BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029A21

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    223   4e-64   Nicotiana tomentosiformis
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    221   2e-63   Solanum lycopersicum
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    219   1e-62   Nicotiana tomentosiformis
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    219   1e-62   Nicotiana tomentosiformis
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    218   6e-62   Solanum tuberosum [potatoes]
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    217   8e-62   Pyrus x bretschneideri [bai li]
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    216   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    216   3e-61   Citrus sinensis [apfelsine]
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    214   6e-61   
ref|XP_007144120.1|  hypothetical protein PHAVU_007G1305001g            199   7e-61   Phaseolus vulgaris [French bean]
ref|XP_008224159.1|  PREDICTED: uncharacterized protein LOC103323...    213   9e-61   
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    214   1e-60   Nicotiana sylvestris
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    214   1e-60   Prunus mume [ume]
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    213   2e-60   
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    213   2e-60   
ref|XP_009388278.1|  PREDICTED: phytoene desaturase-like                200   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO99279.1|  unnamed protein product                                213   2e-60   Coffea canephora [robusta coffee]
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    213   2e-60   Citrus sinensis [apfelsine]
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             213   3e-60   Prunus persica
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    212   5e-60   Fragaria vesca subsp. vesca
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    212   7e-60   Prunus mume [ume]
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    211   9e-60   Populus euphratica
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    211   1e-59   Populus euphratica
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    211   1e-59   Populus euphratica
ref|XP_010936016.1|  PREDICTED: uncharacterized protein LOC105055...    209   1e-59   
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    211   1e-59   Nelumbo nucifera [Indian lotus]
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    211   1e-59   Populus euphratica
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    211   1e-59   Populus euphratica
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    211   2e-59   Elaeis guineensis
emb|CAN68017.1|  hypothetical protein VITISV_025151                     210   2e-59   Vitis vinifera
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          210   3e-59   
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    209   5e-59   
ref|XP_004171362.1|  PREDICTED: protoporphyrinogen oxidase, chlor...    194   9e-59   
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         208   2e-58   Jatropha curcas
ref|XP_010650130.1|  PREDICTED: uncharacterized protein LOC100249...    206   3e-58   
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    207   4e-58   Eucalyptus grandis [rose gum]
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    206   7e-58   Vitis vinifera
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    206   8e-58   
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    205   1e-57   Nicotiana tomentosiformis
ref|XP_002528810.1|  methyltransferase, putative                        205   1e-57   Ricinus communis
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    205   1e-57   Glycine max [soybeans]
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    204   2e-57   Nicotiana tomentosiformis
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    204   2e-57   Nicotiana tomentosiformis
gb|KDO54089.1|  hypothetical protein CISIN_1g037740mg                   189   2e-57   Citrus sinensis [apfelsine]
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    204   3e-57   
ref|XP_007035213.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    201   5e-57   
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    203   6e-57   Phoenix dactylifera
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    203   6e-57   
ref|XP_009586646.1|  PREDICTED: uncharacterized protein LOC104084...    202   6e-57   
ref|XP_007035212.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    202   9e-57   
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    203   9e-57   Nicotiana tomentosiformis
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    202   1e-56   
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    202   1e-56   Glycine max [soybeans]
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   202   2e-56   Citrus sinensis [apfelsine]
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    202   2e-56   Theobroma cacao [chocolate]
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       201   3e-56   Cucumis sativus [cucumbers]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    201   3e-56   Cucumis melo [Oriental melon]
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           201   4e-56   Medicago truncatula
ref|XP_006606355.1|  PREDICTED: uncharacterized protein LOC100815...    200   5e-56   Glycine max [soybeans]
ref|XP_008460675.1|  PREDICTED: uncharacterized protein LOC103499...    200   5e-56   Cucumis melo [Oriental melon]
gb|ABG37642.1|  cyclopropane fatty acid synthase                        204   6e-56   Populus trichocarpa [western balsam poplar]
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       200   9e-56   Cucumis sativus [cucumbers]
emb|CBI23694.3|  unnamed protein product                                199   1e-55   Vitis vinifera
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    199   3e-55   
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    201   5e-55   
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           198   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    196   1e-54   
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    196   2e-54   Citrus sinensis [apfelsine]
gb|AAT74602.1|  cyclopropane fatty acid synthase                        194   1e-53   Gossypium hirsutum [American cotton]
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                194   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    194   1e-53   
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    194   1e-53   
emb|CDX77504.1|  BnaA07g06420D                                          194   2e-53   
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             193   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    193   2e-53   Camelina sativa [gold-of-pleasure]
emb|CDX85109.1|  BnaC07g07970D                                          193   2e-53   
dbj|BAD44154.1|  unnamed protein product                                193   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         193   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57657.1|  AT3g23510/MEE5_5                                        193   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    193   3e-53   Brassica rapa
dbj|BAB01742.1|  unnamed protein product                                192   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             192   6e-53   Capsella rubella
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             192   6e-53   Eutrema salsugineum [saltwater cress]
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         192   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    192   8e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    191   1e-52   Sesamum indicum [beniseed]
ref|XP_006431328.1|  hypothetical protein CICLE_v10030464mg             189   1e-52   
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    189   5e-52   Solanum lycopersicum
gb|KJB38367.1|  hypothetical protein B456_006G251800                    189   6e-52   Gossypium raimondii
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    189   8e-52   Tarenaya hassleriana [spider flower]
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    188   1e-51   Eucalyptus grandis [rose gum]
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    187   4e-51   Sesamum indicum [beniseed]
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   5e-51   
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    186   9e-51   Eucalyptus grandis [rose gum]
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    186   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_006350408.1|  PREDICTED: uncharacterized protein LOC102579...    184   3e-50   Solanum tuberosum [potatoes]
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    184   5e-50   Solanum tuberosum [potatoes]
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    184   7e-50   
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    183   1e-49   
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    182   2e-49   Tarenaya hassleriana [spider flower]
gb|KJB28512.1|  hypothetical protein B456_005G052900                    182   2e-49   Gossypium raimondii
gb|KJB28513.1|  hypothetical protein B456_005G052900                    181   4e-49   Gossypium raimondii
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    182   4e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    181   7e-49   Gossypium raimondii
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             179   2e-48   
gb|KJB28510.1|  hypothetical protein B456_005G052900                    178   2e-48   Gossypium raimondii
gb|KJB28511.1|  hypothetical protein B456_005G052900                    178   2e-48   Gossypium raimondii
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    178   7e-48   Tarenaya hassleriana [spider flower]
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             176   3e-47   
emb|CDX92987.1|  BnaA03g37090D                                          176   4e-47   
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    176   6e-47   Brassica rapa
emb|CBI23697.3|  unnamed protein product                                176   8e-47   Vitis vinifera
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    175   1e-46   
emb|CDX94854.1|  BnaC03g43340D                                          175   2e-46   
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    172   1e-45   Brassica rapa
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    172   2e-45   
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   171   4e-45   
gb|KGN61579.1|  hypothetical protein Csa_2G172490                       157   1e-44   Cucumis sativus [cucumbers]
gb|KGN61576.1|  hypothetical protein Csa_2G172460                       157   1e-44   Cucumis sativus [cucumbers]
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   165   4e-43   Zea mays [maize]
dbj|BAJ93367.1|  predicted protein                                      164   9e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE67149.1|  hypothetical protein OsJ_24210                          162   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             163   2e-42   Selaginella moellendorffii
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    162   4e-42   Setaria italica
ref|XP_010532687.1|  PREDICTED: uncharacterized protein LOC104808...    160   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    162   6e-42   Tarenaya hassleriana [spider flower]
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    160   2e-41   Tarenaya hassleriana [spider flower]
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           160   3e-41   Medicago truncatula
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    160   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      159   8e-41   
gb|EEC82010.1|  hypothetical protein OsI_25960                          157   2e-40   Oryza sativa Indica Group [Indian rice]
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                156   4e-40   Erythranthe guttata [common monkey flower]
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         156   6e-40   Sterculia foetida
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          154   4e-39   Sorghum bicolor [broomcorn]
gb|AAT74600.1|  cyclopropane fatty acid synthase                        153   7e-39   Gossypium hirsutum [American cotton]
gb|KJB70810.1|  hypothetical protein B456_011G092100                    153   8e-39   Gossypium raimondii
gb|KJB70811.1|  hypothetical protein B456_011G092100                    153   9e-39   Gossypium raimondii
gb|AAT74601.1|  cyclopropane fatty acid synthase                        153   9e-39   Gossypium hirsutum [American cotton]
gb|KJB12596.1|  hypothetical protein B456_002G026100                    152   1e-38   Gossypium raimondii
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    152   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    151   3e-38   Zea mays [maize]
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    151   4e-38   Zea mays [maize]
gb|KJB12595.1|  hypothetical protein B456_002G026100                    151   4e-38   Gossypium raimondii
ref|XP_002862680.1|  predicted protein                                  141   5e-38   
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    147   9e-37   Sesamum indicum [beniseed]
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    142   4e-35   
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    140   4e-34   Setaria italica
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    139   9e-34   Setaria italica
ref|XP_001769171.1|  predicted protein                                  138   1e-33   
ref|XP_008677861.1|  PREDICTED: uncharacterized protein LOC103652...    137   2e-33   Zea mays [maize]
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    137   3e-33   Zea mays [maize]
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    134   3e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70161.1|  hypothetical protein M569_04599                         132   1e-31   Genlisea aurea
gb|KJB12590.1|  hypothetical protein B456_002G025800                    127   8e-30   Gossypium raimondii
ref|XP_002183150.1|  predicted protein                                  127   1e-29   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          125   3e-29   
ref|WP_027873283.1|  NADH-ubiquinone oxidoreductase subunit 6           121   1e-28   Spongiibacter marinus
ref|XP_005648777.1|  cyclopropane fatty acid synthase                   124   2e-28   Coccomyxa subellipsoidea C-169
gb|KHG28468.1|  putative fatty acid methyltransferase                   122   5e-28   Gossypium arboreum [tree cotton]
gb|KHG28467.1|  putative fatty acid methyltransferase                   122   5e-28   Gossypium arboreum [tree cotton]
ref|XP_005824669.1|  hypothetical protein GUITHDRAFT_165417             122   1e-27   Guillardia theta CCMP2712
ref|WP_038500647.1|  NADH-ubiquinone oxidoreductase subunit 6           118   1e-27   Janthinobacterium agaricidamnosum
emb|CDG85105.1|  flavin containing amine oxidoreductase family pr...    118   2e-27   Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    120   2e-27   Nicotiana tomentosiformis
ref|WP_043631329.1|  NADH-ubiquinone oxidoreductase subunit 6           117   3e-27   Chromobacterium haemolyticum
ref|WP_008347203.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    115   1e-26   Burkholderiaceae
ref|WP_035824801.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   Janthinobacterium sp. RA13
ref|WP_035725299.1|  NADH-ubiquinone oxidoreductase subunit 6           115   1e-26   
ref|WP_043614801.1|  NADH-ubiquinone oxidoreductase subunit 6           115   2e-26   Chromobacterium violaceum
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  117   2e-26   Citrus sinensis [apfelsine]
ref|WP_027232012.1|  NADH-ubiquinone oxidoreductase subunit 6           114   4e-26   
ref|WP_019104394.1|  NADH-ubiquinone oxidoreductase subunit 6           114   4e-26   Chromobacterium sp. C-61
ref|WP_043581068.1|  NADH-ubiquinone oxidoreductase subunit 6           114   4e-26   Chromobacterium
ref|WP_034748929.1|  NADH-ubiquinone oxidoreductase subunit 6           114   5e-26   Janthinobacterium lividum
ref|WP_016347695.1|  amine oxidase                                      114   5e-26   Burkholderia insecticola
ref|WP_044459099.1|  NADH-ubiquinone oxidoreductase subunit 6           114   5e-26   Rhizobium
ref|WP_043590453.1|  NADH-ubiquinone oxidoreductase subunit 6           114   5e-26   Chromobacterium haemolyticum
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    116   6e-26   
ref|WP_010394901.1|  NADH-ubiquinone oxidoreductase subunit 6           113   7e-26   Janthinobacterium lividum
ref|WP_019566747.1|  NADH-ubiquinone oxidoreductase subunit 6           113   7e-26   Agrobacterium
ref|WP_018152743.1|  hypothetical protein                               113   7e-26   Leeia oryzae
ref|WP_004431402.1|  NADH-ubiquinone oxidoreductase subunit 6           113   7e-26   Agrobacterium tumefaciens
ref|WP_013761036.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    113   7e-26   Rhizobium/Agrobacterium group
ref|WP_043596502.1|  NADH-ubiquinone oxidoreductase subunit 6           113   9e-26   Chromobacterium violaceum
ref|WP_025594884.1|  NADH-ubiquinone oxidoreductase subunit 6           113   9e-26   Agrobacterium tumefaciens
ref|WP_040661572.1|  NADH-ubiquinone oxidoreductase subunit 6           113   1e-25   
gb|EAR60721.1|  hypothetical protein MED92_13638                        113   1e-25   Neptuniibacter caesariensis
ref|WP_034784946.1|  NADH-ubiquinone oxidoreductase subunit 6           112   1e-25   Janthinobacterium lividum
ref|WP_004433137.1|  amine oxidase, flavin-containing                   112   1e-25   Agrobacterium tumefaciens
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  115   1e-25   Citrus sinensis [apfelsine]
ref|WP_022563112.1|  conserved hypothetical protein; putative oxi...    112   1e-25   Rhizobium
ref|WP_035200438.1|  NADH-ubiquinone oxidoreductase subunit 6           112   1e-25   Agrobacterium tumefaciens
ref|WP_035208627.1|  NADH-ubiquinone oxidoreductase subunit 6           112   1e-25   Agrobacterium tumefaciens
ref|WP_034497400.1|  NADH-ubiquinone oxidoreductase subunit 6           112   2e-25   Rhizobium/Agrobacterium group
ref|WP_037092074.1|  NADH-ubiquinone oxidoreductase subunit 6           112   2e-25   Rhizobium
ref|WP_020694301.1|  hypothetical protein                               112   2e-25   Reyranella massiliensis
ref|WP_042317992.1|  NADH-ubiquinone oxidoreductase subunit 6           112   2e-25   Paraburkholderia caledonica
ref|WP_009340169.1|  NADH-ubiquinone oxidoreductase subunit 6           112   2e-25   Afipia
ref|WP_021079312.1|  16S rRNA (-2'-O)-methyltransferase                 112   2e-25   
ref|WP_035507039.1|  NADH-ubiquinone oxidoreductase subunit 6           112   3e-25   Caballeronia jiangsuensis
ref|WP_036551677.1|  NADH-ubiquinone oxidoreductase subunit 6           112   3e-25   
ref|WP_036861967.1|  NADH-ubiquinone oxidoreductase subunit 6           112   3e-25   
ref|WP_038570879.1|  NADH-ubiquinone oxidoreductase subunit 6           111   3e-25   Burkholderia cepacia complex
ref|WP_002717506.1|  hypothetical protein                               111   3e-25   Afipia felis
ref|WP_012218188.1|  NADH-ubiquinone oxidoreductase subunit 6           111   3e-25   Burkholderia multivorans
ref|WP_006699863.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   Rhizobiales
ref|WP_025097256.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   Burkholderia sp. A1
ref|WP_017234374.1|  hypothetical protein                               111   4e-25   Pandoraea sp. B-6
ref|WP_040705051.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   
ref|WP_034192796.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   Burkholderia
ref|WP_014725774.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   Burkholderia sp. KJ006
ref|XP_009410825.1|  PREDICTED: protoporphyrinogen oxidase, chlor...    104   4e-25   
ref|WP_013699783.1|  NADH-ubiquinone oxidoreductase subunit 6           111   4e-25   Burkholderia gladioli
ref|WP_011880041.1|  NADH-ubiquinone oxidoreductase subunit 6           111   5e-25   Burkholderia vietnamiensis
ref|WP_017918374.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    111   5e-25   Burkholderia gladioli
ref|WP_011295863.1|  NADH-ubiquinone oxidoreductase subunit 6           110   5e-25   Cupriavidus pinatubonensis
dbj|GAM27527.1|  hypothetical protein SAMD00019534_107030               111   6e-25   Acytostelium subglobosum LB1
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      114   6e-25   Bathycoccus prasinos
ref|WP_018334542.1|  hypothetical protein                               110   6e-25   Actinomycetospora chiangmaiensis
ref|WP_022958759.1|  NADH-ubiquinone oxidoreductase subunit 6           110   6e-25   Spongiibacter tropicus
gb|ERJ39944.1|  Amine oxidase, flavin-containing                        110   6e-25   Burkholderia sp. AU4i
ref|WP_042973675.1|  NADH-ubiquinone oxidoreductase subunit 6           110   7e-25   Burkholderia sp. AU4i
ref|WP_025662389.1|  NADH-ubiquinone oxidoreductase subunit 6           110   7e-25   Rhizobium sp. IBUN
ref|WP_039370008.1|  NADH-ubiquinone oxidoreductase subunit 6           110   8e-25   Burkholderia
gb|EGD05972.1|  amine oxidase                                           110   8e-25   Burkholderia sp. TJI49
ref|XP_005851729.1|  hypothetical protein CHLNCDRAFT_29187              110   8e-25   Chlorella variabilis
ref|WP_028160094.1|  NADH-ubiquinone oxidoreductase subunit 6           110   8e-25   Bradyrhizobium japonicum
ref|WP_036039189.1|  NADH-ubiquinone oxidoreductase subunit 6           110   8e-25   Burkholderia gladioli
ref|WP_012432094.1|  NADH-ubiquinone oxidoreductase subunit 6           110   8e-25   Paraburkholderia phytofirmans
ref|WP_028369081.1|  NADH-ubiquinone oxidoreductase subunit 6           110   8e-25   Burkholderia sp. UYPR1.413
ref|WP_034203531.1|  NADH-ubiquinone oxidoreductase subunit 6           110   9e-25   Burkholderia cepacia
gb|EJN00550.1|  putative NAD/FAD-binding protein                        110   9e-25   Phyllobacterium sp. YR531
ref|WP_025871998.1|  NADH-ubiquinone oxidoreductase subunit 6           110   9e-25   Methylobacillus glycogenes
