAIAKANPVVK  165



>ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=151

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 99/171 (58%), Gaps = 29/171 (17%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  KEETE K VP++I L   N  V+  P  +N  QK  S +T++  +   +     
Sbjct  1    MAQKREKEETELK-VPQSIPL--PNLPVSSQPHADN--QKPTSPSTSSVRTPEISDLKLS  55

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS--  484
            G    RS    +SPE++  +  R   R+V R                    RE NRCS  
Sbjct  56   GSDDSRSSSGAISPEKSDLEEIR---RSVKR-------------------PREANRCSGI  93

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GCRRKVGL GFRCRCG++FC EHRYSDRH CSYDYKA GR+AIARENPVV+
Sbjct  94   GCRRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENPVVR  144



>ref|XP_006487967.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Citrus sinensis]
Length=156

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 83/149 (56%), Gaps = 11/149 (7%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  370
            LCVNNCG  G+P T N+C KCF      A  SS+A H             +     +S D
Sbjct  12   LCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKH----------ALNQTLISSSSVD  61

Query  371  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  550
            L  RE R     E   E E+   E  +P      NRC  CRR+VGLTGF+CRCG +FCG 
Sbjct  62   LSLRE-RPATDVEVAAEAEKPPAEVAAPVQSTAANRCMTCRRRVGLTGFKCRCGSVFCGT  120

Query  551  HRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            HRY ++H CS+D+K  G++ IAR NPVVK
Sbjct  121  HRYPEQHACSFDFKEMGKEQIARANPVVK  149



>ref|XP_008384532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384535.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=169

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 84/164 (51%), Gaps = 7/164 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LCVNNCG  G+ AT NMC KC             A    FG    R+
Sbjct  4    EETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQXKLAAS-SFGSIVNRT  62

Query  332  GFRRLSPERTSPDLKRR--EDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  505
                 +    S D++    E +T++             E    P      RC+ C ++VG
Sbjct  63   SSINANEPVASVDVQPHPMEPKTLSSQPSFSFGSGSSGE----PKPEGPKRCNTCNKRVG  118

Query  506  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LTGF CRCG LFC  HRYSD+HDCSYDY  AG+DAIA+ NPVVK
Sbjct  119  LTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANPVVK  162



>ref|XP_004135920.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 1 [Cucumis sativus]
 ref|XP_004135921.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 2 [Cucumis sativus]
 gb|KGN45145.1| hypothetical protein Csa_7G428820 [Cucumis sativus]
Length=172

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNARSIVEK---VKESPNRCSSCRKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NPVVK
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANPVVK  165



>ref|XP_004158200.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 1 [Cucumis sativus]
 ref|XP_004158201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 2 [Cucumis sativus]
 ref|XP_004158202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 3 [Cucumis sativus]
 ref|XP_004158203.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 4 [Cucumis sativus]
Length=172

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 87/165 (53%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNVRSIVEK---VKESPNRCSSCRKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NPVVK
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANPVVK  165



>ref|XP_010279014.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=172

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 82/170 (48%), Gaps = 31/170 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LCVNNCG  G+ AT NMC KC               H     KQ ++     S E
Sbjct  11   PEGPILCVNNCGFFGSAATMNMCSKC---------------HKDLVLKQEQAKLAASSIE  55

Query  356  RT-----------SPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA-----KREVNRCSG  487
                          P +    D ++   E  +   +    + S        K   NRCS 
Sbjct  56   NIVNGSSSSSNGKEPVVAGSVDVSIGSVEPKLISTQVSSASASSEGVEVKVKEGPNRCSS  115

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGF CRCG +FC  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  116  CRKRVGLTGFNCRCGNIFCAVHRYSDKHDCPFDYRTAARDAIAKANPVVK  165



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 87/169 (51%), Gaps = 30/169 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID  55

Query  356  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  490
                       P +    +  VA+ E KT+  +  E    S      P  +   NRCS C
Sbjct  56   SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC  115

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  116  RKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVK  164



>ref|XP_009419155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419156.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=175

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 81/160 (51%), Gaps = 6/160 (4%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G+ AT NMC KC          +  A           SG    S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKCHREMILKQEQAKLAAS-SIDNLVNGSGGDICSS  68

Query  353  ERTSPDLKRREDRTVARGEKTVeeeee-----eeeNRSPPAKREVNRCSGCRRKVGLTGF  517
                P +    D T+  GE      +         +    AK   NRCS CR++VGLTGF
Sbjct  69   NGKEPVISAVTDVTIVSGELKAIPSQSPEVLCSSGSGEAKAKNGPNRCSTCRKRVGLTGF  128

Query  518  RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +CRCG+LFC  HRYSD+H C +DY+ A RDAIA+ NPVVK
Sbjct  129  QCRCGDLFCTTHRYSDKHGCPFDYQRAARDAIAKANPVVK  168



>ref|XP_008786424.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 85/170 (50%), Gaps = 30/170 (18%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LCVNNCG  G+PAT NMC KC               H     KQ ++     S 
Sbjct  10   TPEAPILCVNNCGFFGSPATMNMCSKC---------------HKDLLLKQEQAKLVASSV  54

Query  353  ERT----------SPDLKRREDRTVARGE-KTVeeeeeeeeNRSPPAKREV----NRCSG  487
            + T           P +    D  V   E KT           S   + +V    NRC+ 
Sbjct  55   DSTVSGSGSSSGKEPVVSWSVDFAVGPTEPKTTLAYPSNASAISKGGETKVKDGPNRCNT  114

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGF CRCG LFC  HRYSD H+C +DY++AGRDAI++ NPVVK
Sbjct  115  CRKRVGLTGFTCRCGNLFCAMHRYSDEHNCPFDYRSAGRDAISKANPVVK  164



>ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=159

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 86/170 (51%), Gaps = 22/170 (13%)
 Frame = +2

Query  134  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFG  313
            AQK  KEETE KV PE+I LC     V                            H    
Sbjct  3    AQKREKEETELKV-PESIPLCSPTLPVPSPSPPPTT-------------------HLSVA  42

Query  314  EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG--  487
                     R S ER    +   +D++ +    + E  +          +RE NRCSG  
Sbjct  43   LISDLKRSDRSSTERVDLKVSSMDDQSRSTSAASPESTDLVGRKTGVKRQREANRCSGIG  102

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENPVVK
Sbjct  103  CRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENPVVK  152



>ref|XP_002975420.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
 gb|EFJ23621.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
Length=175

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 92/171 (54%), Gaps = 5/171 (3%)
 Frame = +2

Query  131  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ++ K E E     +PE   LC NNCG  G+ AT N+C KC+   +++  ++   I  
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAAETMITT  60

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
                    +          +    R            V E++       P   R  NRC 
Sbjct  61   TTTAAAAAATPAAKEEALAAIATSRTSTTIATAATTLVTEDDSSASQEKP---RLSNRCL  117

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CR+++GLTGF+CRCG++FC  HRYSD+H+CS+DYKAAGR+AIA+ NPVVK
Sbjct  118  ACRKRLGLTGFKCRCGDVFCSMHRYSDKHNCSFDYKAAGREAIAKANPVVK  168



>ref|XP_009374543.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374550.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374557.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 78/162 (48%), Gaps = 0/162 (0%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LCVNNCG  G+ AT NMC KC          +  A           S
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
                  P   +  +  +      +   +         +   P      RC+ C ++VGLT
Sbjct  64   SISANEPVVAAATVDVQPHPVEPKTLSSQPSFSFGSGSSGEPKPEGPKRCNTCNKRVGLT  123