ref|XP_004172280.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    110   1e-24   
ref|WP_019620433.1|  hypothetical protein                               110   1e-24   Amphritea japonica
ref|WP_028880747.1|  NADH-ubiquinone oxidoreductase subunit 6           110   1e-24   
ref|WP_028444633.1|  NADH-ubiquinone oxidoreductase subunit 6           109   1e-24   Chitinimonas koreensis
ref|WP_014189646.1|  NADH-ubiquinone oxidoreductase subunit 6           110   1e-24   Azospirillum lipoferum
ref|WP_009451675.1|  NADH-ubiquinone oxidoreductase subunit 6           109   1e-24   Nitratireductor indicus
ref|WP_011349277.1|  NADH-ubiquinone oxidoreductase subunit 6           109   1e-24   Burkholderia lata
ref|WP_041643943.1|  NADH-ubiquinone oxidoreductase subunit 6           109   1e-24   
emb|CAL95925.1|  conserved hypothetical amine oxidoreductase            109   1e-24   Azoarcus sp. BH72
ref|WP_017510251.1|  hypothetical protein                               109   1e-24   beta proteobacterium L13
gb|EYR84639.1|  putative NAD/FAD-binding protein                        109   2e-24   Shinella sp. DD12
ref|WP_030479110.1|  amine oxidase                                      109   2e-24   
ref|WP_037404758.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   
ref|WP_008889725.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   Thalassospira profundimaris
ref|WP_011487298.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   Paraburkholderia xenovorans
ref|WP_041912257.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   
ref|WP_017923872.1|  NADH-ubiquinone oxidoreductase subunit 6           107   2e-24   
ref|WP_043815399.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   Rubrivivax gelatinosus
ref|WP_003163823.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   Brevundimonas
dbj|GAM98350.1|  amine oxidase                                          109   2e-24   alpha proteobacterium U9-1i
ref|WP_028639776.1|  NADH-ubiquinone oxidoreductase subunit 6           109   2e-24   Novosphingobium acidiphilum
gb|KDO50391.1|  hypothetical protein CISIN_1g0358702mg                  102   2e-24   Citrus sinensis [apfelsine]
ref|WP_035310951.1|  NADH-ubiquinone oxidoreductase subunit 6           109   3e-24   Brevundimonas sp. EAKA
ref|WP_044542063.1|  NADH-ubiquinone oxidoreductase subunit 6           109   3e-24   Bradyrhizobium sp. LTSP885
ref|WP_040855695.1|  NADH-ubiquinone oxidoreductase subunit 6           109   3e-24   
ref|WP_014430674.1|  NADH-ubiquinone oxidoreductase subunit 6           108   3e-24   Rubrivivax gelatinosus
ref|WP_016832821.1|  hypothetical protein                               108   4e-24   Herbaspirillum lusitanum
ref|WP_012567205.1|  NADH-ubiquinone oxidoreductase subunit 6           108   4e-24   Rhodospirillum centenum
ref|WP_043420888.1|  NADH-ubiquinone oxidoreductase subunit 6           108   4e-24   
ref|WP_006997242.1|  Flavin containing amine oxidoreductase             108   4e-24   Candidatus Pelagibacter ubique
ref|WP_035864519.1|  NADH-ubiquinone oxidoreductase subunit 6           108   4e-24   Cupriavidus sp. SK-3
ref|WP_011281854.1|  flavin containing amine oxidoreductas              108   4e-24   Candidatus Pelagibacter ubique
ref|WP_020169184.1|  Flavin containing amine oxidoreductase             108   4e-24   Candidatus Pelagibacter ubique
ref|WP_027306686.1|  flavin containing amine oxidoreductas              108   4e-24   Candidatus Pelagibacter ubique
ref|WP_036487838.1|  NADH-ubiquinone oxidoreductase subunit 6           108   5e-24   Nesiotobacter exalbescens
ref|WP_033379455.1|  NADH-ubiquinone oxidoreductase subunit 6           108   5e-24   Paraburkholderia caledonica
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     110   5e-24   Eucalyptus grandis [rose gum]
ref|WP_011871814.1|  NADH-ubiquinone oxidoreductase subunit 6           108   5e-24   Herminiimonas arsenicoxydans
ref|WP_030898331.1|  amine oxidase                                      108   6e-24   Streptomyces sp. NRRL F-5126
gb|KIY98773.1|  hypothetical protein MNEG_9189                          110   6e-24   Monoraphidium neglectum
ref|WP_020009386.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    108   6e-24   Agrobacterium
ref|WP_043621892.1|  NADH-ubiquinone oxidoreductase subunit 6           107   6e-24   
ref|WP_035224034.1|  NADH-ubiquinone oxidoreductase subunit 6           108   6e-24   Agrobacterium tumefaciens
ref|WP_011903806.1|  NADH-ubiquinone oxidoreductase subunit 6           108   7e-24   Polynucleobacter asymbioticus
ref|WP_042457343.1|  cyclopropane-fatty-acyl-phospholipid synthase      107   8e-24   Rhodovulum sulfidophilum
emb|CDX77513.1|  BnaA07g06510D                                          110   8e-24   
ref|WP_012733707.1|  NADH-ubiquinone oxidoreductase subunit 6           107   9e-24   
gb|EFA79548.1|  hypothetical protein PPL_07599                          108   9e-24   
ref|WP_003507671.1|  NADH-ubiquinone oxidoreductase subunit 6           107   9e-24   
ref|WP_026439795.1|  NADH-ubiquinone oxidoreductase subunit 6           107   9e-24   
ref|WP_019254489.1|  NADH-ubiquinone oxidoreductase subunit 6           107   9e-24   
ref|WP_030103211.1|  NADH-ubiquinone oxidoreductase subunit 6           107   9e-24   
ref|WP_009855773.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_008259909.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_008495386.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_039398472.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
gb|ACV37205.1|  FAD dependent oxidoreductase                            107   1e-23   
ref|WP_017451245.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    107   1e-23   
ref|WP_035996342.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_041568750.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_009668089.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_042296695.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_009541056.1|  Amine oxidase, flavin-containing                   107   1e-23   
ref|WP_013233084.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_026989223.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_043355115.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_042327676.1|  NADH-ubiquinone oxidoreductase subunit 6           107   1e-23   
ref|WP_028116906.1|  FAD-dependent oxidoreductase                       106   1e-23   
ref|WP_024583618.1|  NADH-ubiquinone oxidoreductase subunit 6           107   2e-23   
ref|WP_010323291.1|  NADH-ubiquinone oxidoreductase subunit 6           107   2e-23   
ref|WP_039789083.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_026283740.1|  NADH-ubiquinone oxidoreductase subunit 6           107   2e-23   
ref|WP_031400557.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_010971977.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    107   2e-23   
ref|WP_034199245.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_043702973.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_006316415.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|XP_002502708.1|  predicted protein                                  109   2e-23   
ref|WP_042275006.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_025977669.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_043855709.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_007878405.1|  putative amine oxidase                             106   2e-23   
gb|AAQ60890.1|  probable dehydrogenase                                  106   2e-23   
ref|WP_033403562.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
gb|KEI70136.1|  NADH-ubiquinone oxidoreductase subunit 6                106   2e-23   
ref|WP_013544226.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_042618059.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|WP_039245159.1|  NADH-ubiquinone oxidoreductase subunit 6           106   2e-23   
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    108   2e-23   
ref|WP_044588091.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_007149524.1|  amine oxidase                                      106   3e-23   
ref|WP_021160956.1|  Amine oxidase, flavin-containing                   106   3e-23   
ref|WP_044827279.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_035852078.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_035552365.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_019655032.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_022731757.1|  NADH-ubiquinone oxidoreductase subunit 6           106   3e-23   
ref|WP_026187915.1|  NADH-ubiquinone oxidoreductase subunit 6           105   3e-23   
ref|WP_039331876.1|  NADH-ubiquinone oxidoreductase subunit 6           105   3e-23   
ref|WP_007175869.1|  NADH-ubiquinone oxidoreductase subunit 6           105   4e-23   
ref|WP_032926853.1|  NADH-ubiquinone oxidoreductase subunit 6           105   4e-23   
ref|WP_034190985.1|  NADH-ubiquinone oxidoreductase subunit 6           105   4e-23   
ref|WP_034453592.1|  amine oxidase                                      105   4e-23   
ref|WP_037990410.1|  NADH-ubiquinone oxidoreductase subunit 6           105   4e-23   
ref|WP_044447958.1|  FAD-dependent oxidoreductase                       105   4e-23   
gb|EMG51288.1|  putative amine oxidase                                  105   4e-23   
ref|WP_008326156.1|  NADH-ubiquinone oxidoreductase subunit 6           105   4e-23   
gb|KEQ08421.1|  NADH-ubiquinone oxidoreductase subunit 6                105   5e-23   
ref|WP_003495137.1|  NADH-ubiquinone oxidoreductase subunit 6           105   5e-23   
ref|WP_035599917.1|  NADH-ubiquinone oxidoreductase subunit 6           105   5e-23   
ref|WP_039861233.1|  NADH-ubiquinone oxidoreductase subunit 6           105   5e-23   
ref|WP_035049215.1|  NADH-ubiquinone oxidoreductase subunit 6           105   5e-23   
ref|WP_035261907.1|  NADH-ubiquinone oxidoreductase subunit 6           105   6e-23   
ref|WP_017503882.1|  NADH-ubiquinone oxidoreductase subunit 6           105   6e-23   
ref|WP_041696044.1|  NADH-ubiquinone oxidoreductase subunit 6           105   6e-23   
ref|WP_037138296.1|  NADH-ubiquinone oxidoreductase subunit 6           105   6e-23   
ref|WP_018115447.1|  NADH-ubiquinone oxidoreductase subunit 6           105   6e-23   
ref|WP_044057527.1|  FAD-dependent oxidoreductase                       105   6e-23   
ref|WP_027456573.1|  NADH-ubiquinone oxidoreductase subunit 6           105   7e-23   
ref|XP_005708372.1|  cyclopropane-fatty-acyl-phospholipid synthase      107   7e-23   
ref|WP_008929348.1|  amine oxidase                                      104   7e-23   
gb|KHN30725.1|  Putative fatty acid methyltransferase                   107   7e-23   
ref|WP_015682946.1|  NAD(P)-binding Rossmann-like domain protein        104   7e-23   
ref|WP_025565552.1|  FAD-dependent oxidoreductase                       104   7e-23   
ref|WP_026036644.1|  NADH-ubiquinone oxidoreductase subunit 6           105   7e-23   
ref|WP_043566519.1|  NADH-ubiquinone oxidoreductase subunit 6           105   7e-23   
ref|WP_029013942.1|  NADH-ubiquinone oxidoreductase subunit 6           104   8e-23   
ref|WP_040652358.1|  NADH-ubiquinone oxidoreductase subunit 6           104   8e-23   
ref|WP_013045454.1|  NADH-ubiquinone oxidoreductase subunit 6           104   9e-23   
ref|WP_018388286.1|  hypothetical protein                               105   9e-23   
ref|WP_034640061.1|  NADH-ubiquinone oxidoreductase subunit 6           104   9e-23   
ref|WP_012977821.1|  NADH-ubiquinone oxidoreductase subunit 6           105   9e-23   
ref|WP_015341846.1|  putative amine oxidase                             105   9e-23   
gb|EEG09848.1|  amine oxidase                                           104   9e-23   
ref|WP_014087480.1|  NADH-ubiquinone oxidoreductase subunit 6           104   9e-23   
ref|WP_028036610.1|  flavin containing amine oxidoreductas              104   9e-23   
dbj|GAK46215.1|  amine oxidase                                          105   9e-23   
ref|WP_018411529.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_008250273.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
gb|EPR40262.1|  amine oxidase                                           104   1e-22   
ref|WP_043253197.1|  FAD-dependent oxidoreductase                       104   1e-22   
ref|WP_009839402.1|  Flavin containing amine oxidoreductas              100   1e-22   
ref|WP_034744234.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_040415203.1|  FAD-dependent oxidoreductase                       104   1e-22   
ref|WP_040612926.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
gb|EAP90948.1|  possible NADPH-dependent oxidoreductase                 104   1e-22   
ref|WP_006465178.1|  dehydrogenase                                      104   1e-22   
ref|WP_042115913.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_009769616.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_032553645.1|  FAD-dependent oxidoreductase                       104   1e-22   
ref|WP_034951396.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_007742446.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
dbj|GAK70358.1|  putative amine oxidase                                 104   1e-22   
ref|WP_038014651.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_025668383.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_036186404.1|  NADH-ubiquinone oxidoreductase subunit 6           104   1e-22   
ref|WP_018408401.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_020165365.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_019917409.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
gb|EMJ87687.1|  NAD(P)-binding Rossmann-like domain protein             103   2e-22   
ref|WP_011646801.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    103   2e-22   
ref|WP_017037535.1|  hypothetical protein                               103   2e-22   
gb|EMT01204.1|  Cyclopropane-fatty-acyl-phospholipid synthase           105   2e-22   
gb|KDN87747.1|  amine oxidase                                           103   2e-22   
ref|WP_035210178.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_024894758.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_022695414.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_020702431.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_032893652.1|  FAD-dependent oxidoreductase                       103   2e-22   
ref|WP_011588051.1|  MULTISPECIES: amine oxidase                        103   2e-22   
ref|WP_010637102.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
gb|AHE52338.1|  hypothetical protein NX02_02905                         103   2e-22   
ref|WP_024920550.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    103   2e-22   
ref|WP_006022402.1|  hypothetical protein                               103   2e-22   
ref|WP_039996369.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|WP_014286810.1|  NADH-ubiquinone oxidoreductase subunit 6           103   2e-22   
ref|XP_001695321.1|  cyclopropane fatty acid synthase                   106   2e-22   
gb|EXJ13068.1|  protoporphyrinogen oxidase                              102   2e-22   
ref|WP_007089223.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_035527085.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|XP_002294769.1|  predicted protein                                  105   3e-22   
ref|WP_018091565.1|  amine oxidase                                      103   3e-22   
ref|WP_028827881.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_003188372.1|  amine oxidase                                      103   3e-22   
ref|WP_004788063.1|  NADP transhydrogenase subunit alpha                103   3e-22   
ref|WP_040500757.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_032903980.1|  FAD-dependent oxidoreductase                       103   3e-22   
ref|WP_043624542.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_020302483.1|  MULTISPECIES: putative oxidoreductase              102   3e-22   
ref|WP_025109339.1|  FAD-dependent oxidoreductase                       102   3e-22   
ref|WP_007670477.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_014716842.1|  MULTISPECIES: amine oxidase                        102   3e-22   
ref|WP_039365608.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_034789530.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_037838847.1|  amine oxidase                                      102   3e-22   
ref|WP_020084021.1|  hypothetical protein                               103   3e-22   
ref|WP_022980196.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_034936602.1|  NADH-ubiquinone oxidoreductase subunit 6           103   3e-22   
ref|WP_012325386.1|  amine oxidase                                      102   3e-22   
ref|WP_035870484.1|  amine oxidase                                      102   4e-22   
ref|WP_029869004.1|  NADH-ubiquinone oxidoreductase subunit 6           101   4e-22   
ref|WP_041373649.1|  NADH-ubiquinone oxidoreductase subunit 6           103   4e-22   
ref|WP_038163662.1|  NADP transhydrogenase subunit alpha                102   4e-22   
ref|WP_034128074.1|  FAD-dependent oxidoreductase                       102   4e-22   
gb|ACG79467.1|  amine oxidase, flavin-containing protein                103   4e-22   
ref|WP_019280258.1|  NADH-ubiquinone oxidoreductase subunit 6           103   4e-22   
ref|WP_035715304.1|  NADH-ubiquinone oxidoreductase subunit 6           102   4e-22   
ref|WP_027616715.1|  FAD-dependent oxidoreductase                       102   4e-22   
ref|WP_012345499.1|  NADH-ubiquinone oxidoreductase subunit 6           102   4e-22   
ref|WP_019965200.1|  NADH-ubiquinone oxidoreductase subunit 6           102   4e-22   
ref|WP_015679354.1|  NAD(P)-binding Rossmann-like domain protein        102   4e-22   
ref|WP_008058110.1|  NADH-ubiquinone oxidoreductase subunit 6           102   4e-22   
ref|WP_025281276.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    102   4e-22   
gb|EPE96225.1|  amine oxidase                                           103   4e-22   
ref|WP_030114119.1|  MULTISPECIES: amine oxidase                        102   4e-22   
ref|WP_040568260.1|  NADH-ubiquinone oxidoreductase subunit 6           102   4e-22   
ref|WP_035015201.1|  FAD-dependent oxidoreductase                       102   4e-22   
gb|EEX12803.1|  amine oxidase                                           102   4e-22   
ref|WP_034876173.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
gb|KDO54096.1|  hypothetical protein CISIN_1g0029282mg                95.9    5e-22   
ref|WP_042310911.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_015487919.1|  amine oxidase                                      102   5e-22   
ref|WP_025264845.1|  FAD-dependent oxidoreductase                       102   5e-22   
ref|WP_041379432.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_035540528.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_037106477.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_016746108.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    102   5e-22   
ref|WP_037520154.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_028233174.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
ref|WP_027693326.1|  NADH-ubiquinone oxidoreductase subunit 6           102   5e-22   
gb|ABQ71179.1|  amine oxidase                                           102   6e-22   
gb|AIU25495.1|  NADH-ubiquinone oxidoreductase subunit 6                102   6e-22   
ref|WP_010660331.1|  NADH-ubiquinone oxidoreductase subunit 6           102   6e-22   
ref|WP_036519337.1|  NADH-ubiquinone oxidoreductase subunit 6           102   6e-22   
ref|WP_008932697.1|  NADH-ubiquinone oxidoreductase subunit 6           102   6e-22   
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    104   6e-22   
ref|WP_037162878.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    102   6e-22   
ref|WP_012285610.1|  NADH-ubiquinone oxidoreductase subunit 6           102   6e-22   
ref|WP_020682554.1|  hypothetical protein                               102   7e-22   
ref|WP_037112614.1|  NADH-ubiquinone oxidoreductase subunit 6           102   7e-22   
ref|WP_035613535.1|  NADH-ubiquinone oxidoreductase subunit 6           102   7e-22   
ref|WP_036547878.1|  NADH-ubiquinone oxidoreductase subunit 6           102   7e-22   
dbj|BAP13665.1|  amine-oxidase                                          102   7e-22   
ref|WP_033068007.1|  NADH-ubiquinone oxidoreductase subunit 6           102   7e-22   
ref|WP_026039634.1|  NADH-ubiquinone oxidoreductase subunit 6           102   8e-22   
ref|WP_008547394.1|  NADH-ubiquinone oxidoreductase subunit 6           102   8e-22   
ref|WP_023874324.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    102   8e-22   
ref|WP_020400278.1|  hypothetical protein                               102   8e-22   
ref|WP_037072913.1|  NADH-ubiquinone oxidoreductase subunit 6           101   8e-22   
ref|WP_008253319.1|  NADH-ubiquinone oxidoreductase subunit 6           102   9e-22   
ref|WP_007815668.1|  NADH-ubiquinone oxidoreductase subunit 6           102   9e-22   
gb|EHS52662.1|  amine oxidase                                           101   9e-22   
ref|WP_013595869.1|  NADH-ubiquinone oxidoreductase subunit 6           102   9e-22   
ref|WP_043683403.1|  NADH-ubiquinone oxidoreductase subunit 6           102   9e-22   
ref|WP_029008959.1|  NADH-ubiquinone oxidoreductase subunit 6           102   9e-22   
ref|WP_027331137.1|  FAD-dependent oxidoreductase                       101   9e-22   
ref|WP_008193427.1|  NADH-ubiquinone oxidoreductase subunit 6           101   1e-21   
ref|WP_037065787.1|  NADH-ubiquinone oxidoreductase subunit 6           102   1e-21   
ref|WP_025390591.1|  FAD-dependent oxidoreductase                       101   1e-21   
ref|WP_012483567.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    102   1e-21   
ref|WP_035426557.1|  NADH-ubiquinone oxidoreductase subunit 6           101   1e-21   
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    103   1e-21   
ref|WP_004672198.1|  NADH-ubiquinone oxidoreductase subunit 6           101   1e-21   
ref|WP_033951217.1|  amine oxidase                                      101   1e-21   
ref|WP_035460477.1|  NADH-ubiquinone oxidoreductase subunit 6           101   1e-21   
ref|WP_024271493.1|  putative NAD/FAD-binding protein                   101   1e-21   
ref|WP_009958816.1|  NADP transhydrogenase subunit alpha                101   1e-21   