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF CRCG LFC  HRYSD+HDC YDY+ AGRDAIA+ NPVVK
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCPYDYRTAGRDAIAKANPVVK  165



>ref|XP_006650711.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Oryza brachyantha]
Length=160

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 100/174 (57%), Gaps = 26/174 (15%)
 Frame = +2

Query  131  MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+  T  A   +S     
Sbjct  1    MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKARTVASVV---  57

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDR---TVARGEKTVeeeeeeeeNRSPPAKREVN  475
               EK      + L    ++P +    D    +VA G++ VE++  +     PP+    N
Sbjct  58   ---EK------KSLVSLSSTPLVSEDTDGGSGSVAAGKQVVEDDTPK-----PPS----N  99

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RC  C++KVGLTGF+CRCG  FC  HRY+D H C++DYK AGR+ IA++NP+VK
Sbjct  100  RCLSCQKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQAGREQIAKQNPIVK  153



>gb|EYU31356.1| hypothetical protein MIMGU_mgv1a014938mg [Erythranthe guttata]
Length=173

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 83/172 (48%), Gaps = 32/172 (19%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPR-----SGF  337
             P+   LCVNNCG  G PAT NMC KC+                    KQ R     S F
Sbjct  10   TPQATILCVNNCGFFGTPATLNMCSKCYKDVVL---------------KQERAEFAASSF  54

Query  338  RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNR----SPPA--------KREVNRC  481
            + +    +    K  +  T    E      +  E +R      PA        K+   RC
Sbjct  55   QSIINGSSKNGAKVSDAATAVIAEANAISSDSMEASRRTSSESPAIGGSDEANKQGPKRC  114

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
              C ++VGLTGF CRCG +FCG HRYSD+HDC +DY AAG+ AIA+ NPVVK
Sbjct  115  GACNKRVGLTGFNCRCGSMFCGVHRYSDKHDCPFDYHAAGQQAIAKANPVVK  166



>ref|XP_009596933.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=142

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 86/171 (50%), Gaps = 38/171 (22%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  KEETE KV PETI L       T +P   +  +                    F
Sbjct  1    MAQKREKEETELKV-PETIPLRTPTITGTDDPTHASDPK-----------------LPNF  42

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG-  487
               +PRS           P  +    R++ R                   + E NRCSG 
Sbjct  43   NGSRPRSDLVSQPQPEKKPAGEDNNRRSMKR------------------LREEANRCSGI  84

Query  488  -CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRRKVGL GFRCRCGE+FC EHRYSDRH CSYDYKAAGR+AIARENPVV+
Sbjct  85   GCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENPVVR  135



>ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 87/159 (55%), Gaps = 8/159 (5%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  343
             PE   LCVNNCG  G+ AT NMC KC          A  ++ +I +        +    
Sbjct  11   APEGPILCVNNCGFFGSAATMNMCSKCHKDMILKQQQAKLAATSIENIVNGSSSSNQKEP  70

Query  344  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-NRCSGCRRKVGLTGFR  520
            +  E    +    E +T A  + +    +      S P  +EV NRC+ CR++VGLTGF 
Sbjct  71   VLAEAVKVEAGSVELKTDALQQSS----DLLSVPSSEPKPKEVPNRCTTCRKRVGLTGFN  126

Query  521  CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            C+CG LFC  HRYSD+H+C +DY+ AGRDAIA+ NP+VK
Sbjct  127  CKCGNLFCSVHRYSDKHECPFDYRTAGRDAIAKANPLVK  165



>ref|XP_010928496.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
 ref|XP_010928497.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
Length=171

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 88/160 (55%), Gaps = 10/160 (6%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  343
             PE   LC+NNCG  G+ AT NMC KC          A  +S++I+         SG   
Sbjct  10   TPEAPILCINNCGFFGSAATMNMCSKCHQDLILKQEQAKLASSSINDIVNGSGSSSGEEP  69

Query  344  LSPERTSPDLKRREDRTVAR--GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  517
            +        +   E +T++    + TV  E  E + +  P     NRCS CR++VGLTGF
Sbjct  70   IVSGNADVAVGPVEPKTISAHLSDSTVISEGGETKVKVGP-----NRCSTCRKRVGLTGF  124

Query  518  RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRCG LFC  HRYS+ H+C +DY+ AGRDAIA+ NPV+K
Sbjct  125  NCRCGNLFCATHRYSEEHNCPFDYRTAGRDAIAKANPVIK  164



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 90/169 (53%), Gaps = 35/169 (21%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            M QK+ + E    +      LC NNCG  G+ ATNN+C KC+                +F
Sbjct  1    MEQKSQENEVNAAI------LCANNCGFFGSAATNNLCSKCY---------------KEF  39

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
              KQ +              +   E+ TV  GE +    EE     SP  K   NRCS C
Sbjct  40   VIKQSKEA-----------SVVENENNTV--GENSGSGIEEGAAAGSPE-KCPANRCSFC  85

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF+CRCG+ FC  HRYSD+H+C +DYK+A +DAIA+ NPVVK
Sbjct  86   RKRVGLTGFKCRCGQTFCSMHRYSDKHNCVFDYKSAAQDAIAKANPVVK  134



>emb|CDP20562.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 103/174 (59%), Gaps = 32/174 (18%)
 Frame = +2

Query  137  QKTGKEETEFKVVPETITLCVNNCGV----TGNPATNNMCQKCFsattaaagsssaaIHH  304
            QK  KEETE KV PE++TLC     V      +P +N+       A +  +      ++ 
Sbjct  4    QKREKEETELKV-PESLTLCTPTIPVPPPQLDDPRSNS-------ARSPESSDPKLLVN-  54

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE-VNRC  481
              G+   RS    LSPER+  DL       ++ G     + +  E NRS    R+ VNRC
Sbjct  55   --GDDNLRSSP--LSPERS--DL-------ISVG---AVDGKGVELNRSLKRPRDAVNRC  98

Query  482  S--GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            S  GCRRK+GL GFRCRCG++FC EHRYSDRHDCSYDYK AGR+AIARENPVVK
Sbjct  99   SCTGCRRKLGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKTAGREAIARENPVVK  152



>ref|XP_004252868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum lycopersicum]
Length=160

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 2/61 (3%)
 Frame = +2

Query  461  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENPVV
Sbjct  93   QREANRCSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV  152

Query  635  K  637
            K
Sbjct  153  K  153



>gb|ABI31653.1| zinc finger protein [Camellia sinensis]
Length=173

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 88/173 (51%), Gaps = 19/173 (11%)
 Frame = +2

Query  149  KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGE----  316
            + ET  +V P+   LCVNNCG  G+ AT N C KC          +  A     G     
Sbjct  3    QNETGCQVPPDAPMLCVNNCGFFGSAATMNPCSKCHKDLMLKQQQTELAAS-SIGSIANG  61

Query  317  ------KQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  478
                  K+P S    +  +  S D       ++    +++  E        PP     NR
Sbjct  62   GSGSPGKEPDSAITTVHVDAGSSD---SMIVSMQASHESLLNENNVIVKEVPP-----NR  113

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CS CR++VGLTGF CRCG LFC  HRYSD+HDC +DY++A +DAIA+ NPVVK
Sbjct  114  CSACRKRVGLTGFNCRCGNLFCAVHRYSDKHDCPFDYRSAAQDAIAKANPVVK  166