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   223 bits (569),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 104/116 (90%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFW  116



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   221 bits (564),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VA+VGAGISGLVSAY LAK GA +V+YEKEDY+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1    MKVAIVGAGISGLVSAYELAKSGAKIVIYEKEDYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFW  116



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   219 bits (559),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 103/116 (89%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFW  116



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   219 bits (559),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 103/116 (89%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFW  116



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   218 bits (554),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLVSAY LAK G  VV+Y+KE+Y+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKSGVKVVIYDKENYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFW  116



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   217 bits (553),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 101/116 (87%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFW
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFW  116



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   216 bits (551),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 101/116 (87%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFW
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFW  116



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KMRVAV+GAGISGLVSAYVLAK G  VV+YEK+DYLGGHAKTVT DGVDLDLGFMVFNRV
Sbjct  4    KMRVAVIGAGISGLVSAYVLAKAGVEVVLYEKDDYLGGHAKTVTFDGVDLDLGFMVFNRV  63

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFW
Sbjct  64   TYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFW  120



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLNPYFW  116



>ref|XP_007144120.1| hypothetical protein PHAVU_007G1305001g, partial [Phaseolus vulgaris]
 gb|ESW16114.1| hypothetical protein PHAVU_007G1305001g, partial [Phaseolus vulgaris]
Length=166

 Score =   199 bits (507),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR+AVVGAGISGL SAYVLAK G  VV+YEKED+LGGHAKTV  DGVD+DLGFMVFNRVT
Sbjct  1    MRIAVVGAGISGLASAYVLAKSGVNVVLYEKEDWLGGHAKTVNADGVDVDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE++GVDME+SDMSFSVSLD G G EWGSR+G SGLFAQK+N++NPYFW
Sbjct  61   YPNMMEFFENIGVDMELSDMSFSVSLDRGRGCEWGSRSGLSGLFAQKRNVMNPYFW  116



>ref|XP_008224159.1| PREDICTED: uncharacterized protein LOC103323914 isoform X3 [Prunus 
mume]
Length=689

 Score =   213 bits (541),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5    KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFW
Sbjct  65   TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFW  121



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   214 bits (545),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT++ VDLDLGFMVFNRVT
Sbjct  1    MKVAVVGAGISGLVSAYELAKAGVEVVVYEKEDYLGGHAKTVTVNDVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGVDMEISDMSFSVSLD G+G EWGSR G SGLFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFENLGVDMEISDMSFSVSLDKGYGCEWGSRTGLSGLFAQKKNVLNPYFW  116



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   214 bits (544),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5    KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFW
Sbjct  65   TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFW  121



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            +MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSRNGFSGLFAQKKN LNPYFW
Sbjct  63   TYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSRNGFSGLFAQKKNALNPYFW  119



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   213 bits (543),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 99/116 (85%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAG+SGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGMSGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG S LFAQK NL+NPYFW
Sbjct  61   YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSSLFAQKTNLINPYFW  116



>ref|XP_009388278.1| PREDICTED: phytoene desaturase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=200

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGL SAY LAK G  VV+YEKEDYLGGHAKTVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLASAYTLAKAGVDVVLYEKEDYLGGHAKTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM+E FE+LGVDMEISDMSFSVSLD G G EWGSRNG S LFAQK N  NP FW
Sbjct  61   YPNMVEFFETLGVDMEISDMSFSVSLDEGKGCEWGSRNGLSSLFAQKTNAFNPSFW  116



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   213 bits (543),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            K+RVAVVGAGISGLV+A+VLAK G  VV+YEKEDYLGGHAKTVT+DG+DLDLGFMVFNRV
Sbjct  3    KLRVAVVGAGISGLVAAHVLAKEGVDVVIYEKEDYLGGHAKTVTMDGIDLDLGFMVFNRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMMELFE+LGVDME+SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNP FW
Sbjct  63   TYPNMMELFENLGVDMELSDMSFSVSLDKGKGCEWGSRNGLSSLFAQKKNVLNPKFW  119



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   213 bits (542),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 100/116 (86%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+G GISGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLDL FMVFNRVT
Sbjct  1    MRAAVIGGGISGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDLCFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFW  116



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   213 bits (541),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFW
Sbjct  61   YPNMMELFERLGVDMETSDMSFSASLDKGQGCEWGSRNGLSSLFAQKRNLFNPYFW  116



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   212 bits (539),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG+GISGLV+AYVLAK G  V +YEKEDYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLVAAYVLAKDGVEVDLYEKEDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGV+MEISDMSFS SLD G GYEWGSRNG S LFAQK N+LNPYFW
Sbjct  61   YPNMMEFFESLGVEMEISDMSFSASLDKGKGYEWGSRNGLSSLFAQKSNVLNPYFW  116



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   212 bits (539),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 98/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFW
Sbjct  61   YPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFW  116



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFW  119



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFW  119



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3    RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW
Sbjct  63   TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFW  119



>ref|XP_010936016.1| PREDICTED: uncharacterized protein LOC105055750 isoform X3 [Elaeis 
guineensis]
Length=677

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/116 (84%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1    MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFW  116



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   211 bits (536),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGLVSAYVLA  G  VV+YEKEDYLGGH++TVT+DG+DLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLANAGVDVVLYEKEDYLGGHSRTVTIDGLDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGV+ME SDMSFSVSLD GH YEWGSRNG + LFAQK N LNPYFW
Sbjct  61   YPNMMEFFESLGVEMETSDMSFSVSLDKGHDYEWGSRNGLASLFAQKTNALNPYFW  116



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFW  116



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW
Sbjct  61   YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFW  116



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   211 bits (536),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 97/116 (84%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1    MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFW  116



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   210 bits (535),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+ME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFETLGVBMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  116



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   210 bits (534),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAV+G GISGLVS+YVLAK G  V +YEKEDYLGGHA+TV LDGVDLDLGFMVFNRVT
Sbjct  1    MKVAVIGGGISGLVSSYVLAKAGVSVTLYEKEDYLGGHARTVKLDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLG+DMEISDMSFSVSLD G GYEWGSR+G +GLFAQK N LNP+FW
Sbjct  61   YPNMMEFFESLGIDMEISDMSFSVSLDGGQGYEWGSRSGLAGLFAQKSNALNPHFW  116



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG+GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLVSAYVLAKAGVNVVLYEKENYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME+SDMSFSVSLD G G EWGSRNG SGLFAQK+N+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMELSDMSFSVSLDKGRGCEWGSRNGLSGLFAQKRNVLNPYFW  116



>ref|XP_004171362.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic/mitochondrial-like, 
partial [Cucumis sativus]
Length=166

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFW
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFW  116



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAY-VLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            +MRVAV+G GISGL+SAY V++  GA VV+YEKEDYLGGHA+TV+ DGVDLDLGFMVFNR
Sbjct  3    RMRVAVIGGGISGLISAYYVVSNSGAEVVLYEKEDYLGGHARTVSFDGVDLDLGFMVFNR  62

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMMELFESLGVDME+SDMSFSVSLD G+GYEWGSRNG SG+FAQKKN+LNPYFW
Sbjct  63   VTYPNMMELFESLGVDMELSDMSFSVSLDKGNGYEWGSRNGLSGVFAQKKNILNPYFW  120



>ref|XP_010650130.1| PREDICTED: uncharacterized protein LOC100249441 isoform X3 [Vitis 
vinifera]
Length=678

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  116



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   207 bits (526),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+V V+G G+SGLV+AY  A+GGA VVVYEKEDYLGGHAKTV+++GVDLDLGFMVFNRVT
Sbjct  1    MKVGVIGGGMSGLVAAYEAARGGAKVVVYEKEDYLGGHAKTVSVNGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLGV+MEISDMS SVSLD G GYEWGSRNG   LFAQK NLLNPYFW
Sbjct  61   YPNMMELFESLGVEMEISDMSISVSLDEGQGYEWGSRNGLLSLFAQKTNLLNPYFW  116



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   206 bits (524),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  116



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   206 bits (523),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAV+G GISGLVS YVLA+ G  VV+YEKE+Y+GGHAKTV  DGV+LDLGFMVFNRVT
Sbjct  1    MKVAVIGGGISGLVSTYVLARNGVKVVLYEKEEYIGGHAKTVCFDGVELDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM E FESLGVD+E+SDMSFSVSLD+G GYEWGSRNG SGLFAQK N +NPYFW
Sbjct  61   YPNMTEFFESLGVDLELSDMSFSVSLDHGKGYEWGSRNGLSGLFAQKTNAINPYFW  116



>ref|XP_009586643.1| PREDICTED: uncharacterized protein LOC104084479 isoform X4 [Nicotiana 
tomentosiformis]
Length=824

 Score =   205 bits (522),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 96/116 (83%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFW  116



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFN VT
Sbjct  1    MRVAVVGGGISGLVSAYVLAKDGVEVVLYEKEEYLGGHAKTVCFDGVDLDLGFMVFNCVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME+SDMSFSVSLDNG GYEWGSRNG  GLFAQK N  NPYFW
Sbjct  61   YPNMMEFFESLGVDMELSDMSFSVSLDNGKGYEWGSRNGLPGLFAQKTNAFNPYFW  116



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   205 bits (522),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFW  116



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   204 bits (520),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/116 (83%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFW  116



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   204 bits (520),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/116 (83%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1    MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFW  116



>gb|KDO54089.1| hypothetical protein CISIN_1g037740mg, partial [Citrus sinensis]
Length=130

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1    MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFW
Sbjct  61   SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFW  116



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   204 bits (520),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 94/117 (80%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KMRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V
Sbjct  4    KMRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHV  63

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFW
Sbjct  64   EYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFW  120



>ref|XP_007035213.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
 gb|EOY06139.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
Length=604

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFW  116



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   203 bits (517),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFW  116



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   203 bits (517),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFW  116



>ref|XP_009586646.1| PREDICTED: uncharacterized protein LOC104084479 isoform X6 [Nicotiana 
tomentosiformis]
Length=744

 Score =   202 bits (515),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1    MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFW  116



>ref|XP_007035212.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
 gb|EOY06138.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
Length=672

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFW  116



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   203 bits (516),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1    MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFW  116



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   202 bits (515),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 95/116 (82%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1    MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFW
Sbjct  61   YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFW  116



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM++ FE+LGVDME+SDMSFSVSLD G G EWGSRNG + LFAQK+N+LNPYFW
Sbjct  61   YPNMLDFFENLGVDMELSDMSFSVSLDKGRGCEWGSRNGLTSLFAQKRNVLNPYFW  116



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   202 bits (514),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V 
Sbjct  1    MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVE  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFW  116



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW
Sbjct  61   YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFW  116



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   201 bits (512),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFW
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFW  116



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   201 bits (511),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFW
Sbjct  61   YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFW  116



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG GISGLVSAYVLAKGG  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1    MRVAVVGGGISGLVSAYVLAKGGVNVVLYEKEDYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FESLGV+ME+SDMSFSVSLD G G EWGSR+  SGLFAQK+N LNPYFW
Sbjct  61   YPNMMEFFESLGVEMELSDMSFSVSLDKGRGCEWGSRS-LSGLFAQKRNALNPYFW  115