>gb|ACM68460.1| stress-associated protein 10 [Solanum pennellii]
Length=160

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 2/61 (3%)
 Frame = +2

Query  461  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENPVV
Sbjct  93   QREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV  152

Query  635  K  637
            K
Sbjct  153  K  153



>dbj|BAO74165.1| zinc finger protein [Cucurbita pepo subsp. ovifera]
Length=176

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 87/167 (52%), Gaps = 7/167 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT N+C KC   F         ++++I        
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDFIMKQEQVKLAASSIGSIVNGGP  64

Query  323  PRSGFRRLSPERTSPDLKRRED--RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
               G  + +   TSP     E    ++   + +               K   NRCS CR+
Sbjct  65   NDHG--KKAAVVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRK  122

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NPVVK
Sbjct  123  RVGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANPVVK  169



>gb|ACG26325.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG28071.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
Length=171

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 86/169 (51%), Gaps = 30/169 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQEQAQLAASSID  55

Query  356  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  490
                       P +    +  V + E KT+  +       S      P AK   +RC+ C
Sbjct  56   SIVNGGDGGKGPVIAASVNAAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAAC  115

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NPVV+
Sbjct  116  RKRVGLTGFSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANPVVR  164



>ref|XP_003597446.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
Length=157

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 82/152 (54%), Gaps = 6/152 (4%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRRLSPERT  361
            LC+NNCG  G+ AT NMC KC          A  ++++I +        SG         
Sbjct  2    LCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSSSSSGIEPAITANV  61

Query  362  SPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF  541
               +   E + ++  E  V    EE   + P  K    RCS C ++VGLTGF CRCG L+
Sbjct  62   EISVDPVEPKIIS-AEPLVASGSEESLEKKP--KDGPKRCSNCNKRVGLTGFNCRCGNLY  118

Query  542  CGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            C  HRYSD+HDC +DY+ AGRDAIA+ NPVVK
Sbjct  119  CAVHRYSDKHDCPFDYRTAGRDAIAKANPVVK  150



>ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nicotiana sylvestris]
Length=226

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +2

Query  464  REVNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RE NRC   GCRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGRDAIARENPVVK
Sbjct  160  REANRCCGIGCRRKVGLLPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGRDAIARENPVVK  219



>ref|XP_002304765.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE79744.2| zinc finger family protein [Populus trichocarpa]
Length=178

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 91/173 (53%), Gaps = 4/173 (2%)
 Frame = +2

Query  125  LRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            ++  QK  ++ET  +  PE   LC+NNCG  G+ AT NMC KC          +  A   
Sbjct  1    MQEKQKMDRDETGCQAPPERPILCINNCGFFGSAATMNMCSKCHKDMLLKQEQTKLAASS  60

Query  305  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE--VNR  478
              G     S    ++ E    D    +   V     TV+            AK +   +R
Sbjct  61   -IGSIVNGSASSNVN-EPVIADTINVQINAVEPKTITVQPSCASVSGERVEAKPKEGPSR  118

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            C+ C+++VGLTGF+CRCG+LFC  HRYSD+HDC +DY+ A R+AIA+ NPVVK
Sbjct  119  CTSCKKRVGLTGFKCRCGDLFCASHRYSDKHDCPFDYRTAAREAIAKANPVVK  171



>gb|ACM68446.1| stress-associated protein 9 [Solanum lycopersicum]
Length=149

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 89/168 (53%), Gaps = 21/168 (13%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  311  GEKQPRSGFRRLS--PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  484
            G+++P       S  P  ++  +   ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  485  GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
             CR+KVGLTGF+CRCG  FCG HRY + H CS+D+K+ GR+AIA+ NP
Sbjct  102  ACRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANP  149



>gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata]
Length=143

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 87/176 (49%), Gaps = 47/176 (27%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  KEETE KV PE I +C     ++  P                            
Sbjct  1    MAQKRDKEETELKV-PENIPICTPPQTISPPPQI--------------------------  33

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNR-----SPPAKREVN  475
                         P   SP++   +    A  ++T      +  NR     S    RE  
Sbjct  34   -------------PSTRSPEISDPKISAAACSQRTSCAISPDLVNRAENRGSLKRPREAT  80

Query  476  RCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGRDAIA+ENPV++
Sbjct  81   RCSGSGCRKRIGLVGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGRDAIAKENPVIR  136



>ref|NP_001130325.1| LOC100191419 [Zea mays]
 ref|XP_008680964.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 ref|XP_008680965.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 gb|ACF78509.1| unknown [Zea mays]
 gb|ACF81174.1| unknown [Zea mays]
 gb|ACN33638.1| unknown [Zea mays]
 gb|AFW70762.1| zinc finger A20 and AN1 domain-containing protein isoform 1 [Zea 
mays]
 gb|AFW70763.1| zinc finger A20 and AN1 domain-containing protein isoform 2 [Zea 
mays]
 gb|AFW70764.1| zinc finger A20 and AN1 domain-containing protein isoform 3 [Zea 
mays]
 gb|AFW70765.1| zinc finger A20 and AN1 domain-containing protein isoform 4 [Zea 
mays]
Length=171

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 86/169 (51%), Gaps = 30/169 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQEQAQLAASSID  55

Query  356  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  490
                       P +    +  V + E KT+  +       S      P AK   +RC+ C
Sbjct  56   SIVNGGDGGKGPVIAASVNVAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAAC  115

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NPVV+
Sbjct  116  RKRVGLTGFSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANPVVR  164



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 87/169 (51%), Gaps = 30/169 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            P+   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PKGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID  55

Query  356  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  490
                       P +    +  VA+ E KT+  +  E    S      P  +   NRCS C
Sbjct  56   SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC  115

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  116  RKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVK  164



>dbj|BAO74167.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 87/167 (52%), Gaps = 7/167 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT N+C KC   F         ++++I        
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDFIMKQEQVKLAASSIGSIVNGGP  64

Query  323  PRSGFRRLSPERTSPDLKRRED--RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
               G  + +   TSP     E    ++   + +               K   NRCS CR+
Sbjct  65   NDHG--KKAAVVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRK  122

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            ++GLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NPVVK
Sbjct  123  RIGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANPVVK  169



>ref|XP_010545575.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 88/162 (54%), Gaps = 2/162 (1%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            ++T  +  PE   LC+NNCG  G+PAT NMC KC  A        +       G     +
Sbjct  4    DKTGCQTPPECPKLCINNCGFFGSPATMNMCSKCHKAMLFQQEQGAKLASVVSGSSSSIN  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
              +  S    S D++ +     A   ++     +         K   +RCS C ++VGLT
Sbjct  64   ASKETS--VASADVQAKPVEPNAGFLQSSSSATDTGVAVEAKPKEGPSRCSTCNKRVGLT  121

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF+CRCG LFCG HRY+D+HDCS++Y AA ++AIA++NPVVK
Sbjct  122  GFKCRCGILFCGSHRYADKHDCSFNYHAAAQEAIAKDNPVVK  163



>ref|XP_011075194.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075195.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075196.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 75/155 (48%), Gaps = 0/155 (0%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G+ AT NMC KC          +  A           S      P
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKCHKDMILKQQQAKLAASSIENIVNGSSNSNEKEP  70

Query  353  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  532
               +P         +         +     N     K   NRC+ C ++VGLTGF CRCG
Sbjct  71   LLANPVDVEAGPLELKAASPQPSPDLASLPNSEMKVKEGPNRCTTCHKRVGLTGFSCRCG  130

Query  533  ELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             LFC  HRYSD+HDC +DY+AAGRDAI++ NP+VK
Sbjct  131  NLFCSTHRYSDKHDCPFDYQAAGRDAISKANPLVK  165



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 84/153 (55%), Gaps = 19/153 (12%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFs----attaaagsssaaIHHKFGEKQPRSGFRRLSPER  358
            LCVNNCG  G+  TN++C KC+       +  A   +  + +K GE     G   ++   
Sbjct  23   LCVNNCGYYGSAKTNDLCSKCYKEFLLTQSKGAVEGTVIVENKVGE----GGANVVNKSH  78

Query  359  TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGEL  538
                ++      V  G  +             P KR  NRCS CR++VGLTGF+CRCG+ 
Sbjct  79   VEQVVEEVRQSQVEEGTTS-----------ENPEKRPANRCSFCRKRVGLTGFKCRCGDT  127

Query  539  FCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            FC  HRYS+ H+C +DYK+AG+DAIA+ NPV+K
Sbjct  128  FCSLHRYSNSHNCMFDYKSAGQDAIAKANPVIK  160



>gb|ACF80251.1| unknown [Zea mays]
Length=174

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 84/173 (49%), Gaps = 35/173 (20%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSID  55

Query  356  RTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA----------------KREVNR  478
                      +  VA G  TV    +   +  N   PA                K   NR
Sbjct  56   SIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGSSEGVAAISKGGKVGPNR  114

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  115  CSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANPVVK  167



>gb|ABK21003.1| unknown [Picea sitchensis]
 gb|ACN40831.1| unknown [Picea sitchensis]
Length=180

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 104/179 (58%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  MAQKTG---KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF-------sattaaag  280
            MAQ++    KEET  +V PE +  C NNCG  G+PAT ++C KC+       S  ++   
Sbjct  1    MAQESWNREKEETGCQV-PEGLIRCANNCGFFGSPATMSLCSKCYREFVLLNSPKSSFDK  59

Query  281  sssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA  460
                 I  +    +P  G   +  +  + D       T A      + E ++++N  PP 
Sbjct  60   PQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAH-----QLEPQQQQNPPPPP  114

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             R+ NRC  CR++VGLTGFRCRCG++FC  HRYSD+H+C+YDYK AGR+AIA+ NP+VK
Sbjct  115  PRQTNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHNCTYDYKTAGREAIAKANPLVK  173



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 87/150 (58%), Gaps = 13/150 (9%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPER-TSP  367
            +CVNNCG  G+  TNN+C KC+         ++A      G K+  +G + L  +R    
Sbjct  23   MCVNNCGFFGSEKTNNLCSKCYKDFLLKQSKTAADDTAVVG-KKVSAGDQDLENKRHVQQ  81

Query  368  DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  547
             L+  +   V  G  +             P KR  NRC+ CR++VGLTGF+CRCG+ FC 
Sbjct  82   VLEEVKQSQVEEGTTS-----------ENPEKRPANRCNFCRKRVGLTGFKCRCGQTFCS  130

Query  548  EHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             HRYS++H+C +DYK+AG++AIA+ NPVVK
Sbjct  131  LHRYSNKHNCVFDYKSAGQEAIAKANPVVK  160



>ref|XP_002323304.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_006373771.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_011033292.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033293.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033294.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033295.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 gb|ABK94854.1| unknown [Populus trichocarpa]
 gb|ABK96387.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05065.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 gb|ERP51568.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
Length=170

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 83/163 (51%), Gaps = 18/163 (11%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G+ AT NMC KC              I ++   +   S    +  
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKCHKDI----------ILNQQQAQLAASSIESIVN  60

Query  353  ERTS-----PDLKRREDRTVARGEKTVeeeeeeeeNRSPP---AKREVNRCSGCRRKVGL  508
              +S     P +    D   A  E  +   E    +  P    AK   +RC+ CR++VGL
Sbjct  61   GNSSGNGKEPVVAGAVDVQAAPVEVKIISTEPSIASSKPSEMKAKEGPSRCTACRKRVGL  120

Query  509  TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            TGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  121  TGFGCRCGNLFCAIHRYSDKHDCPFDYRTAARDAIAKANPVVK  163



>ref|XP_009799138.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=142

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 87/171 (51%), Gaps = 38/171 (22%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQK  KEETE KV PETI L       T +P   +  +                    F
Sbjct  1    MAQKREKEETELKV-PETIPLRTPTITGTDDPTRASDPK-----------------LPNF  42

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG-  487
               +PRS          +P  +    +++ R                   + E NRCSG 
Sbjct  43   KGSRPRSDLVSQPQPEKNPAGEDNNRQSMKR------------------PREEANRCSGI  84

Query  488  -CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRRKVGL GFRCRCGE+FC EHRYSDRH CSYDYKAAGR+AIARENPVV+
Sbjct  85   GCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENPVVR  135



>gb|AAX14637.1| zinc finger protein [Zea mays]
 gb|ABS83244.1| AN13 [Zea mays]
 gb|ACG36018.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG48526.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|AFW87476.1| zinc finger protein1 isoform 1 [Zea mays]
 gb|AFW87477.1| zinc finger protein1 isoform 2 [Zea mays]
 gb|AFW87478.1| zinc finger protein1 isoform 3 [Zea mays]
Length=174

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 84/173 (49%), Gaps = 35/173 (20%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSID  55

Query  356  RTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA----------------KREVNR  478
                      +  VA G  TV    +   +  N   PA                K   NR
Sbjct  56   SIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPNR  114

Query  479  CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  115  CSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANPVVK  167



>gb|ACJ86086.1| unknown [Medicago truncatula]
Length=164

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            ++T  +  PE   LC+NNCG  G+ AT NMC KC          A  ++++I +      
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              SG            +   E + ++  E  V    EE   + P  K    RCS C ++V
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIIS-AEPLVASGSEESLEKKP--KDGPKRCSNCNKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            GLTGF CRCG L+C  HRYSD+HDC +DY+ AGRDAIA+ NP +
Sbjct  121  GLTGFNCRCGNLYCAVHRYSDKHDCPFDYRTAGRDAIAKANPCL  164



>ref|XP_002297783.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK92782.1| unknown [Populus trichocarpa]
 gb|EEE82588.1| zinc finger family protein [Populus trichocarpa]
Length=172

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 85/164 (52%), Gaps = 4/164 (2%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LC NNCG  G+ AT NMC KC          ++ A           S
Sbjct  4    DETGCQAPPEGPILCTNNCGFFGSAATMNMCSKCHKGMLLKQEQANLAASSIGSIVNGSS  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE--VNRCSGCRRKVG  505
                  P     D+   ++  V     TV+            AK +   NRC+ C+++VG
Sbjct  64   SSNVFEP--VIADIIDVQNNAVEPKTITVQPSCASGSGERVEAKPKEGPNRCTSCKKRVG  121

Query  506  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LTGF+CRCG LFC  HRYSD+HDC +DY++A R+AIA+ NPVVK
Sbjct  122  LTGFKCRCGSLFCASHRYSDKHDCPFDYRSAAREAIAKANPVVK  165



>ref|XP_006842203.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 91/174 (52%), Gaps = 18/174 (10%)
 Frame = +2