>ref|XP_006606355.1| PREDICTED: uncharacterized protein LOC100815937 isoform X2 [Glycine 
max]
Length=741

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1    MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFW  116



>ref|XP_008460675.1| PREDICTED: uncharacterized protein LOC103499444 isoform X2 [Cucumis 
melo]
Length=740

 Score =   200 bits (509),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFW
Sbjct  61   YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFW  116



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   204 bits (518),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 102/139 (73%), Positives = 106/139 (76%), Gaps = 23/139 (17%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV-  483
            MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV 
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRVV  60

Query  484  ----------------------TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  597
                                  TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSR
Sbjct  61   GFVTNLRVGLIDLEGYWDHEQVTYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSR  120

Query  598  NGFSGLFAQKKNLLNPYFW  654
            NGFSGLFAQKKN LNPYFW
Sbjct  121  NGFSGLFAQKKNALNPYFW  139



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   200 bits (508),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN VT
Sbjct  1    MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFW
Sbjct  61   YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFAQKKNLLNPYFW  116



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   199 bits (507),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  116



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   199 bits (505),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  116



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   201 bits (511),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  301  LKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            + M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN 
Sbjct  772  VAMKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNT  831

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFW
Sbjct  832  VTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFW  889


 Score =   185 bits (470),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 93/139 (67%), Positives = 101/139 (73%), Gaps = 23/139 (17%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN---  477
            M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN   
Sbjct  1    MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVL  60

Query  478  --------------------RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  597
                                +VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR
Sbjct  61   PLHFHLSLSLYDYEYSFGFEQVTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSR  120

Query  598  NGFSGLFAQKKNLLNPYFW  654
            NG S LF+QKKNLLNPYFW
Sbjct  121  NGLSSLFSQKKNLLNPYFW  139



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   198 bits (503),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4    KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFW
Sbjct  64   TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFW  120



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   196 bits (498),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4    KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFW
Sbjct  64   TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFW  120



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AV+G GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVIGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME  DMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPFDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   194 bits (493),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 100/117 (85%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            KMRVAVVG G+SGLVSAYV+AKGG  VVVYEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4    KMRVAVVGGGVSGLVSAYVVAKGGVEVVVYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR GFSGLFAQKKN +NPYFW
Sbjct  64   TYPNMMEFFETLGVEMEISDMSFSVSLDKGQGCEWGSRTGFSGLFAQKKNAINPYFW  120



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   194 bits (493),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  483
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  117



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   194 bits (493),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 89/117 (76%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  483
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFW  117



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRCDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFW
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFW  117



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGISGLFAQKKNVLNPYFW  117



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFW
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFW  117



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFW
Sbjct  61   TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFW  117



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQK N+LNPYFW
Sbjct  61   TYPNMMEFFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKTNVLNPYFW  117



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMM+ FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFW
Sbjct  61   TYPNMMDFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFW  117



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  61   TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  117



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            M+VAVVG+GISGL SAYVLA  G   +V+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVVGSGISGLGSAYVLANQGVEEIVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPNMME FE LGV+ME+SDMSFSVSLDNG G EWGSRNG SGLF+QKKN+LNPYFW
Sbjct  61   TYPNMMEFFEKLGVEMEVSDMSFSVSLDNGKGCEWGSRNGVSGLFSQKKNVLNPYFW  117



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   191 bits (486),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            +MR+AVVG G+SGL +AYVLAK GA VVVYEKED LGG AKT T+DG  LDLGFMVF+RV
Sbjct  3    RMRMAVVGGGVSGLAAAYVLAKDGAEVVVYEKEDRLGGQAKTATIDGTPLDLGFMVFSRV  62

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW
Sbjct  63   IYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFW  119



>ref|XP_006431328.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
 gb|ESR44568.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
Length=585

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1    MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKN LNPYFW
Sbjct  61   SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNFLNPYFW  116



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   189 bits (481),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+V VVGAGI+GL+SAY LAK G  VV+YEKE ++GGHAKTV +DGV+LDLGF++FNRVT
Sbjct  1    MKVGVVGAGINGLISAYALAKCGVKVVIYEKEHFIGGHAKTVAVDGVELDLGFIIFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            YP MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF
Sbjct  61   YPYMMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYF  115



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   189 bits (481),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AV+G GISGL+SAYVL K G  VV+YEKE  LGGHA TVT   VD DLGFMVFNRVT
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVVLYEKEGDLGGHANTVTFHDVDSDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL NPYFW
Sbjct  61   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNPYFW  116



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   189 bits (480),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 85/116 (73%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+G GISGL +A+VLA+ G  VV+YEKE+ LGGHA+TV  DGVD+D+GFMVFNRVT
Sbjct  1    MRVAVIGGGISGLGAAHVLARDGVEVVLYEKEENLGGHARTVRFDGVDVDIGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE LGVD+E+SD SFSVSLD+G G EWGSRNG S LFAQK N+ NP+FW
Sbjct  61   YPNMMEFFEDLGVDLEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVFNPHFW  116



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   188 bits (478),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 87/102 (85%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  349  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  528
            +AY  A+GGA VVVYEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVTYPNMMELFESL VD
Sbjct  15   AAYEAARGGAKVVVYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVTYPNMMELFESLRVD  74

Query  529  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            MEISDMSFSVSLD G G EWGSRNG  GLFAQK N+LNPYFW
Sbjct  75   MEISDMSFSVSLDEGRGCEWGSRNGLLGLFAQKSNVLNPYFW  116



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   187 bits (475),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 83/101 (82%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  352  AYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVDM  531
            AY+L  GG  VV+YEKEDYLGGHAKTVT+DG  LDLGFMVFNRVTYPNMME FE+LGVDM
Sbjct  20   AYILEGGGVEVVLYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRVTYPNMMEFFETLGVDM  79

Query  532  EISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            E+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW
Sbjct  80   ELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFW  120



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   187 bits (474),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  349  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  528
            +AY  A+GGA VVVYEKEDYLGGHAKTV+ +GVDLDLGFMVFNRVTYPNMMELFESLGV+
Sbjct  15   AAYEAARGGAKVVVYEKEDYLGGHAKTVSFNGVDLDLGFMVFNRVTYPNMMELFESLGVE  74

Query  529  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFW
Sbjct  75   MEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFW  116



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   186 bits (472),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  349  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  528
            +AY   +GGA VVVYEKEDYLGGHAKTV++DGVDLDLGFMVFNRVTYPNMMELFESLGVD
Sbjct  15   AAYEAVRGGAKVVVYEKEDYLGGHAKTVSIDGVDLDLGFMVFNRVTYPNMMELFESLGVD  74

Query  529  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            MEISDMSFSVSLD G G EWG RNG   LFAQK N+LNPYFW
Sbjct  75   MEISDMSFSVSLDEGQGCEWGGRNGLWSLFAQKSNVLNPYFW  116



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG GISGL SAYVLA+ G  VV+YE+++ LGGHAKTV  DG D+DLGFM+FNRVT
Sbjct  1    MRVAVVGGGISGLGSAYVLAREGVEVVLYERDENLGGHAKTVRFDGADVDLGFMIFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME+SDMSFSVSL+NG G EWGSRNGFS LFAQK N+ N +FW
Sbjct  61   YPNMMELFEDLGVDMEVSDMSFSVSLENGGGLEWGSRNGFSSLFAQKSNVFNTHFW  116



>ref|XP_006350408.1| PREDICTED: uncharacterized protein LOC102579763 isoform X2 [Solanum 
tuberosum]
Length=812

 Score =   184 bits (468),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  483
            M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1    MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFW
Sbjct  61   TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFW  117



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   184 bits (467),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  483
            M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1    MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFW
Sbjct  61   TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFW  117



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   184 bits (466),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 89/117 (76%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  483
            MRVAV+G GISGL SAYVLAK GA VVVYEKED LGGHA KTV   GVD+DLGF+ FN  
Sbjct  1    MRVAVIGGGISGLASAYVLAKAGAEVVVYEKEDCLGGHANKTVNYKGVDVDLGFLAFNPA  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            +YPNM E FES+GVDME+SDMSFSVS+D G GYEWGSR G S LFAQKKN  NPYFW
Sbjct  61   SYPNM-EFFESIGVDMELSDMSFSVSIDKGKGYEWGSRKGLSSLFAQKKNSFNPYFW  116



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +1

Query  322  VGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNM  498
            +G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRVTYPNM
Sbjct  1    IGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRVTYPNM  60

Query  499  MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            ME FE L VDME+SDMSF+VSLDNG G EWGSRNG SGLFAQ+KN+LNPYFW
Sbjct  61   MEFFEKLAVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQRKNVLNPYFW  112



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+G G SGL +A+VLA+ G  VV+YEKE+ LGGHAKTV  DGVD+D+GFMVFNRV 
Sbjct  1    MRVAVIGGGTSGLGAAHVLARDGVEVVLYEKEENLGGHAKTVRFDGVDVDIGFMVFNRVM  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMME FE LGVDME+SD SFSVSLD+G G EWGSRNG S LFAQK N+LNP+FW
Sbjct  61   YPNMMEFFEDLGVDMEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVLNPHFW  116



>gb|KJB28512.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=828

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>gb|KJB28513.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=816

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   182 bits (461),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 81/102 (79%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  349  SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  528
            +AY LAK G  VV++EKEDYLGGHAKTV  DG+DLDLGFMVFNRVTYPNMMELFESLG++
Sbjct  15   AAYELAKAGVNVVLHEKEDYLGGHAKTVHFDGIDLDLGFMVFNRVTYPNMMELFESLGIE  74

Query  529  MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            ME+SDMSFSVSLD G G EWGSRNG  GLFAQK N +NPYFW
Sbjct  75   MELSDMSFSVSLDKGRGCEWGSRNGLRGLFAQKANAVNPYFW  116



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   181 bits (459),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   179 bits (455),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 4/120 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDL--GFMVF  474
            M+VAV+G GISGLVSA+VLA+  G   +V++EKE+ LGGHAKTV  DGVDLDL  GF+ F
Sbjct  1    MKVAVIGGGISGLVSAFVLAREDGVEELVLFEKEETLGGHAKTVRFDGVDLDLDLGFIAF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            NR+TYP+MME F++LGVD+E+ DMSFSVSLD+G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   NRITYPSMMEFFKNLGVDLEVLDMSFSVSLDSGKGCEWGSRNGLSSLFAQKKNILNPYFW  120



>gb|KJB28510.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=620

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>gb|KJB28511.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=681

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AVVG GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1    MKIAVVGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFESLG+DME SDMS SVSL+ G G EWGSRNG S LFAQK NL NPYFW
Sbjct  61   YPNMMELFESLGIDMEPSDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFW  116



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   178 bits (452),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 93/119 (78%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK---GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN  477
            MRVAV+G GISGL SAYVLA    GG  VV+YEK+D LGGHAKTV  D  D+DLGFMVFN
Sbjct  1    MRVAVIGGGISGLGSAYVLATRHGGGDEVVLYEKDDALGGHAKTVRFDSADVDLGFMVFN  60

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            RVTYPNMME FE LGVDME+SDMSFSVSLD+G G EWGSRNGFSGLFAQK N  NPYFW
Sbjct  61   RVTYPNMMEFFEELGVDMEVSDMSFSVSLDDGRGCEWGSRNGFSGLFAQKSNAFNPYFW  119



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            MRVAV+G+GISGL SAYVLAK  G   +V++EKE+ LGGHAKT+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGSGISGLGSAYVLAKEDGIEELVLFEKENSLGGHAKTMRFDGVDLDLGFTVFNP  60

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VT PNMME F++LGVD+E+S+MS SVSLDNG G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61   VTSPNMMEFFKNLGVDLEVSEMSLSVSLDNGTGCEWGSRNGLSSLFAQKKNVLNPYFW  118



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   176 bits (446),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFW
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFW  118



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   176 bits (445),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFW
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFW  118



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 100/139 (72%), Gaps = 23/139 (17%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGF-------  465
            MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV   LGF       
Sbjct  1    MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVTGILGFRNGTIMS  60

Query  466  ----------------MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  597
                            M+   VTYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSR
Sbjct  61   VNFVLLGTYILLDLIGMMARDVTYPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSR  120

Query  598  NGFSGLFAQKKNLLNPYFW  654
            NG S LFAQKKN+LNPYFW
Sbjct  121  NGLSSLFAQKKNILNPYFW  139



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   175 bits (443),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  477
            MRVAV+G G+ GL SAYVLA+  G   VV++EKE+  LGGHAKT+ LDGVDLD+GF+V N
Sbjct  1    MRVAVIGGGVCGLGSAYVLAREDGIEEVVLFEKEESVLGGHAKTMRLDGVDLDVGFIVCN  60

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             VT+PNMME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFW
Sbjct  61   PVTHPNMMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFW  119



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   175 bits (443),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1    MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNP+FW
Sbjct  61   VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPFFW  118



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   172 bits (436),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 3/119 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  477
            M+VAV+G G+SGL SA+ LA+  G   VV++EKE+ + GGH KT+  +GVDLD+GF+VFN
Sbjct  1    MKVAVIGGGVSGLGSAHDLAREDGIKEVVLFEKEESFFGGHGKTMRFEGVDLDIGFIVFN  60

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW
Sbjct  61   PVTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFW  119



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  283  RRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLG  462
            R++ E  +MRVAV+G GI GLVSAYVLAK G  VVVYEK    GGHA+TV    +DLDL 
Sbjct  55   RQQTEYYRMRVAVIGGGIRGLVSAYVLAKAGVNVVVYEKGKQFGGHARTVNFHAIDLDLA  114

Query  463  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  642
            FM  N   +PN+++ F  LGVD+E SD+SFSVSLDNG GYEWG++ GFS LFAQKKN+ N
Sbjct  115  FMFLNPAKHPNVLDFFTGLGVDVETSDVSFSVSLDNGQGYEWGNQKGFSSLFAQKKNVFN  174

Query  643  PYFW  654
            PYFW
Sbjct  175  PYFW  178



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   171 bits (433),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M  AV+G GI GLVSAYVLAK G  VVVYEKED  GGHAKTV    +DLDLGF+  N  T
Sbjct  1    MGFAVIGGGIRGLVSAYVLAKAGVNVVVYEKEDQFGGHAKTVNFHAIDLDLGFLFLNPAT  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDN-GHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YP M+ELF+ LGVD+E SD+SFSVS D  GHGYEWG+ +GFS LFA +KN+LNPYFW
Sbjct  61   YPTMLELFDILGVDVEASDVSFSVSHDKLGHGYEWGTHHGFSSLFAHRKNMLNPYFW  117



>gb|KGN61579.1| hypothetical protein Csa_2G172490 [Cucumis sativus]
Length=143

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  483
            M+VAV+GAGI GLV +YVLAK G  VV++E+E+YLG H  +T+T DG DLDL  MVFN V
Sbjct  1    MKVAVIGAGIKGLVCSYVLAKAGVEVVLFEREEYLGSHRYRTITFDGFDLDLAIMVFNPV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T+PN M L E L V+ME S+MSFS+S+D G GYEWG+RN F+ LFAQK N+L+  FW
Sbjct  61   THPNTMALLEDLEVEMEESNMSFSISIDKGRGYEWGTRNCFASLFAQKNNILDLSFW  117



>gb|KGN61576.1| hypothetical protein Csa_2G172460 [Cucumis sativus]
Length=160

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  483
            M+VAV+GAGI GLV +YVLAK G  VV++E+E+YLG H  +T+T DG DLDL  MVFN V
Sbjct  1    MKVAVIGAGIKGLVCSYVLAKAGVEVVLFEREEYLGSHRYRTITFDGFDLDLAIMVFNPV  60

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            T+PN M L E L V+ME S+MSFS+S+D G GYEWG+RNG S LFAQK N+L+  FW
Sbjct  61   THPNTMALLEDLEVEMEESNMSFSISIDKGRGYEWGTRNGVSSLFAQKNNILDLSFW  117



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   165 bits (418),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 10/126 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDGVD------LDLGF  465
            MRVAVVGAG+SGL +A+ LA+ GG+ V VYEKEDYLGGHA+TV ++  D      LDLGF
Sbjct  1    MRVAVVGAGVSGLAAAHELARSGGSRVTVYEKEDYLGGHARTVAVEDADAASTVQLDLGF  60

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNL  636
            MVFNRVTYPNM+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N 
Sbjct  61   MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNA  120

Query  637  LNPYFW  654
            L+P FW
Sbjct  121  LSPSFW  126



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 92/118 (78%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVGAG+SGL +A+ LA+G A V VYE E+ LGGHA+T  +DGV LDLGFMVFNRVT
Sbjct  5    MRVAVVGAGVSGLAAAHELARGAARVTVYEAEEALGGHARTADVDGVHLDLGFMVFNRVT  64

Query  487  YPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N + P FW
Sbjct  65   YPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNAVRPAFW  122



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   162 bits (411),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 10/125 (8%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  471
            RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3    RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  639
            FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63   FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  640  NPYFW  654
            +P FW
Sbjct  123  SPAFW  127



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   163 bits (413),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 77/115 (67%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            R+AV+GAG+SGLV+AY L K G   VV+YEKE+Y GGHA+T   +G+ +DLGFMVFN+VT
Sbjct  3    RIAVIGAGVSGLVAAYTLCKAGCHEVVLYEKENYFGGHARTEDANGIAVDLGFMVFNQVT  62

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            YPNM+ LF+ LGVDME SDMSFSVSLD G G EWGS  G + +FAQK NL+NPYF
Sbjct  63   YPNMVSLFDELGVDMETSDMSFSVSLDGGKGCEWGS-TGLAAVFAQKSNLVNPYF  116



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   162 bits (411),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 10/126 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAG--VVVYEKEDYLGGHAKTVTLDG-----VDLDLGF  465
            MRVAVVGAG+SGL +A+ LA+ GAG  V VYEKED LGGHA+TV ++      V LDLGF
Sbjct  1    MRVAVVGAGVSGLAAAHELARSGAGARVTVYEKEDCLGGHARTVAVEDAAAGTVHLDLGF  60

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG---YEWGSRNGFSGLFAQKKNL  636
            MVFNRVTYPNM+E FE LGV+MEISDMSFSVS   G G    EWGSRNG SGL AQK N 
Sbjct  61   MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTQLGTGGSRCEWGSRNGISGLLAQKSNA  120

Query  637  LNPYFW  654
            ++P FW
Sbjct  121  ISPSFW  126



>ref|XP_010532687.1| PREDICTED: uncharacterized protein LOC104808653 isoform X3 [Tarenaya 
hassleriana]
Length=717

 Score =   160 bits (406),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  304  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  477
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFW  122



>ref|XP_010532686.1| PREDICTED: uncharacterized protein LOC104808653 isoform X2 [Tarenaya 
hassleriana]
Length=887

 Score =   162 bits (409),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  304  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  477
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFW  122



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   160 bits (405),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  304  KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  477
            +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4    EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
                PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW
Sbjct  64   PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFW  122



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 80/120 (67%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG---HAKTVTLDGVDLD-LGFMVF  474
            MRVAVVGAGISGLVSAYVLAK G  VV+YEKED+LG    H  T      D D +GFM+ 
Sbjct  1    MRVAVVGAGISGLVSAYVLAKAGVNVVLYEKEDHLGEEGIHGNTQQY-AFDFDHMGFMLL  59

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN++NPYFW
Sbjct  60   NPVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNVINPYFW  119



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   160 bits (404),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MR AV+G GISGL +A+ LAK G  VV+YEKE+ LGGHA+ V ++G+D+DL FMVFNRV+
Sbjct  1    MRFAVIGGGISGLGAAFELAKAGVEVVLYEKEELLGGHAQIVNVNGIDVDLNFMVFNRVS  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YP+  ELF+ LG+D++  DMS SVSLD G G EWGSRNGF  LFAQ  N L P FW
Sbjct  61   YPHTTELFDGLGIDVDAFDMSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFW  116



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   159 bits (401),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 80/116 (69%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M+VAV+G GI GLVSA VLAK GA VVVYEKE+ +GG AKT   +G+DLDLGF+ FN   
Sbjct  1    MKVAVIGGGIGGLVSACVLAKAGANVVVYEKEEQVGGQAKT--FNGIDLDLGFITFNPAM  58

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             P+ +ELF+SLGVD+E  +MSFSVSLDNG  YEWG+RNGFS LFAQK+N+LNPYFW
Sbjct  59   NPSTLELFDSLGVDVEACNMSFSVSLDNGQDYEWGTRNGFSSLFAQKQNVLNPYFW  114



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 10/125 (8%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  471
            RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3    RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  639
            FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63   FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  640  NPYFW  654
            +P FW
Sbjct  123  SPAFW  127



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   156 bits (395),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG-HAKTVT-LDGVDLDLGFMVFNR  480
            MRVAVVG G SGL+S Y+LAK G  VV+YEKE  LGG HA TVT  DG +LD+G + F  
Sbjct  1    MRVAVVGGGTSGLISGYILAKEGVKVVLYEKETRLGGGHANTVTATDGTELDIGLIGFCN  60

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VT PN  EL ESLG++M  +D SFSVSL  G G EWG+RNGFS LFAQKKNLLNPYFW
Sbjct  61   VTNPNTTELLESLGIEMGPTDTSFSVSLSGGQGCEWGNRNGFSSLFAQKKNLLNPYFW  118



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GLVSAYVLAK G  VVVYEKE+ +GGHAKTV+ D VDLDLG +  N   
Sbjct  1    MGVAVIGGGIQGLVSAYVLAKAGVNVVVYEKEEQVGGHAKTVSFDAVDLDLGLLFLNPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YP M+ELF+SL VD+E +D+SFSVS D G+GYEW S+ GFS   A KK +LNPY W
Sbjct  61   YPTMLELFDSLEVDVEATDVSFSVSHDKGNGYEWCSQYGFSNFLAHKKKMLNPYNW  116



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =   154 bits (389),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 9/124 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  468
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKE++LGG AKTV ++G     V +D+ FM
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEEHLGG-AKTVAVNGGSSGPVLVDVDFM  60

Query  469  VFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLN  642
            VFNRVTYPNMME FE LGV+ME SDMSFS S  L+ G+G+EWGSRNG S +  QK N L+
Sbjct  61   VFNRVTYPNMMEWFERLGVEMETSDMSFSASLRLNKGNGFEWGSRNGISSVLVQKSNFLS  120

Query  643  PYFW  654
            P FW
Sbjct  121  PRFW  124



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   153 bits (387),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GL+SAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLLSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            Y  ++ +F+SLGVD+E SD+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  61   YATLLHMFDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNW  117



>gb|KJB70810.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=838

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  492
            VAV+G GI GLVSAYV+AKGG  VVVYEKE  LG HA TV  D  DLDL F+  N  +Y 
Sbjct  4    VAVIGGGIRGLVSAYVVAKGGVDVVVYEKEKQLGRHAITVNFDATDLDLRFLFLNPASYA  63

Query  493  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             M+E+FESLGVD+E SD+SFSVS D G+GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  64   TMLEMFESLGVDVETSDVSFSVSHDKGNGYEWSSQYGFSNYFAQKKKLLNPFNW  117



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  492
            VAV+G GI GLVSAYV+AKGG  VVVYEKE  LG HA TV  D  DLDL F+  N  +Y 
Sbjct  4    VAVIGGGIRGLVSAYVVAKGGVDVVVYEKEKQLGRHAITVNFDATDLDLRFLFLNPASYA  63

Query  493  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             M+E+FESLGVD+E SD+SFSVS D G+GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  64   TMLEMFESLGVDVETSDVSFSVSHDKGNGYEWSSQYGFSNYFAQKKKLLNPFNW  117



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   153 bits (386),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            Y  ++++ +SLGVD+E SD+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  61   YATLLDIIDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNW  117



>gb|KJB12596.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=820

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            Y  ++++ +SLGVD+E  D+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  61   YATLLDIIDSLGVDVETPDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNW  117



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  480
            RVAVVGAG+SGL +A+ L + G     V VYE E+ LGGHA+T  +DGV LDLGFMVFNR
Sbjct  7    RVAVVGAGVSGLAAAHELCRAGGNGVRVTVYEAEERLGGHARTADVDGVQLDLGFMVFNR  66

Query  481  VTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L P FW
Sbjct  67   VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPGFW  126



>ref|XP_008664677.1| PREDICTED: uncharacterized protein LOC103643302 isoform X2 [Zea 
mays]
 tpg|DAA49063.1| TPA: hypothetical protein ZEAMMB73_143484 [Zea mays]
Length=873

 Score =   151 bits (382),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 8/123 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  471
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            FNRVT+ NMME FE LGV+ME SDMSFS S  L+ G G+EWG+RNG S +  QK NLL+P
Sbjct  61   FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  646  YFW  654
             FW
Sbjct  121  RFW  123



>ref|XP_008664676.1| PREDICTED: uncharacterized protein LOC103643302 isoform X1 [Zea 
mays]
Length=875

 Score =   151 bits (382),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 8/123 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  471
            MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2    MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            FNRVT+ NMME FE LGV+ME SDMSFS S  L+ G G+EWG+RNG S +  QK NLL+P
Sbjct  61   FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  646  YFW  654
             FW
Sbjct  121  RFW  123



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   151 bits (381),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1    MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            Y  ++++ +SLGVD+E  D+SFS+S D G +GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  61   YATLLDIIDSLGVDVETPDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNW  117



>ref|XP_002862680.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=181

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 82/110 (75%), Gaps = 18/110 (16%)
 Frame = +1

Query  328  AGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMME  504
            +GISGL SAYVLA  G   VV+YEKE+ LGGHAKTVT                 YPNMME
Sbjct  19   SGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVT-----------------YPNMME  61

Query  505  LFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  62   FFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFW  111



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   147 bits (371),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAVVG G+SGL +AYVLAK G  VVVYEKED LGG AKTV + G  LDLGF VF RV 
Sbjct  1    MRVAVVGGGVSGLAAAYVLAKDGVEVVVYEKEDALGGRAKTVDIGGTLLDLGFTVFTRVM  60

Query  487  YPNMMELFESLGVDMEISDM-SFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            +P  +EL ESLGVD E+ DM SFSVSLD G G EWG+RNG S LFA+K N LNPYFW
Sbjct  61   HPETIELLESLGVDRELCDMSSFSVSLDEGQGCEWGTRNGVSSLFARKTNALNPYFW  117



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   142 bits (359),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 9/125 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  465
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLL  639
            MVFNR+T PNMM  FE LG+++E SDMSFS S  LD G G+EWG+RNG SG+  QK NLL
Sbjct  62   MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  640  NPYFW  654
            +P FW
Sbjct  122  SPRFW  126



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 11/125 (9%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  468
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG  KT+ +D      V  DLG M
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGG--KTMAVDDGAGGRVPADLGCM  59

Query  469  VFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKNLL  639
            VFNR+T PNMM  FE LGV++E SDMSFS SL   D G G+EWGS NG SG+ AQK NLL
Sbjct  60   VFNRMTCPNMMRWFEDLGVEVETSDMSFSASLRLDDKGGGFEWGSHNGISGVLAQKSNLL  119

Query  640  NPYFW  654
            +P FW
Sbjct  120  SPRFW  124



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 9/125 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  465
            MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2    MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLL  639
            MVFNR+T PNMM  FE LG+++E SDMSFS S  LD G G+EWG+RNG SG+  QK NLL
Sbjct  62   MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  640  NPYFW  654
            +P FW
Sbjct  122  SPRFW  126



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   138 bits (348),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +1

Query  343  LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  522
            L +A+ LA  G  V +YEKEDY+GGHA+T+   G+ LD GFMVFNRVTYPNM++ FE  G
Sbjct  13   LTAAHTLASAGIQVTLYEKEDYVGGHARTIHDVGIGLDTGFMVFNRVTYPNMIDFFEQAG  72

Query  523  VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            V+ME SDMSFSVSL+ G G EWGS     GLFAQK+N++NP+F+
Sbjct  73   VEMEESDMSFSVSLNGGKGCEWGS-TSLGGLFAQKRNMINPFFF  115



>ref|XP_008677861.1| PREDICTED: uncharacterized protein LOC103652693 isoform X2 [Zea 
mays]
Length=834

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 11/127 (9%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  462
            +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18   EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  463  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  633
             +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77   PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  634  LLNPYFW  654
            LL+P FW
Sbjct  137  LLSPRFW  143



>ref|XP_008677860.1| PREDICTED: uncharacterized protein LOC103652693 isoform X1 [Zea 
mays]
Length=887

 Score =   137 bits (345),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 11/127 (9%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  462
            +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18   EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  463  FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  633
             +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77   PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  634  LLNPYFW  654
            LL+P FW
Sbjct  137  LLSPRFW  143



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   134 bits (338),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLG--GHAKTVTLDGVDLD--LGFMV  471
            MR+AV+G GI G+  A+ LAK G   VV+Y+K+DYLG   H KTV +DGVDLD  LGFM 
Sbjct  1    MRIAVIGGGICGVGVAFELAKAGIHQVVLYDKDDYLGETTHTKTVNIDGVDLDIDLGFMF  60

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FNRV+YPN+ EL +SLG+D+  SDMSFSVSL+ G G EWG+RNG   L+AQK N L P +
Sbjct  61   FNRVSYPNLTELMDSLGIDIVASDMSFSVSLNKGQGCEWGNRNGLRSLYAQKSNALKPSY  120

Query  652  W  654
            W
Sbjct  121  W  121



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   132 bits (332),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = +1

Query  343  LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  522
            L +A VL   G  VV+YE+E++    A T T+DG  +D+GF+  N VTY NM+ELFESLG
Sbjct  12   LTAARVLKDAGVDVVIYEREEW----APTFTVDGTRIDIGFL--NPVTYSNMVELFESLG  65

Query  523  VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            ++ E+SD+SFSVSLDNG GYEWG RNG S LFAQKKN+ NPY+W
Sbjct  66   LEAELSDVSFSVSLDNGRGYEWGIRNGLSSLFAQKKNVFNPYYW  109



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   127 bits (320),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M VAV+G GI GLVSAYVLAK G   VVYEKE+ LGG+AKTV  D +DLDLGF+  +   
Sbjct  1    MGVAVIGGGIKGLVSAYVLAKAGVDAVVYEKEEQLGGYAKTVNFDALDLDLGFLFLDPAR  60

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            Y  ++ +F+ LGVD+E SD+SFSVS D G +GYEW S+ GFS  FAQKK LLNP+ W
Sbjct  61   YATLLNMFDCLGVDVETSDVSFSVSHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNW  117



>ref|XP_002183150.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45368.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=949

 Score =   127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +1

Query  298  LLKMRVAVVGAGISGLVSAYVLA-KGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVF  474
            L   +VA+VG G++GL +A+ L+   GA V ++E E  LGGHA T  +DGVD+D+GFMV+
Sbjct  10   LTDQKVAIVGGGVAGLSAAWHLSVNTGAHVQLFEAESRLGGHAYTTNVDGVDVDIGFMVY  69

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N   YPNM+E F +LGV  E SDMS SVSLD G   EW S +G  GLFA ++ L++P F+
Sbjct  70   NETNYPNMVEWFRTLGVTQEDSDMSLSVSLDGGDTVEWSS-DGLDGLFANRRQLVSPPFY  128



>ref|XP_002451282.1| hypothetical protein SORBIDRAFT_05g026910 [Sorghum bicolor]
 gb|EES10270.1| hypothetical protein SORBIDRAFT_05g026910 [Sorghum bicolor]
Length=761

 Score =   125 bits (314),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 68/113 (60%), Positives = 78/113 (69%), Gaps = 13/113 (12%)
 Frame = +1

Query  352  AYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDG-------VDLDLGFMVFNRVTYPNMM  501
            A+ LA+ G G   V VYEKEDYLGG AKTV +DG       V +DLG MVFN V  PNMM
Sbjct  16   AHELARSGGGGVRVTVYEKEDYLGG-AKTVAVDGGAAADGRVAVDLGLMVFNPVRSPNMM  74

Query  502  ELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            E FE LGV+M+ SDMSFS S  L+ G G+EWGSRNG S +  QK NLL+P FW
Sbjct  75   EWFERLGVEMDTSDMSFSASMRLNKGKGFEWGSRNGMSSVLVQKSNLLSPRFW  127



>ref|WP_027873283.1| NADH-ubiquinone oxidoreductase subunit 6 [Melitea salexigens]
Length=446

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV----TLDGVDLDLGFMV  471
            K R+A++G+GISGL  A++L + G  + V+EK+D LGGH+ TV    T     +D GF+V
Sbjct  4    KQRIAIIGSGISGLSCAWLLQRSGHAITVFEKDDRLGGHSNTVEISTTAGTTAVDTGFIV  63

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN   YPN++ LF+ LGVD   +DMSF VSLD+G   E+   N  + +FAQK+NLL P F
Sbjct  64   FNDKCYPNLVNLFKQLGVDSLATDMSFGVSLDDGR-LEYSGSNSLATMFAQKRNLLRPRF  122