Query  131  MAQKTGKEETE--FKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH  304
            MAQ++ K + E      P+    C N CG  G+ +TNN+C KC+             I  
Sbjct  1    MAQESKKRDAEDMGHEPPKGPIFCANKCGFFGSASTNNLCSKCYKDFYLKQLKEDENITD  60

Query  305  KF---GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  475
            K       +P +          + +L+  ED    +G         +  +   P K+  N
Sbjct  61   KVIPCLNNEPNAKV-------DAANLQNSEDGKKNKG------VVVDGTSSEEPQKQAPN  107

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RC  CR++VGL GFRCRCG LFC  HRYSD+H+CS+DY+A+G+DAIA+ NPVVK
Sbjct  108  RCRLCRKRVGLAGFRCRCGGLFCSTHRYSDKHNCSFDYRASGQDAIAKANPVVK  161



>ref|XP_006660259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Oryza brachyantha]
Length=118

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  449  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  628
            S  ++  VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDCS+DYK+A RDAIARENP
Sbjct  49   SKASRSSVNRCHSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCSFDYKSAARDAIARENP  108

Query  629  VVK  637
            VV+
Sbjct  109  VVR  111


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  256
            MAQ+  K E   ++    +TLC N+CG  GNPAT N+CQ CF
Sbjct  1    MAQRDKKVEEPTELRAPEMTLCANSCGFPGNPATKNLCQNCF  42



>ref|XP_008354997.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008354998.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008354999.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 77/162 (48%), Gaps = 0/162 (0%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            EET  +  PE   LCVNNCG  G+ AT NMC KC          +  A           S
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
                  P   +  +  +      +   +         +   P      RC+ C ++VGLT
Sbjct  64   SIBANEPVVAAATVDVQPHPVEPKTLSSQPSFSFGSGSSGEPXPEGPKRCNTCNKRVGLT  123

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF CRCG  FC  HRYSD+HDC YDY+ AGRDAIA+ NPVVK
Sbjct  124  GFNCRCGHXFCAVHRYSDKHDCPYDYRTAGRDAIAKANPVVK  165



>ref|XP_010673602.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Beta vulgaris subsp. vulgaris]
Length=174

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 92/166 (55%), Gaps = 6/166 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsat---taaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LCVNNCG  G+ AT NMC KC+         A  ++++I +      
Sbjct  4    DETGCQAPPEGPILCVNNCGFFGSVATMNMCSKCYKDAVLKQEQAKLAASSIENIVNGSS  63

Query  323  PRSGFRRLSPERT-SPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRK  499
              +G   +    T    +K    + +   E +V     E  +  P  K+  +RC+ C+++
Sbjct  64   NGNGKEPVVIGTTMDMQVKLIAPKAITIPESSVPSSLGEGGDAKP--KQGPSRCTTCKKR  121

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VGLTGF CRCG LFC  HRYSD+H+C +DY+ A RDAIA+ NPV+K
Sbjct  122  VGLTGFNCRCGNLFCATHRYSDKHECPFDYRTAARDAIAKANPVIK  167



>emb|CDP09861.1| unnamed protein product [Coffea canephora]
Length=166

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 87/159 (55%), Gaps = 20/159 (13%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            P   TLC N CG  G+PAT N+C KC+               + F  ++ +    +++ E
Sbjct  16   PSEPTLCANGCGFFGSPATMNLCSKCY---------------NDFQMEEQQKAAAKVALE  60

Query  356  RTSPDLKRRED-----RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFR  520
            +     K+ +D        + G   V+ E +EE   +P A  + NRC  C +KVG+ GF 
Sbjct  61   KLVTSQKKADDAFHVGSPESYGTAAVQVERQEEAASAPAAVVKSNRCFCCNKKVGVMGFT  120

Query  521  CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CRCG  FCG HRY ++HDC++D+K  GRDAIA+ NPVVK
Sbjct  121  CRCGSTFCGLHRYPEKHDCTFDFKGQGRDAIAKANPVVK  159



>ref|NP_001288874.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
2 [Brassica rapa]
 gb|ABV89666.1| zinc finger an1-like family protein [Brassica rapa]
 emb|CDY22831.1| BnaA06g02460D [Brassica napus]
Length=168

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 86/167 (51%), Gaps = 30/167 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC                HK    Q   G +  S  
Sbjct  12   PEGPKLCINNCGFFGSAATMNMCSKC----------------HKTILFQQEQGAKLASAV  55

Query  356  RTSP-------------DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
              SP             D + +    VA   + V E    EE  + P K   +RC+ C +
Sbjct  56   SGSPSNILKETFTAALVDAETKSIEPVAVSVQAVAEVVAPEEAAAKP-KEGPSRCTTCNK  114

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF+CRCG+LFCG HRY+D H+CS+DY  A ++AIA+ NPVVK
Sbjct  115  RVGLTGFKCRCGDLFCGTHRYADVHNCSFDYHVAAQEAIAKANPVVK  161



>ref|XP_010228642.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X3 [Brachypodium distachyon]
Length=155

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 91/169 (54%), Gaps = 21/169 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T      ++ A     
Sbjct  1    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  57

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                  S    +  E + P         V  G++ VEEE        PP+    NRC  C
Sbjct  58   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRCLSC  99

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R+KVGLTGFRCRCG+ FC  HRY+D H C++DYK AGR+ IA++NP+VK
Sbjct  100  RKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNPLVK  148



>gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea]
Length=76

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 2/60 (3%)
 Frame = +2

Query  464  REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            REV RCSG  CR+K+GL GFRCRCGE+FC EHRYSDRHDC+YDYKAAGR+AIARENPVVK
Sbjct  10   REVTRCSGSGCRKKIGLIGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENPVVK  69



>ref|XP_006446073.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446074.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446075.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446076.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006467189.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Citrus sinensis]
 gb|ESR59313.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59314.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59315.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59316.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|KDO64801.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
 gb|KDO64802.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
 gb|KDO64803.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
Length=172

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 90/165 (55%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF---sattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+ AT NMC KC+         A  ++++I     E  
Sbjct  4    DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              +G   ++           E + ++  + +   E  E     P  K   +RCS C+++V
Sbjct  64   SSNGSESVAAATVDVQASSVEPKIISV-QPSCASELSESVEAKP--KEGPSRCSSCKKRV  120

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF+CRCG L+C  HRYSD+H+C +DY+ A RDAI + NPV+K
Sbjct  121  GLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIK  165



>ref|XP_004513637.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Cicer arietinum]
Length=166

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 78/157 (50%), Gaps = 23/157 (15%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  370
            LCVNNCG  G  AT NMC KC+  T                 KQ +      S E     
Sbjct  18   LCVNNCGFFGRAATMNMCSKCYKDTML---------------KQEQDKLATASVENIVSG  62

Query  371  LKRREDRTVAR--------GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCR  526
                 ++ V          G   +  +    EN     K   +RC+ CR++VGLTGF C+
Sbjct  63   SSTYNEKQVVTDNAVDGKVGNVEISGDSSSGENLETKVKTGPSRCAACRKRVGLTGFTCK  122

Query  527  CGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CG LFC  HRYSD+HDC +DY++ GRDAIA+ NPV+K
Sbjct  123  CGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIK  159



>ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=170

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 89/165 (54%), Gaps = 8/165 (5%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFs---attaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         A  ++++I +      
Sbjct  4    DETGCQPHPEGPILCINNCGFFGSAANMNMCSKCYKDVILKQEQAKLAASSIENFVNGST  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
             + G   +      P L   +    +    +   E  E   +  P+     RCS C++KV
Sbjct  64   SQKGPVIVGSVDVQPALLESKSVIFSSPPSSSSGEAAELMAKEGPS-----RCSTCKKKV  118

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NPVVK
Sbjct  119  GLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANPVVK  163



>gb|EPS60974.1| hypothetical protein M569_13826 [Genlisea aurea]
Length=150

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 84/149 (56%), Gaps = 20/149 (13%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  370
            +CVNNCG  GNPA  N+C KC++                      +SG   +     S  
Sbjct  15   MCVNNCGFLGNPAKQNLCSKCYTVLCLE-----------------KSGDSPIFTPALSFS  57

Query  371  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  550
            L++    +V+  +  ++E+     + + P+ R   RCS CR+KVGL GF CRCG  FCG 
Sbjct  58   LEKSTAESVSPTQ--IDEKSATATSHALPSSRG-GRCSACRKKVGLFGFTCRCGASFCGT  114

Query  551  HRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            HRY ++H CS+D+KAAGRDAIA+ NPVVK
Sbjct  115  HRYPEKHGCSFDFKAAGRDAIAKANPVVK  143



>gb|ABK26062.1| unknown [Picea sitchensis]
Length=180

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 103/179 (58%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  MAQKTG---KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF-------sattaaag  280
            MAQ++    KEET  +V PE +  C NNCG  G+PAT ++C KC+       S  ++   
Sbjct  1    MAQESWNREKEETGCQV-PEGLIRCANNCGFFGSPATMSLCSKCYREFVLLNSPKSSFDK  59

Query  281  sssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA  460
                 I  +    +P  G   +  +  + D       T A      + E ++++N  PP 
Sbjct  60   PQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAH-----QLEPQQQQNPPPPP  114

Query  461  KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             R+ NRC  CR++VGLTGFRCRCG++FC  HRYSD+H C+YDYK AGR+AIA+ NP+VK
Sbjct  115  PRQTNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHKCTYDYKTAGREAIAKANPLVK  173



>dbj|BAJ90521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  458  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +K  VNRC  CR++VGLTGFRCRCGE+FCG HRYSDRHDCSYDYK+A RDAIARENPVV+
Sbjct  95   SKSSVNRCHNCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENPVVR  154


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 2/44 (5%)
 Frame = +2

Query  131  MAQKTGK--EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  256
            MAQ+  K  E TE  +    ITLC N+CG  GNPAT N+CQ CF
Sbjct  1    MAQRDKKVEEPTEVHLHAAEITLCANSCGFPGNPATKNLCQNCF  44



>ref|XP_011090378.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011090379.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=167

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 87/165 (53%), Gaps = 11/165 (7%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF---sattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+         A  ++++I +      
Sbjct  4    DETGCQPHPEGPVLCVNNCGFFGSAANMNMCSKCYKDLMLKQEQAKLAASSIENIVNGSS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              S     + E  +      E + ++    TV           P       RC  C+++V
Sbjct  64   SGSEKESTAAEAGNAQTDLAEKKAISV--PTVNASTXXXTKEGP------KRCGTCKKRV  115

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GL GF+CRCG LFCG HRYS++HDC +DY++AGRDAIA+ NPV+K
Sbjct  116  GLAGFKCRCGNLFCGSHRYSEKHDCPFDYRSAGRDAIAKANPVIK  160



>ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Cicer arietinum]
Length=160

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 78/157 (50%), Gaps = 23/157 (15%)
 Frame = +2

Query  191  LCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  370
            LCVNNCG  G  AT NMC KC+  T                 KQ +      S E     
Sbjct  12   LCVNNCGFFGRAATMNMCSKCYKDTML---------------KQEQDKLATASVENIVSG  56

Query  371  LKRREDRTVAR--------GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCR  526
                 ++ V          G   +  +    EN     K   +RC+ CR++VGLTGF C+
Sbjct  57   SSTYNEKQVVTDNAVDGKVGNVEISGDSSSGENLETKVKTGPSRCAACRKRVGLTGFTCK  116

Query  527  CGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CG LFC  HRYSD+HDC +DY++ GRDAIA+ NPV+K
Sbjct  117  CGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNPVIK  153



>ref|XP_009365001.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 80/164 (49%), Gaps = 6/164 (4%)
 Frame = +2

Query  155  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQP  325
            ET  +  PE   LC NNCG  G+PAT N+C KC          A   +A+I         
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSPATMNLCSKCHKDLVLKQEQAKVVAASIDSAVNGSPS  64

Query  326  RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  505
             SG     P  T+    +     V                R    K    RC  CR++VG
Sbjct  65   ESG---KGPVATAAVDVQAGPADVMLISTQASSTPSLNIKREEKVKETPTRCGTCRKRVG  121

Query  506  LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            LTGF CRCG+LFC  HRYSD+H+C YDY+ A +DAIA+ NPVVK
Sbjct  122  LTGFSCRCGDLFCAVHRYSDKHNCPYDYRTAAQDAIAKANPVVK  165



>ref|XP_010228638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Brachypodium distachyon]
Length=163

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 91/169 (54%), Gaps = 21/169 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T      ++ A     
Sbjct  9    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  65

Query  311  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  490
                  S    +  E + P         V  G++ VEEE        PP+    NRC  C
Sbjct  66   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRCLSC  107

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R+KVGLTGFRCRCG+ FC  HRY+D H C++DYK AGR+ IA++NP+VK
Sbjct  108  RKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNPLVK  156



>ref|XP_006656245.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Oryza brachyantha]
Length=171

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRRL  346
            PE   LC+NNCG  G+ AT NMC KC          A  ++++I          SG   +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVNGGD--SGKEPI  68

Query  347  SPERTSPDLKRREDRT-VARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  523
                T     + E +T VA+  +     E    N  P  K   +RCS CR++VGLTGF C
Sbjct  69   IAGHTEVAFAQVEVQTLVAQPAEIAGPSEGLTVN--PKGKEGPSRCSTCRKRVGLTGFNC  126

Query  524  RCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  127  RCGNLYCALHRYSDKHDCQFDYRTAARDAIAKANPVVK  164



>ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011037832.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
Length=172

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 88/167 (53%), Gaps = 10/167 (6%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC NNCG  G+ AT NMC KC          A  ++++I        
Sbjct  4    DETGCQAPPEGPILCTNNCGFFGSAATMNMCSKCHKDMLLKQEQANLAASSIGSIVNGSS  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE--VNRCSGCRR  496
                F     E    D+   ++  V     TV+            AK +   NRC+ C++
Sbjct  64   SSDVF-----ETVIADIIDVQNNAVEPKTITVQPSCASGSGERVEAKPKEGPNRCTSCKK  118

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF+CRCG LFC  HRYSD+HDC +DY++A R+AIA+ NPVVK
Sbjct  119  RVGLTGFKCRCGSLFCASHRYSDKHDCPFDYRSAAREAIAKANPVVK  165



>dbj|BAO74166.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 83/166 (50%), Gaps = 5/166 (3%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH--KFGEKQP  325
            +ET  +  PE   LC NNCG  G+ AT N+C KC             A           P
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDVIMKQEQVKLAASSIGSIVNGGP  64

Query  326  RSGFRRLSPERTSPDLKRRED--RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRK  499
                ++ +   TSP     E    ++   + +               K   NRCS CR++
Sbjct  65   NDHGKKAA-VVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRKR  123