Query  652  W  654
            W
Sbjct  123  W  123



>ref|XP_005648777.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24233.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
Length=1165

 Score =   124 bits (310),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            + RVAVVG+GI+GL +A++L + GA V +YE E   GGH  T    G  +DLGF V+N  
Sbjct  8    RKRVAVVGSGITGLSAAWLLHRSGASVTLYESESRCGGHTLTDDSPGYPVDLGFQVYNLT  67

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            TYPN++ L E LGVD E SDMSF +S+D G   EWGSR G   +FAQ++NLL+P F
Sbjct  68   TYPNLVGLLEELGVDTEPSDMSFGLSIDGG-ALEWGSR-GLGAIFAQRRNLLSPGF  121



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   122 bits (306),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 32/116 (28%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFW
Sbjct  29   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFW  84



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   122 bits (306),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 32/116 (28%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1    MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFW
Sbjct  29   YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFW  84



>ref|XP_005824669.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
 gb|EKX37689.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
Length=1146

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT-VTLDGVDLDLGFMVFNRVT  486
            RVA++G+GISGL +A+++ K G  V +YE EDY GGH  T  T+ GV +DLGF VFNR T
Sbjct  8    RVAIIGSGISGLAAAWLMQKSGWKVTLYEAEDYFGGHTLTDETIPGVPVDLGFQVFNRTT  67

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            Y +  +  E+LGVD E SDMSF++S+D+G   EWGS N  S +FAQ++NL++P F
Sbjct  68   YGHFEQFLEALGVDSEESDMSFALSVDDGK-VEWGSHN-LSTIFAQRRNLVSPKF  120



>ref|WP_038500647.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium agaricidamnosum]
Length=429

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 6/120 (5%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  474
            M++AVVGAGISGL  AY LA+ G  V ++E  DY GGH+ T  V+LDGV   +D GF+VF
Sbjct  1    MKIAVVGAGISGLSCAYQLAQAGQDVTLFEAGDYFGGHSHTVDVSLDGVTHGVDTGFLVF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLD-NGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ELFE L V+   SDMSFSV +   G   EW   N    +FAQ++NLL+P F
Sbjct  61   NHATYPNLVELFERLQVETADSDMSFSVKMPLGGRTLEWAGAN-LDTVFAQRRNLLSPQF  119



>emb|CDG85105.1| flavin containing amine oxidoreductase family protein [Janthinobacterium 
agaricidamnosum NBRC 102515 = DSM 9628]
Length=448

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 6/120 (5%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  474
            M++AVVGAGISGL  AY LA+ G  V ++E  DY GGH+ T  V+LDGV   +D GF+VF
Sbjct  20   MKIAVVGAGISGLSCAYQLAQAGQDVTLFEAGDYFGGHSHTVDVSLDGVTHGVDTGFLVF  79

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLD-NGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ELFE L V+   SDMSFSV +   G   EW   N    +FAQ++NLL+P F
Sbjct  80   NHATYPNLVELFERLQVETADSDMSFSVKMPLGGRTLEWAGAN-LDTVFAQRRNLLSPQF  138



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   120 bits (301),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  2    VTYPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFW  59



>ref|WP_043631329.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium haemolyticum]
Length=425

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEDADYLGGHAHTVDITIDGVRFAVDTGFLV  64

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN++ LF  LG+    SDMSFSVSLD G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSVSLDQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  652  W  654
            W
Sbjct  123  W  123



>ref|WP_008347203.1| MULTISPECIES: NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia]
 gb|EKS69427.1| Amine oxidase, flavin-containing [Burkholderia sp. SJ98]
 gb|KDR29703.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia zhejiangensis]
Length=433

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
            + R+AV+GAGI+GL SAY+L++    V ++E  DYLGGH  TV   LDGV   +D GF+V
Sbjct  9    QQRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHTHTVDVALDGVQHPVDTGFLV  67

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN  TYPN++ LF+ LGV    SDM+FSVSLD G  +EW   N  + +FAQ++NL +P F
Sbjct  68   FNDRTYPNLIALFDELGVAAHRSDMTFSVSLDGGR-FEWAGTN-LNTVFAQRRNLFSPSF  125



>ref|WP_035824801.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium sp. 
RA13]
Length=437

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 80/124 (65%), Gaps = 10/124 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  474
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  639
            N  TYPN+++LF+ LGV+   SDMSFSV +  G        EW   N    +FAQ+ NLL
Sbjct  61   NHATYPNLVQLFDELGVEAADSDMSFSVKMPLGTASDARVLEWAGAN-LDTVFAQRSNLL  119

Query  640  NPYF  651
             P F
Sbjct  120  RPAF  123



>ref|WP_035725299.1| NADH-ubiquinone oxidoreductase subunit 6 [Fodinicurvata fenggangensis]
Length=442

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTL--DG--VDLDLGFMVF  474
            MR+A+VGAGI+GL +A++L++    V ++E ED LGGH+ TV+   DG  +D+D GF+V+
Sbjct  1    MRIAIVGAGITGLSAAWLLSRRHE-VTLFEAEDRLGGHSNTVSFQEDGRSIDVDTGFIVY  59

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N + YPN++ LF+ LGV  E SDMSF+VS DNG  +E+       GL AQ++NLL P FW
Sbjct  60   NELNYPNLVALFDHLGVASEPSDMSFAVSADNG-AFEYA--GSLPGLIAQRRNLLRPRFW  116



>ref|WP_043614801.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium violaceum]
Length=428

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 9/122 (7%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
              R+AV+G+GISGL +A+ L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGSGISGLATAHFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGY-EWGSRNGFSGLFAQKKNLLNPY  648
            FN  TYPN++ LF+ LG+    SDMSFSVSL  GHG  EW  RN    +F Q+ NLL+P 
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSL--GHGRLEWAGRN-LDSVFVQRGNLLSPG  122

Query  649  FW  654
            FW
Sbjct  123  FW  124



>gb|KDO54097.1| hypothetical protein CISIN_1g0029283mg, partial [Citrus sinensis]
Length=748

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/58 (90%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFW
Sbjct  1    VTYPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFW  58



>ref|WP_027232012.1| NADH-ubiquinone oxidoreductase subunit 6 [Phyllobacterium sp. 
UNC302MFCol5.2]
Length=449

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 86/119 (72%), Gaps = 6/119 (5%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG---VDLDLGFMVFN  477
            +++AV+G+GISG+ +A++L++    + VYE+E  +GGH+ TV + G   V +D GF+V+N
Sbjct  10   LKIAVIGSGISGMSAAWLLSQKHE-ITVYERETRIGGHSNTVIVPGEGGVAVDTGFIVYN  68

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
              TYPN+  LF  LGV+   S+MSF+VSLD+G     G+  GFSGLFAQ++NL+NP FW
Sbjct  69   EQTYPNLTALFALLGVETAASEMSFAVSLDSGRLEYSGT--GFSGLFAQQRNLVNPRFW  125



>ref|WP_019104394.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium sp. 
C-61]
Length=425

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEAADYLGGHAHTVDITMDGVRFAVDTGFLV  64

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN++ LF  LG+    SDMSFSVSL  G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSVSLGQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  652  W  654
            W
Sbjct  123  W  123



>ref|WP_043581068.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium subtsugae]
Length=428

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
              R+AV+G GI+GL +AY L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGGGIAGLATAYFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN  TYPN++ LF+ LG+    SDMSFSVSL  G   EW  R+    +F Q++NLL+P F
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSLGQGR-LEWAGRD-LDSVFVQRRNLLSPGF  123

Query  652  W  654
            W
Sbjct  124  W  124



>ref|WP_034748929.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
 gb|EZP40678.1| Amine oxidase, flavin-containing [Janthinobacterium lividum]
Length=436

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  474
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG-----YEWGSRNGFSGLFAQKKNLL  639
            N  TYPN+++LF+ LGV+   SDMSFSV +  G        EW   N    +F Q+ NLL
Sbjct  61   NHATYPNLVQLFDELGVEAADSDMSFSVKMPLGTASDARVLEWAGAN-LDTVFTQRSNLL  119

Query  640  NPYF  651
             P F
Sbjct  120  RPAF  123



>ref|WP_016347695.1| amine oxidase [Burkholderia sp. RPE64]
 dbj|BAN26986.1| amine oxidase [Burkholderia sp. RPE64]
Length=427

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVF  474
             R+AV+GAGI+GL SAY+L++    V ++E  DYLGGHA TV   LDGV   +D GF+VF
Sbjct  10   QRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHAHTVDVELDGVRHPVDTGFLVF  68

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ LF+ LGV    SDM+FSVSLD G  +EW   N  + +FAQ+++L +P F
Sbjct  69   NDRTYPNLVALFDELGVTTHRSDMTFSVSLDGGR-FEWAGTN-LNTVFAQRRHLFSPTF  125



>ref|WP_044459099.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. UR51a]
 gb|KIV66208.1| Amine oxidase, flavin-containing [Rhizobium sp. UR51a]
Length=457

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D LGGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRLGGHSNTVTFDTKNGPIHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_043590453.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium haemolyticum]
Length=425

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
            +  +AV+GAGISGL  A+ LA+G   + ++E  DYLGGHA TV  T+DGV   +D GF+V
Sbjct  6    RQHIAVIGAGISGLACAHFLARGH-NITLFEAADYLGGHAHTVDITMDGVRFAVDTGFLV  64

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN++ LF  LG+    SDMSFS+SL  G   EW   N    +FAQ++NLL+P F
Sbjct  65   YNDRTYPNLIALFAELGIVSHPSDMSFSISLGQGQ-LEWAGSN-LDTVFAQRRNLLSPGF  122

Query  652  W  654
            W
Sbjct  123  W  123



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   116 bits (290),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 51/58 (88%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFW
Sbjct  2    VTYPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFW  59



>ref|WP_010394901.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
Length=436

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 10/124 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMVF  474
            M++AVVGAGI+GL  AY LA+ G  V +YE  +Y GGH+ TV  TLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQAGQDVTLYEAGEYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSL-----DNGHGYEWGSRNGFSGLFAQKKNLL  639
            N  TYPN+++LF+ LGV+   SDMSFSV +      +    EW   N    +FAQ+ NLL
Sbjct  61   NHATYPNLVQLFQELGVEAADSDMSFSVKMPLGTTPDARVLEWAGAN-LDTVFAQRSNLL  119

Query  640  NPYF  651
             P F
Sbjct  120  RPAF  123



>ref|WP_019566747.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium sp. 10MFCol1.1]
Length=457

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLD  456
            K++  +  +AV+G GISGL +A++L+K    V V+E  D +GGH+ TVT       V +D
Sbjct  7    KRKDSRRNIAVIGTGISGLSAAWLLSKRH-DVTVFEAADRVGGHSNTVTFKTEQGVVSVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N VTYPN+  LF++LGV    SDMSF+VSLD+G G+E+   +GF GL AQK+N 
Sbjct  66   TGFIVYNEVTYPNLTALFKTLGVTTAASDMSFAVSLDDG-GFEYSGGSGF-GLLAQKRNA  123

Query  637  LNPYFW  654
            + P FW
Sbjct  124  VRPRFW  129



>ref|WP_018152743.1| hypothetical protein [Leeia oryzae]
Length=425

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMV  471
            + R+AV+G+GISGL SAY L +G   V ++E  +YLGGH  TV  TLDGV    D GF+V
Sbjct  5    RQRIAVIGSGISGLASAYFLNRGHE-VTLFEAGNYLGGHTHTVDVTLDGVTHPADTGFLV  63

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN+ TYPN++ LF  L V    +DMSF VS+D GH  EW   N    +FAQ++N+L+P F
Sbjct  64   FNQHTYPNLIALFAELAVSSHATDMSFGVSMDQGH-LEWAGTN-LDTVFAQRRNMLSPRF  121



>ref|WP_004431402.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium tumefaciens]
 gb|EHJ97303.1| amine oxidase, flavin-containing [Agrobacterium tumefaciens 5A]
Length=457

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLD  456
            K++  +  +AV+G GISGL +A++L+K    V V+E  D +GGH+ TVT       V +D
Sbjct  7    KRKDSRRNIAVIGTGISGLSAAWLLSKRH-DVTVFEAADRVGGHSNTVTFKTEQGVVSVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N VTYPN+  LF++LGV    SDMSF+VSLD+G G+E+   +GF GL AQK+N 
Sbjct  66   TGFIVYNEVTYPNLTALFKTLGVTTAASDMSFAVSLDDG-GFEYSGGSGF-GLLAQKRNA  123

Query  637  LNPYFW  654
            + P FW
Sbjct  124  VRPRFW  129



>ref|WP_013761036.1| MULTISPECIES: NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium]
 gb|ADY65844.1| amine oxidase, flavin-containing [Agrobacterium sp. H13-3]
 gb|AHK04493.1| amine oxidase [Agrobacterium tumefaciens LBA4213 (Ach5)]
Length=457

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLD  456
            K++  +  +AV+G GISGL +A++L+K    V V+E  D +GGH+ TVT       V +D
Sbjct  7    KRKDSRRNIAVIGTGISGLSAAWLLSKRH-DVTVFEAADRVGGHSNTVTFKTEQGVVSVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N VTYPN+  LF++LGV    SDMSF+VSLD+G G+E+   +GF GL AQK+N 
Sbjct  66   TGFIVYNEVTYPNLTALFKTLGVTTAASDMSFAVSLDDG-GFEYSGGSGF-GLLAQKRNA  123

Query  637  LNPYFW  654
            + P FW
Sbjct  124  VRPRFW  129



>ref|WP_043596502.1| NADH-ubiquinone oxidoreductase subunit 6 [Chromobacterium violaceum]
Length=428

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
              R+AV+G+GI+GL +A+ L++  A V ++E  DYLGGH  TV  T+DG D  +D GF+V
Sbjct  7    PQRIAVIGSGIAGLATAHFLSRRHA-VTLFEAADYLGGHTHTVDVTVDGRDFAVDTGFLV  65

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN  TYPN++ LF+ LG+    SDMSFSVSL  G   EW  RN    +F Q+ NLL+P F
Sbjct  66   FNDRTYPNLIALFQELGIPSHPSDMSFSVSLGQGR-LEWAGRN-LDSVFVQRGNLLSPGF  123

Query  652  W  654
            W
Sbjct  124  W  124



>ref|WP_025594884.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium tumefaciens]
Length=457

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLD  456
            K++  +  +AV+G GISGL +A++L+K    V V+E  D +GGH+ TVT       V +D
Sbjct  7    KRKDSRRNIAVIGTGISGLSAAWLLSKR-HDVTVFEAADRVGGHSNTVTFKTEQGVVSVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N VTYPN+  LF++LGV    SDMSF+VSLD+G G+E+   +GF GL AQK+N 
Sbjct  66   TGFIVYNEVTYPNLTALFKTLGVTTAASDMSFAVSLDDG-GFEYSGGSGF-GLLAQKRNA  123

Query  637  LNPYFW  654
            + P FW
Sbjct  124  VRPRFW  129



>ref|WP_040661572.1| NADH-ubiquinone oxidoreductase subunit 6 [Neptuniibacter caesariensis]
Length=456

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 82/123 (67%), Gaps = 7/123 (6%)
 Frame = +1

Query  298  LLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGF  465
            L   ++AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV  +     +D+D GF
Sbjct  6    LRPKKIAVVGSGISGLSCAWLLNKA-HDVTLYEKDDRLGGHSNTVQFELEEKLIDVDTGF  64

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            +VFN V YPN++ELF +L VD   +DMSF+VS++ G     G+  G SGL AQK NLL P
Sbjct  65   IVFNPVNYPNLVELFNTLDVDTCDTDMSFAVSINRGQLEYSGT--GLSGLLAQKSNLLKP  122

Query  646  YFW  654
             FW
Sbjct  123  SFW  125



>gb|EAR60721.1| hypothetical protein MED92_13638 [Neptuniibacter caesariensis]
Length=460

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 82/123 (67%), Gaps = 7/123 (6%)
 Frame = +1

Query  298  LLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGF  465
            L   ++AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV  +     +D+D GF
Sbjct  10   LRPKKIAVVGSGISGLSCAWLLNKA-HDVTLYEKDDRLGGHSNTVQFELEEKLIDVDTGF  68

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            +VFN V YPN++ELF +L VD   +DMSF+VS++ G     G+  G SGL AQK NLL P
Sbjct  69   IVFNPVNYPNLVELFNTLDVDTCDTDMSFAVSINRGQLEYSGT--GLSGLLAQKSNLLKP  126

Query  646  YFW  654
             FW
Sbjct  127  SFW  129



>ref|WP_034784946.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
 gb|KHA77131.1| NADH-ubiquinone oxidoreductase subunit 6 [Janthinobacterium lividum]
Length=436

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 10/124 (8%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGVD--LDLGFMVF  474
            M++AVVGAGI+GL  AY LA+ G  V +YE  DY GGH+ T  VTLDGV   +D GF+VF
Sbjct  1    MKIAVVGAGIAGLSCAYRLAQSGQDVTLYEAGDYFGGHSHTVDVTLDGVTHGVDTGFLVF  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSL-----DNGHGYEWGSRNGFSGLFAQKKNLL  639
            N  TYP++++LF+ LGV+   SDMSFSV +      +    EW   N    +FAQ+ NLL
Sbjct  61   NHATYPHLVQLFQELGVEAADSDMSFSVKMPLGATPDARVLEWAGAN-LGTVFAQRSNLL  119

Query  640  NPYF  651
             P F
Sbjct  120  RPAF  123



>ref|WP_004433137.1| amine oxidase, flavin-containing [Agrobacterium tumefaciens]
 gb|EMS98602.1| amine oxidase, flavin-containing [Agrobacterium tumefaciens str. 
Cherry 2E-2-2]
Length=457

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDG----VDLD  456
            KKE  + R+AVVG GISGL +A++L++    V V+E  D +GGH  TV        V +D
Sbjct  7    KKEQSRRRIAVVGTGISGLSAAWLLSQRH-DVTVFEAADRIGGHTNTVAFSTDHGQVHVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N  TYPN+  LF+ LGV    S+MSF+VSLDNG G+E+    G  GL AQK N+
Sbjct  66   TGFIVYNEQTYPNLTALFQKLGVATAASNMSFAVSLDNG-GFEYSGGTG-PGLLAQKSNI  123

Query  637  LNPYFW  654
            L P FW
Sbjct  124  LRPRFW  129



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFW
Sbjct  1    VTYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFW  58



>ref|WP_022563112.1| conserved hypothetical protein; putative oxidoreductase (with 
FAD/NAD(P)-binding domain) [Rhizobium sp. IRBG74]
 ref|YP_008648070.1| conserved hypothetical protein; putative oxidoreductase (with 
FAD/NAD(P)-binding domain) [Rhizobium sp. IRBG74]
 emb|CDI10582.1| conserved hypothetical protein; putative oxidoreductase (with 
FAD/NAD(P)-binding domain) [Rhizobium sp. IRBG74]
Length=457

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D +GGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRVGGHSNTVTFDTKNGPIHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_035200438.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium tumefaciens]
Length=457

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 85/126 (67%), Gaps = 7/126 (6%)
 Frame = +1

Query  289  KKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLD  456
            K++  +  +AV+G GISGL +A++L+K    V V+E  D +GGH+ T T       V +D
Sbjct  7    KRKDSRRNIAVIGTGISGLSAAWLLSKRH-DVTVFEAADRVGGHSNTATFKTEQGAVSVD  65

Query  457  LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  636
             GF+V+N VTYPN+  LF++LGV    SDMSF+VSLD+G G+E+   +GF GL AQK+N 
Sbjct  66   TGFIVYNEVTYPNLTALFKTLGVTTAASDMSFAVSLDDG-GFEYSGGSGF-GLLAQKRNA  123

Query  637  LNPYFW  654
            + P FW
Sbjct  124  VRPRFW  129



>ref|WP_035208627.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium tumefaciens]
 gb|KAJ35379.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium tumefaciens]
Length=457

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D +GGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRVGGHSNTVTFDTKNGPIHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_034497400.1| NADH-ubiquinone oxidoreductase subunit 6 [Agrobacterium sp. 33MFTa1.1]
Length=457

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D +GGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRVGGHSNTVTFDTKNGPIHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_037092074.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. H41]
 gb|KGE81871.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. H41]
Length=457

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D +GGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRVGGHSNTVTFDTRNGPIHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_020694301.1| hypothetical protein [Reyranella massiliensis]
Length=449

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            + +AVVG+GI+GL +A++L++    V ++E E+ LGGH+ TV   GV +D GF+V+N VT
Sbjct  14   LTIAVVGSGIAGLSAAWLLSRRHR-VTLFEAENRLGGHSHTVEAAGVAVDTGFIVYNDVT  72

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPN+  LF  L V+ + SDMSF+VSLD+G   E+ S  GFSGLFAQ +N ++P FW
Sbjct  73   YPNLAALFRHLDVETKPSDMSFAVSLDDGR-LEY-SGTGFSGLFAQGRNAMSPRFW  126



>ref|WP_042317992.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia caledonica]
Length=433

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 82/129 (64%), Gaps = 8/129 (6%)
 Frame = +1

Query  280  VRRKKELLK-MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD  450
             RR   L +  RVAV+GAGI+GL SAY+LA+    V ++E   YLGGH  TV   LDG  
Sbjct  4    ARRTAPLTRGSRVAVIGAGIAGLASAYLLARNHR-VTLFESAGYLGGHTNTVDVRLDGRS  62

Query  451  --LDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQ  624
              +D GF+VFN  TYPN++ LF  LGV    SDMSFSVSLD G   EW   N  + LFAQ
Sbjct  63   HPVDTGFLVFNDRTYPNLIALFAELGVKSHASDMSFSVSLDKGR-LEWAGTN-LNTLFAQ  120

Query  625  KKNLLNPYF  651
            ++N+ +P F
Sbjct  121  RRNMFSPTF  129



>ref|WP_009340169.1| NADH-ubiquinone oxidoreductase subunit 6 [Afipia sp. 1NLS2]
 gb|EFI51451.1| amine oxidase [Afipia sp. 1NLS2]
 emb|CEG09086.1| protoporphyrinogen oxidase [Afipia felis]
Length=459

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  492
            +AVVG+GISGL +A++L+K    VV+YE ++ LGGH+ TV   G+ +D GF+VFN  TYP
Sbjct  26   IAVVGSGISGLSAAWLLSKRHR-VVLYEADNRLGGHSHTVDAGGLAVDTGFIVFNENTYP  84

Query  493  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N+  LF+ +GV  + SDMSF+VSLD+G     G+  G  GLFAQ++N ++P FW
Sbjct  85   NLTALFDHIGVSTKCSDMSFAVSLDDGRLEYSGT--GLLGLFAQRRNAISPRFW  136



>ref|WP_021079312.1| 16S rRNA (-2'-O)-methyltransferase [Bradyrhizobium sp. DFCI-1]
 gb|ERF85822.1| 16S rRNA (-2'-O)-methyltransferase [Bradyrhizobium sp. DFCI-1]
Length=450

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 79/121 (65%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTL----DGVDLDLGFMV  471
            K+ VA+VG GISGL +A++L++    V VYEK D +GGH+ TVT       V +D GF+V
Sbjct  6    KLNVAIVGTGISGLSAAWLLSQR-HDVTVYEKSDRIGGHSNTVTASLGGQRVAVDTGFIV  64

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FNR TYPN+  LF  LGV  + S+MS SVSLD G   E+ S  G SGL AQ  NLL P F
Sbjct  65   FNRKTYPNLTALFRHLGVPTQASEMSLSVSLDQG-DLEY-SGTGLSGLLAQPGNLLRPRF  122

Query  652  W  654
            W
Sbjct  123  W  123



>ref|WP_035507039.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. MP-1]
 gb|KAK44352.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. MP-1]
Length=433

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMV  471
            + R+AV+GAGI+GL SAY+L++    V ++E  DYLGGH  TV   LDG+   +D GF+V
Sbjct  9    QQRIAVIGAGIAGLASAYLLSRAHR-VTLFEAADYLGGHTHTVDVALDGMQHPVDTGFLV  67

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN  TYPN++ LF+ LGV    S+M+FSVSLD G  +EW   N  + +FAQ++NL +P F
Sbjct  68   FNDRTYPNLIALFDELGVLAHRSEMTFSVSLDGGR-FEWAGTN-LNTVFAQRRNLFSPSF  125



>ref|WP_036551677.1| NADH-ubiquinone oxidoreductase subunit 6 [Neptunomonas japonica]
Length=462

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 13/132 (10%)
 Frame = +1

Query  271  VHAVRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD---  441
            + A+R KK      +AVVG+GISGL  A++L K    V +YEK+D LGGH+ TV+ D   
Sbjct  3    ITAIRPKK------IAVVGSGISGLSCAWLLNKAHQ-VTLYEKDDRLGGHSNTVSFDLEN  55

Query  442  -GVDLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLF  618
              VD+D GF+VFN V YPN+++ F++L V    +DMSF +S++ G     G+  G SGL 
Sbjct  56   NHVDVDTGFIVFNPVNYPNLVKFFKTLDVTTCETDMSFGISVNQGELEYSGT--GLSGLL  113

Query  619  AQKKNLLNPYFW  654
            AQK+NL+ P FW
Sbjct  114  AQKRNLIRPSFW  125



>ref|WP_036861967.1| NADH-ubiquinone oxidoreductase subunit 6 [Porticoccus hydrocarbonoclasticus]
Length=462

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            +  +AV+G+GISGL  A++L++    V ++EK+D LGGH+ TVT D     + +D GF+V
Sbjct  7    RKNIAVIGSGISGLSCAWLLSRS-QNVTLFEKDDRLGGHSNTVTFDLDKRAISVDTGFIV  65

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N V YPN+++ FE LGV    +DMSFSVS++ G     GS  G SGL AQK+NL  P F
Sbjct  66   YNPVNYPNLVKFFEQLGVTTCETDMSFSVSVNGGELEYSGS--GLSGLLAQKRNLFRPAF  123

Query  652  W  654
            W
Sbjct  124  W  124



>ref|WP_038570879.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia cenocepacia]
 gb|AIO38010.1| FAD dependent oxidoreductase family protein [Burkholderia cenocepacia]
Length=434

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARQHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  127



>ref|WP_002717506.1| hypothetical protein [Afipia felis]
 gb|EKS29911.1| hypothetical protein HMPREF9697_02439 [Afipia felis ATCC 53690]
Length=459

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  492
            +AVVG+GISGL +A++L+K    VV+YE ++ LGGH+ TV   G+ +D GF+VFN  TYP
Sbjct  26   IAVVGSGISGLSAAWLLSKRHR-VVLYEADNRLGGHSHTVDAGGLAVDTGFIVFNENTYP  84

Query  493  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N+  LF+ +GV  + SDMSF+VSLD+G     G+  G  GLFAQ++N ++P FW
Sbjct  85   NLTALFDHIGVATKCSDMSFAVSLDDGRLEYSGT--GLLGLFAQRRNAISPRFW  136



>ref|WP_012218188.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia multivorans]
 gb|ABX19491.1| amine oxidase [Burkholderia multivorans ATCC 17616]
 dbj|BAG47516.1| predicted NAD/FAD-binding protein [Burkholderia multivorans ATCC 
17616]
 gb|AIO72087.1| FAD dependent oxidoreductase family protein [Burkholderia multivorans]
Length=434

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARQHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  127



>ref|WP_006699863.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium lupini]
 gb|EKJ94076.1| amine oxidase [Rhizobium lupini HPC(L)]
Length=457

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMV  471
            + R+A+VG GISGL +A++L++    V V+E  D +GGH+ TVT D     + +D GF+V
Sbjct  12   RRRIAIVGTGISGLSAAWLLSQRH-DVTVFEAADRVGGHSNTVTFDTKNGPMHVDTGFIV  70

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  L V    S+MSF+VSLDNG G+E+   NGF GL AQK+N L P F
Sbjct  71   YNDWTYPNLTALFRKLNVPTAASNMSFAVSLDNG-GFEYSGGNGF-GLLAQKRNALKPRF  128

Query  652  W  654
            W
Sbjct  129  W  129



>ref|WP_025097256.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. A1]
Length=433

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLVALFDELGVRTHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSF  127



>ref|WP_017234374.1| hypothetical protein [Pandoraea sp. B-6]
Length=434

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG--VDLDLGFMVF  474
             RVAVVGAGI+GL SAY LA+    V V+E  DY GGH  TV  TLDG    +D GF+VF
Sbjct  12   QRVAVVGAGIAGLASAYFLARKH-HVTVFEAGDYAGGHTNTVDVTLDGHCAPVDTGFLVF  70

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  71   NDRTYPNLIALFDELGVSAIASDMSFSVSVDGG-ALEWAGTN-LNTVFAQRRNLYSPRF  127



>ref|WP_040705051.1| NADH-ubiquinone oxidoreductase subunit 6, partial [Oceanicaulis 
alexandrii]
Length=414

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGFMVF  474
            MR+AV+GAG+SGL +A+ L +    V V+EK D LGGHA TV +D     +D+D GF+VF
Sbjct  1    MRIAVIGAGVSGLGAAWAL-RNVHDVTVFEKRDRLGGHANTVRIDYDGAQIDVDTGFIVF  59

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  642
            N + YPN++ LFE LGVD   +DMSF  SLD    +EW S NG  GLFA   NL N
Sbjct  60   NPLNYPNLIALFEHLGVDSHRTDMSFGFSLD--RRFEWSS-NGLKGLFADPSNLFN  112



>ref|WP_034192796.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. WP42]
Length=436

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  14   RIAVVGAGIAGLASAYLLARRHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  72

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  73   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  128



>ref|WP_014725774.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. KJ006]
 gb|AFJ89735.1| Amine oxidase, flavin-containing [Burkholderia sp. KJ006]
Length=436

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  14   RIAVVGAGIAGLASAYLLARRHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  72

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  73   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  128



>ref|XP_009410825.1| PREDICTED: protoporphyrinogen oxidase, chloroplastic/mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=84

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            MRVAV+GAGISGL SAY LAK G  VV+YEKEDYLGGHAKTVT DGVDLDLGFMVFNRV+
Sbjct  1    MRVAVIGAGISGLASAYTLAKAGVDVVLYEKEDYLGGHAKTVTFDGVDLDLGFMVFNRVS  60

Query  487  YPNMMELFESLGV  525
                   + S  +
Sbjct  61   ASQSTPRWSSFRI  73



>ref|WP_013699783.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
 gb|AEA62470.1| amine oxidase [Burkholderia gladioli BSR3]
Length=432

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSF  127



>ref|WP_011880041.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia vietnamiensis]
 gb|ABO58835.1| amine oxidase [Burkholderia vietnamiensis G4]
Length=436

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  14   RIAVVGAGIAGLASAYLLARRHR-VTLFESADYLGGHTHTVDVELDGARHPVDTGFLVFN  72

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  73   DRTYPNLIALFDELGVAAHATDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  128



>ref|WP_017918374.1| MULTISPECIES: NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia]
 gb|KGC17323.1| FAD dependent oxidoreductase family protein [Burkholderia mallei]
Length=432

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDEGR-LEWAGTN-LNTVFAQRRNLFSPSF  127



>ref|WP_011295863.1| NADH-ubiquinone oxidoreductase subunit 6 [Cupriavidus pinatubonensis]
 gb|AAZ65421.1| FAD dependent oxidoreductase [Ralstonia eutropha JMP134]
Length=430

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG--VDLDLGFMVF  474
            +R+AVVGAGISGL +A++L++  A V ++E   YLGGH  TV  TL+G    +D GF+VF
Sbjct  11   LRIAVVGAGISGLATAWMLSRDHA-VTLFEAGHYLGGHTNTVDVTLEGFTCPVDTGFLVF  69

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ +FE+LGV    SDMSF+VSLD+G   EW   N  S +FAQ++N  +P F
Sbjct  70   NDRTYPNLVSMFEALGVRSHASDMSFAVSLDDGR-LEWAGSN-VSTVFAQRRNAFSPTF  126



>dbj|GAM27527.1| hypothetical protein SAMD00019534_107030 [Acytostelium subglobosum 
LB1]
Length=515

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 82/133 (62%), Gaps = 19/133 (14%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG---VDLDLGFMV  471
            M++AVVGAGISG+ +AY+LA+GG  V VYEK DYLGGH  TV  T +G   V  D GF+V
Sbjct  1    MKIAVVGAGISGMSAAYLLAQGGHQVTVYEKGDYLGGHTNTVDATFEGVGTVKADTGFLV  60

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG------------YEWGSRNGFSGL  615
            +N   YPN+M LF  LG++   SD+SF+ SL N  G             EWGS +G   +
Sbjct  61   YNEEKYPNLMRLFRELGIESADSDVSFAYSL-NARGSQDGASQSSRGEVEWGS-DGAKTV  118

Query  616  FAQKKNLLNPYFW  654
            FAQ  N+  P FW
Sbjct  119  FAQLSNIFRPSFW  131



>ref|XP_007512428.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
 emb|CCO17028.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
Length=1056