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +GLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NPVVK
Sbjct  124  IGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANPVVK  169



>ref|XP_010544224.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
 ref|XP_010544225.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 86/166 (52%), Gaps = 10/166 (6%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            ++T  +  PE   LCVNNCG  G+PAT NMC KC  A        +       G     S
Sbjct  4    DKTGCQTPPECPKLCVNNCGFFGSPATMNMCSKCHKAMLFQEKQDAKLASAVAGS---SS  60

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS----PPAKREVNRCSGCRRK  499
            G   +    + P     + + ++ G K          +         K   +RCS C ++
Sbjct  61   GIDTVKETVSGPS---SDVQVISMGMKITSPPSSSASDPGITLETKPKEGPSRCSTCNKR  117

Query  500  VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            VGLTGF+CRCG LFCG HRY+D+HDCS++Y  A ++AIA+ NPVVK
Sbjct  118  VGLTGFKCRCGNLFCGSHRYADKHDCSFNYHEAAQEAIAKANPVVK  163



>gb|KDO64800.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
Length=179

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 90/165 (55%), Gaps = 6/165 (4%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF---sattaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+ AT NMC KC+         A  ++++I     E  
Sbjct  11   DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETS  70

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
              +G   ++           E + ++  + +   E  E     P  K   +RCS C+++V
Sbjct  71   SSNGSESVAAATVDVQASSVEPKIISV-QPSCASELSESVEAKP--KEGPSRCSSCKKRV  127

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF+CRCG L+C  HRYSD+H+C +DY+ A RDAI + NPV+K
Sbjct  128  GLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKANPVIK  172



>ref|XP_010913141.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
Length=171

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 86/170 (51%), Gaps = 30/170 (18%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LCVNNCG  G+ AT NMC KC               H     KQ ++     S 
Sbjct  10   APEAPILCVNNCGFFGSAATMNMCSKC---------------HKDLLLKQQQAKLAASSV  54

Query  353  ERTS----------PDLKRREDRTVARGE-KTVeeeeeeeeNRSPPAKREVN----RCSG  487
            + T+          P +    D +V   E KT      +    S   + +V     RC+ 
Sbjct  55   DSTASGSGSSSGKEPVVSWSVDFSVGPTEPKTTLAYPSDALAISEGGETKVKDGPKRCNT  114

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR++VGLTGF CRCG +FC  HRYSD+H+C +DY+ AGRDAIA+ NPVVK
Sbjct  115  CRKRVGLTGFTCRCGNIFCATHRYSDKHNCPFDYRTAGRDAIAKANPVVK  164



>ref|XP_003557802.2| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Brachypodium distachyon]
Length=226

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 93/172 (54%), Gaps = 21/172 (12%)
 Frame = +2

Query  122  VLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIH  301
            + RMAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T      ++ A  
Sbjct  69   LARMAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEK  125

Query  302  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  481
                     S    +  E + P         V  G++ VEEE        PP+    NRC
Sbjct  126  KVAVASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRC  167

Query  482  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
              CR+KVGLTGFRCRCG+ FC  HRY+D H C++DYK AGR+ IA++NP+VK
Sbjct  168  LSCRKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNPLVK  219



>emb|CBI16408.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 79/162 (49%), Gaps = 40/162 (25%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRS  331
            +ET  +  PE   LC+NNCG  G+PAT NMC KC                          
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMM---------------------  42

Query  332  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  511
                         LK+ + +  +      E   E +    P      NRCS C+++VGLT
Sbjct  43   -------------LKQEQAKLASSFSFGSEGSGEAKPKEGP------NRCSTCKKRVGLT  83

Query  512  GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  84   GFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANPVVK  125



>ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=205

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +2

Query  464  REVNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RE NRC   GCRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIARENPVVK
Sbjct  139  REANRCCGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENPVVK  198



>gb|AFW87479.1| zinc finger protein1 [Zea mays]
Length=193

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 84/174 (48%), Gaps = 35/174 (20%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S 
Sbjct  29   APEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSI  73

Query  353  ERTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA----------------KREVN  475
            +          +  VA G  TV    +   +  N   PA                K   N
Sbjct  74   DSIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPN  132

Query  476  RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            RCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NPVVK
Sbjct  133  RCSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANPVVK  186



>ref|XP_007145644.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 ref|XP_007145645.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17638.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17639.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
Length=172

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 86/158 (54%), Gaps = 6/158 (4%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsat---taaagsssaaIHHKFGEKQPRSGFRR  343
             PE   LC NNCG  G  AT NMC KC+  T         ++A++ +        SG + 
Sbjct  11   APERPILCTNNCGFFGRAATMNMCSKCYKDTLLKQEQDKLAAASVENIVNGGSGCSGKQA  70

Query  344  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  523
            ++       +   E +TV+     +  +    +N    AK   +RC+ CR++VGLTGF C
Sbjct  71   VTAGSVDVQVGNVEMKTVS---AEISGDSSSGQNLEMKAKTGPSRCATCRKRVGLTGFSC  127

Query  524  RCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +CG LFC  HRYSD+HDC +DY+  GR+AIA+ NP +K
Sbjct  128  KCGNLFCAMHRYSDKHDCPFDYQTVGREAIAKANPAIK  165



>gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii]
Length=156

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 92/170 (54%), Gaps = 20/170 (12%)
 Frame = +2

Query  131  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKF  310
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  311  GEKQP-RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  487
            G ++P  S F    P  ++  +   ++   A  E  V         +  PA  + NRCS 
Sbjct  44   GLQKPIDSLFPPQLPIPSTSSILVLQESAAAEEEPEVVTAAVAVAVQPIPA--QPNRCSA  101

Query  488  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            CR+KVGLTGF+CRCG  FCG HRY + H CS+D+K+ GR+AIA+ NPVVK
Sbjct  102  CRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANPVVK  151



>gb|EPS60034.1| hypothetical protein M569_14771 [Genlisea aurea]
Length=170

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 80/160 (50%), Gaps = 11/160 (7%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHH-----KFGEKQPRSGF  337
             P+   LC+NNCG  G  AT NMC KC+         +  A          G     +  
Sbjct  10   APQAPILCINNCGFFGTAATMNMCSKCYKDLVLKQEQAKLAASSIQSIMNVGASSENAAV  69

Query  338  RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  517
              ++P   + +      +  A    T   EE  +    P       RC  CR++VGLTGF
Sbjct  70   SVVTPSAATSESTAASPQATAAESLTTATEEGVKGGGGP------KRCVSCRKRVGLTGF  123

Query  518  RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             CRCG  FC  HRYSD+H+CS+DY++AG++AIAR NP+VK
Sbjct  124  TCRCGGTFCSVHRYSDKHECSFDYRSAGQEAIARANPLVK  163



>ref|XP_009349757.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=173

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 85/161 (53%), Gaps = 11/161 (7%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             P+   LCVNNCG  G  AT NMC KC+  T      ++ A           S    +  
Sbjct  11   APDRPILCVNNCGFFGRAATMNMCSKCYKDTLLKQEQANLAASSIDSIVNGSSSSNIV--  68

Query  353  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV------NRCSGCRRKVGLTG  514
                P +    D    R E +V   E   E+ SP  K E+      +RC+ CR++VGLTG
Sbjct  69   --IDPVVASAVDVQAVRVETSVVSTEAYIES-SPSMKTEMKENKGPSRCTTCRKRVGLTG  125

Query  515  FRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            F C+CG  FC  HRYSD+HDC +DY+ AG+DAIA+ NP+VK
Sbjct  126  FNCKCGNTFCASHRYSDKHDCPFDYRTAGQDAIAKANPIVK  166



>ref|XP_004250869.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 gb|ACM68439.1| stress-associated protein 2 [Solanum lycopersicum]
Length=170

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 89/165 (54%), Gaps = 8/165 (5%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFs---attaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+            ++++I +      
Sbjct  4    DETGCQPHPEGPILCINNCGFFGSAANMNMCSKCYKDVILKQEQEKLAASSIENFVNGST  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
             + G   +      P L   +   ++    +   E  E   +  P+     RCS C++KV
Sbjct  64   SQKGPVIVGSVDVQPALLESKSVVLSSPPSSSSGEAAELMAKEGPS-----RCSTCKKKV  118

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NPVVK
Sbjct  119  GLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANPVVK  163



>ref|XP_010105325.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
 gb|EXC04346.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
Length=168

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 79/155 (51%), Gaps = 4/155 (3%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G  ATNNMC KCF  T      +  A           +G   +  
Sbjct  11   APERPILCINNCGFFGRAATNNMCSKCFKDTLLKQEQAKLAASSIDSIVNGGNGKEPVIA  70

Query  353  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  532
            +         E   V     +     +  EN     K+  NRC+ CR++VGLTGF C+CG
Sbjct  71   DALDVQAGPVETEIVTTEPSSDSSSSKPVEN----VKQGPNRCTTCRKRVGLTGFNCKCG  126

Query  533  ELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             LFC  HRYSD+HDC +DY+ A RD IA+ NPVVK
Sbjct  127  NLFCSSHRYSDKHDCPFDYRTAARDGIAKANPVVK  161



>gb|ADK63395.1| AN1-like zinc finger protein [Brassica rapa]
Length=168

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 85/167 (51%), Gaps = 30/167 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC                HK    Q   G +  S  
Sbjct  12   PEGPKLCINNCGFFGSAATMNMCSKC----------------HKTILFQQEHGAKLASAV  55

Query  356  RTSP-------------DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
              SP             D   +    VA   + V E     E+ + P K   +RC+ C +
Sbjct  56   SGSPSNILKETFTAALVDAGTKSIEPVAVSVQAVAEVVAPGESAAKP-KEGPSRCTTCNK  114

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF+CRCG+LFCG HRY+D H+CS+DY  A ++AIA+ NPVVK
Sbjct  115  RVGLTGFKCRCGDLFCGTHRYADVHNCSFDYHTAAQEAIAKANPVVK  161



>emb|CDY25219.1| BnaC06g04440D [Brassica napus]
Length=168

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 86/167 (51%), Gaps = 30/167 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC                HK    Q   G +  S  
Sbjct  12   PEGPKLCINNCGFFGSAATMNMCSKC----------------HKTMLFQQEQGAKLASAV  55

Query  356  RTSP-------------DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
              SP             D + +    +A   + V E    EE  + P K   +RC+ C +
Sbjct  56   SGSPSNILKETFTAALVDAETKSVEPMAVSVQAVAEVVAPEEAAAKP-KEGPSRCTTCNK  114

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF+CRCG+LFCG HRY+D H+CS+DY  A ++AIA+ NPVVK
Sbjct  115  RVGLTGFKCRCGDLFCGTHRYADVHNCSFDYHVAAQEAIAKANPVVK  161



>ref|XP_009147775.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Brassica rapa]
 ref|XP_009147776.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Brassica rapa]
Length=168

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 85/167 (51%), Gaps = 30/167 (18%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            PE   LC+NNCG  G+ AT NMC KC                HK    Q   G +  S  
Sbjct  12   PEGPKLCINNCGFFGSAATMNMCSKC----------------HKTILFQQEQGAKLASAV  55

Query  356  RTSP-------------DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  496
              SP             D   +    VA   + V E    EE  + P K   +RC+ C +
Sbjct  56   SGSPSNILKETFTADLVDAGTKSIEPVAVSVQAVAEVVAPEEAAAKP-KEGPSRCTTCNK  114

Query  497  KVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            +VGLTGF+CRCG+LFCG HRY+D H+CS+DY  A ++AIA+ NPVVK
Sbjct  115  RVGLTGFKCRCGDLFCGTHRYADVHNCSFDYHVAAQEAIAKANPVVK  161



>gb|ACM68452.1| stress-associated protein 2 [Solanum pennellii]
Length=170

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 89/165 (54%), Gaps = 8/165 (5%)
 Frame = +2

Query  152  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFs---attaaagsssaaIHHKFGEKQ  322
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+            ++++I +      
Sbjct  4    DETGCQPHPEGPILCINNCGFFGSAANMNMCSKCYKDVILKQEQEKLAASSIENFVNGST  63

Query  323  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  502
             + G   +      P L   +   ++    +   E  E   +  P+     RCS C++KV
Sbjct  64   SQKGPVIVGSVDVQPALLESKSVVLSSPPSSSSGEVAELMAKEGPS-----RCSTCKKKV  118

Query  503  GLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            GLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NPVVK
Sbjct  119  GLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANPVVK  163



>ref|XP_010540147.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
 ref|XP_010540154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
Length=167

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 84/154 (55%), Gaps = 6/154 (4%)
 Frame = +2

Query  176  PETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  355
            P    LC N CG  G+P+  N+C KC+    A     +AA        +P      L+PE
Sbjct  13   PSEPKLCANGCGFFGSPSNMNLCSKCYRDLRAMEDQKAAAKAAVEKSFKPS----LLTPE  68

Query  356  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  535
            + +  +    +  V  G  T         ++  P +   NRCS C +KVG+ GF+C+CG 
Sbjct  69   QPAKPVPASAEAAVVNG--TEPTATPGAADKHEPPRHPSNRCSSCNKKVGVMGFKCKCGS  126

Query  536  LFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
             FCG+HRY ++H+CS+D+K AGRDAIA+ NP+VK
Sbjct  127  TFCGDHRYPEKHECSFDFKEAGRDAIAKANPLVK  160



>gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum]
Length=160

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 2/61 (3%)
 Frame = +2

Query  461  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVV  634
            +RE NR SG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENPVV
Sbjct  93   QREANRSSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENPVV  152

Query  635  K  637
            K
Sbjct  153  K  153



>ref|XP_006381027.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
 gb|ERP58824.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
Length=171

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 82/169 (49%), Gaps = 29/169 (17%)
 Frame = +2

Query  173  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  352
             PE   LC+NNCG  G+ AT NMC KC               H     KQ ++     S 
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKC---------------HKDIILKQQQAQLAASSI  55

Query  353  ERT----------SPDLKRREDRTVARGEKTVeeeeeeeeNRSPP----AKREVNRCSGC  490
            E             P +    D   A  E  +   E      S P    AK   +RC+ C
Sbjct  56   ESIVNGNSSGNGKEPVVAVAVDVQSAPVEVKIISTEPSSATSSKPSEMKAKEGPSRCTSC  115

Query  491  RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENPVVK  637
            R++VGLTGF CRCG LFC  HRYSD+H+C +DY+ A RDAIA+ NPVV+
Sbjct  116  RKRVGLTGFSCRCGNLFCAVHRYSDKHNCRFDYRNAARDAIAKANPVVR  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125