 Score =   114 bits (284),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 9/122 (7%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLGGHA----KTVTLDGVDLDLGFM  468
            K  V V+GAGISGL +AY+L +  A  V VYE E   GGHA    K+     +D+DLGF 
Sbjct  23   KQTVCVIGAGISGLSAAYLLHQSNAFAVTVYESEPTAGGHALTREKSKHAGELDVDLGFQ  82

Query  469  VFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPY  648
            VFN  TYP+++ LFE L V  E SDMSFS+  +     EWGS  G SG+FAQK+NL+NP 
Sbjct  83   VFNLTTYPHLVGLFEELRVKHEQSDMSFSLQSERT---EWGSL-GLSGIFAQKRNLINPK  138

Query  649  FW  654
            FW
Sbjct  139  FW  140



>ref|WP_018334542.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=414

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            + RVAV+GAG+SGL +AYVL +    V ++E E  LGGHA T  L+ V +D GF+V N  
Sbjct  3    RDRVAVIGAGVSGLTAAYVLQRAH-DVTLFEAESRLGGHAHTHDLEHVSVDSGFIVHNHA  61

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            TYPN++ LF  LGV  + S+MS SV  D+  G E+    G +GLFAQK+NL NP
Sbjct  62   TYPNLIRLFGELGVATQDSEMSMSVR-DDATGLEYAGARGAAGLFAQKRNLANP  114



>ref|WP_022958759.1| NADH-ubiquinone oxidoreductase subunit 6 [Spongiibacter tropicus]
Length=445

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV----TLDGVDLDLGFMVF  474
             R+AV+G+GISGL  A++L K    V +YE+++ LGGH+ TV    T   + +D GF+VF
Sbjct  5    QRIAVIGSGISGLSCAWLLNKEHE-VTLYEEDERLGGHSNTVDIMTTAGTIAVDTGFIVF  63

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N   YPN++ LF++LGV    +DMSF VSLDNG   E+   +  S LFAQK+NLL P FW
Sbjct  64   NEKCYPNLIALFDALGVKSLATDMSFGVSLDNGR-LEYSGSDSISTLFAQKRNLLRPRFW  122



>gb|ERJ39944.1| Amine oxidase, flavin-containing [Burkholderia sp. AU4i]
Length=428

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  7    RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVELDGARHPVDTGFLVFN  65

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  66   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  121



>ref|WP_042973675.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. AU4i]
Length=434

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVELDGARHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  127



>ref|WP_025662389.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. IBUN]
Length=446

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
             M++AVVG GI+GL +A++L+K    V V+E ++ +GGH  TV   GV +D GF+V+N  
Sbjct  12   PMKIAVVGTGIAGLSAAWLLSKRHE-VTVFEADNRVGGHCHTVNAGGVPVDTGFIVYNET  70

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+  LF  L V  + SDMSF+VS+D G   E+   N  +GLFAQ+ NL NP FW
Sbjct  71   TYPNLTALFAHLDVSTKASDMSFAVSIDGGQ-LEYAGTN-LAGLFAQRSNLANPRFW  125



>ref|WP_039370008.1| NADH-ubiquinone oxidoreductase subunit 6 [Mumia flava]
 gb|KHL08659.1| NADH-ubiquinone oxidoreductase subunit 6 [Mumia flava]
Length=434

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGARHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  127



>gb|EGD05972.1| amine oxidase [Burkholderia sp. TJI49]
Length=428

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  7    RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGARHPVDTGFLVFN  65

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  66   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  121



>ref|XP_005851729.1| hypothetical protein CHLNCDRAFT_29187, partial [Chlorella variabilis]
 gb|EFN59627.1| hypothetical protein CHLNCDRAFT_29187, partial [Chlorella variabilis]
Length=426

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTY  489
            RVAVVG+GISGL +A++L + GA V +YE E+  GGH  T T  G  +DLGF V+N  TY
Sbjct  5    RVAVVGSGISGLSAAFLLHRSGARVTLYESEESCGGHTLTDTSSGYPIDLGFQVYNLTTY  64

Query  490  PNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            P+++ LFE LGV+ + S+MSF++S+D G   EWGS +    +FAQ+ NL +  F
Sbjct  65   PHLVGLFEELGVETQPSEMSFALSVDGG-AVEWGS-HSLDTVFAQRSNLASSAF  116



>ref|WP_028160094.1| NADH-ubiquinone oxidoreductase subunit 6 [Bradyrhizobium japonicum]
Length=447

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTL---DG-VDLDLGFMV  471
            + R+AV+G GISG+ +A++L++    V VYE++  LGGH+ TV +   DG V +D GF+V
Sbjct  8    RKRIAVIGTGISGMSAAWLLSQR-HDVTVYERDARLGGHSNTVKVGMPDGTVPVDTGFIV  66

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N  TYPN+  LF  LGV    SDMSFSVSLD G   E+ S +  +GLFAQ++NLL P F
Sbjct  67   YNETTYPNLTALFAHLGVPTHASDMSFSVSLDGG-ALEY-SGSSLNGLFAQRRNLLRPRF  124

Query  652  W  654
            W
Sbjct  125  W  125



>ref|WP_036039189.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
 gb|KGE06711.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia gladioli]
Length=432

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AV+GAGI+GL SAY+LA+    V ++E  DYLGGHA TV   LDG    +D GF+VFN
Sbjct  13   RIAVIGAGIAGLASAYLLARQHR-VTLFEAADYLGGHAHTVDVELDGERHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLVALFDELGVRAHGSDMSFSVSVDGGR-LEWAGTN-LNTVFAQRRNLFSPSF  127



>ref|WP_012432094.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia phytofirmans]
 gb|ACD15464.1| FAD dependent oxidoreductase [Burkholderia phytofirmans PsJN]
Length=433

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            RVAV+GAGISGL SAY+LA+    V ++E   YLGGH  TV  TLDG    +D GF+VFN
Sbjct  15   RVAVIGAGISGLASAYLLARHHR-VTLFESAAYLGGHTNTVDVTLDGHTHPVDTGFLVFN  73

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF  LGV    SDM+FSVSLD G   EW      + +FAQ++NL +P F
Sbjct  74   DRTYPNLIALFAELGVQSHPSDMTFSVSLDEGR-LEWAG-TSLNTVFAQRRNLFSPTF  129



>ref|WP_028369081.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia sp. UYPR1.413]
Length=432

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            RVAVVGAGI+GL SAY+LA+    V ++E   Y GGHA TV   LDG    +D GF+VFN
Sbjct  15   RVAVVGAGIAGLASAYLLARRHQ-VTLFEASGYAGGHANTVDVELDGFTHPVDTGFLVFN  73

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    SDM+FSVSLD+G   EW   N  + +FAQ++N+L+P F
Sbjct  74   DRTYPNLIALFDELGVASHASDMTFSVSLDHGR-LEWAGTN-LNTVFAQRRNMLSPSF  129



>ref|WP_034203531.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia cepacia]
 gb|AIO43194.1| FAD dependent oxidoreductase family protein [Burkholderia cepacia]
 gb|KGC04716.1| FAD dependent oxidoreductase family protein [Burkholderia cepacia]
Length=434

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVT--LDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDVDLDGACHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF+ LGV    +DMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   DRTYPNLIALFDELGVAAHSTDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPTF  127



>gb|EJN00550.1| putative NAD/FAD-binding protein [Phyllobacterium sp. YR531]
Length=442

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 82/121 (68%), Gaps = 8/121 (7%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD-----GVDLDLGFMV  471
            M++AVVG GISG+ +A++L++    V VYE+E  +GGH+ T  ++      + +D GF+V
Sbjct  1    MKIAVVGTGISGMSAAWLLSQNN-DVTVYEREHRIGGHSNTFLIERDNERPLPVDTGFIV  59

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            FN  TYPN+  LF  L V+   S+MSF+VSLD+G     G+  GFSGLFAQ++NL NP F
Sbjct  60   FNEHTYPNLTALFAHLDVETAASEMSFAVSLDSGKLEYSGT--GFSGLFAQQRNLFNPRF  117

Query  652  W  654
            W
Sbjct  118  W  118



>ref|WP_025871998.1| NADH-ubiquinone oxidoreductase subunit 6 [Methylobacillus glycogenes]
Length=424

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (68%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMV  471
            K R+AV+G+GISGL SA++LA+    VV+YE   Y GGH+ TV  TLDG+   +D GF+V
Sbjct  3    KQRIAVIGSGISGLASAWLLAREHE-VVLYEAGSYFGGHSNTVDVTLDGITAPVDTGFLV  61

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
             N +TYPN++ LF+ LGV    S+MSFSV+++   G EW   N    +F Q++NLL P F
Sbjct  62   HNDLTYPNLVALFKHLGVATHTSNMSFSVAIE-AQGLEWAG-NNLDTVFCQRRNLLRPRF  119



>ref|XP_004172280.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213850, 
partial [Cucumis sativus]
Length=483

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  481  VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            VTYPNMME FE+LGV+ME SDMSFSVSLDNG G EWGSRNG S LFAQKKNLLNPYFW
Sbjct  1    VTYPNMMEFFENLGVEMETSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKKNLLNPYFW  58



>ref|WP_019620433.1| hypothetical protein [Amphritea japonica]
Length=458

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +1

Query  298  LLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLD----GVDLDLGF  465
            L   ++AVVG+GI+GL  A++L K    V +YEK+D LGGH+ TV+ D     +D+D GF
Sbjct  6    LRPRKIAVVGSGIAGLSCAWLLNKAHQ-VTLYEKDDRLGGHSNTVSFDLKGQNIDVDTGF  64

Query  466  MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNP  645
            +VFN V YPN+++ FE + +    +DM+F+VS+++G     GS  G  GLFAQK+NL +P
Sbjct  65   IVFNPVNYPNLVKFFEHINLPTCETDMTFAVSINDGQLEYSGS--GLGGLFAQKRNLFSP  122

Query  646  YFW  654
             FW
Sbjct  123  PFW  125



>ref|WP_028880747.1| NADH-ubiquinone oxidoreductase subunit 6 [Terasakiella pusilla]
Length=448

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 81/116 (70%), Gaps = 3/116 (3%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  486
            M++AV+G GI+G+ ++++L+     V +YEK+D +GGH  TV +DG  +D GF+V+N   
Sbjct  10   MKIAVIGTGIAGMSASWLLSTA-HDVTIYEKDDRIGGHTNTVDVDGTGVDTGFIVYNEKN  68

Query  487  YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            YPN++ LF+  GV+ + +DMSF VS+ NG  +E+   N F G+ AQK+N+L P FW
Sbjct  69   YPNLIALFDHFGVETQKTDMSFGVSVGNGE-FEYAGTNLF-GMLAQKRNILRPRFW  122



>ref|WP_028444633.1| NADH-ubiquinone oxidoreductase subunit 6 [Chitinimonas koreensis]
Length=430

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            R+AVVGAGI+GL +AY+L++  A V ++EK  YLGGH  +V   LDG    +D GF+VFN
Sbjct  12   RIAVVGAGIAGLSAAYLLSRRYA-VSLFEKGSYLGGHTNSVDLNLDGQVHPVDTGFLVFN  70

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LFE LGV    SDMSFSVS+D+G   EW   N    +FAQ++NL++P F
Sbjct  71   DRTYPNLVALFEELGVQSHASDMSFSVSIDDG-AMEWAGSN-LDTVFAQRRNLVSPRF  126



>ref|WP_014189646.1| NADH-ubiquinone oxidoreductase subunit 6 [Azospirillum lipoferum]
 emb|CBS90797.1| putative amine oxidase [Azospirillum lipoferum 4B]
Length=460

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGV-DLDLGFMVFNRVTY  489
            +AV+GAGI+GL +A++L+K    V +YEKED  GGHA TV  DG   +D GF+V+N   Y
Sbjct  16   IAVIGAGIAGLSAAWLLSKAHR-VTLYEKEDRPGGHANTVEADGAGPVDTGFIVYNEPCY  74

Query  490  PNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            PN++ LF+ LGV    +DMSF+ SLD G     GS  G   LFAQK NLL P FW
Sbjct  75   PNLVALFDRLGVRTRATDMSFAASLDGGRVEYAGSSLGT--LFAQKSNLLRPRFW  127



>ref|WP_009451675.1| NADH-ubiquinone oxidoreductase subunit 6 [Nitratireductor indicus]
 gb|EKF41285.1| amine oxidase flavin-containing [Nitratireductor indicus C115]
Length=446

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 7/121 (6%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV---TLDG-VDLDLGFMV  471
            K RVAV+G+GI+GL +A++L K  A V +YE E   GGHA TV   T DG V +D GF+V
Sbjct  10   KKRVAVIGSGIAGLSAAWLLGKS-ASVTLYEAEMRPGGHANTVDVETADGPVAIDTGFIV  68

Query  472  FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            +N   YPN++ LF+ LGV  ++SDMSF+ SLD G  +E+ S +G  GL  QK NL+ P F
Sbjct  69   YNERNYPNLVALFKQLGVPTQLSDMSFAASLDQGR-FEY-SGSGLKGLLGQKTNLMRPRF  126

Query  652  W  654
            W
Sbjct  127  W  127



>ref|WP_011349277.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia lata]
 gb|ABB05633.1| FAD dependent oxidoreductase [Burkholderia lata]
Length=435

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGVD--LDLGFMVFN  477
            R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  TV   LDG    +D GF+VFN
Sbjct  13   RIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHTVDIELDGASHPVDTGFLVFN  71

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ L + +GV    SDMSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  72   ERTYPNLIALLDEIGVAAHPSDMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPSF  127



>ref|WP_041643943.1| NADH-ubiquinone oxidoreductase subunit 6 [Azoarcus sp. BH72]
Length=441

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG--VDLDLGFMVFN  477
            RVAVVGAGI+GL SA++L++  A V ++E  DYLGGH  TV   +DG    +D GF+VFN
Sbjct  10   RVAVVGAGIAGLASAWLLSQRYA-VTLFEAGDYLGGHTHTVDVEIDGRPAAVDTGFLVFN  68

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            R TYPN+  LF  LGV+   SDMSF+VSL+     EW   N  + LFAQK+NL+ P F
Sbjct  69   RRTYPNLCALFALLGVEATPSDMSFAVSLERP-ALEWAGSN-LATLFAQKRNLMRPAF  124



>emb|CAL95925.1| conserved hypothetical amine oxidoreductase [Azoarcus sp. BH72]
Length=447

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDG--VDLDLGFMVFN  477
            RVAVVGAGI+GL SA++L++  A V ++E  DYLGGH  TV   +DG    +D GF+VFN
Sbjct  16   RVAVVGAGIAGLASAWLLSQRYA-VTLFEAGDYLGGHTHTVDVEIDGRPAAVDTGFLVFN  74

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            R TYPN+  LF  LGV+   SDMSF+VSL+     EW   N  + LFAQK+NL+ P F
Sbjct  75   RRTYPNLCALFALLGVEATPSDMSFAVSLERP-ALEWAGSN-LATLFAQKRNLMRPAF  130



>ref|WP_017510251.1| hypothetical protein [beta proteobacterium L13]
Length=436

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 6/120 (5%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT--VTLDGV--DLDLGFMVF  474
            M +AV GAGI+GL +A++LA+ G  V ++E   Y GGH+ T  VTLDGV   +D GF+V 
Sbjct  1    MHIAVAGAGIAGLSAAWLLARSGHQVTLFEAGRYAGGHSNTVDVTLDGVTAPVDTGFLVH  60

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            N  TYPN++ LF  LGV +  ++M+FSV+LD     EW   + F+ LFAQK+NLL P FW
Sbjct  61   NDRTYPNLIRLFALLGVPVYHTEMTFSVALDQ-EKLEWAGSDLFT-LFAQKRNLLRPAFW  118



>gb|EYR84639.1| putative NAD/FAD-binding protein [Shinella sp. DD12]
Length=443

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
             +++AVVG GI+GL + ++LA+    V V+E ++ +GGH+ TV   G  +D GF+V+N  
Sbjct  10   PLKIAVVGTGIAGLSAGWLLAQRH-DVTVFEADNRIGGHSHTVQAGGAPVDTGFIVYNEA  68

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+  LF  LGV  + SDMSFSVS+D+G   E+ + N  +GLFAQ+ NL +P FW
Sbjct  69   TYPNLTALFAHLGVPTKASDMSFSVSMDDGQ-LEYAATN-LAGLFAQRSNLASPRFW  123



>ref|WP_030479110.1| amine oxidase [Lentzea albidocapillata]
Length=412

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = +1

Query  313  VAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYP  492
            VAV+GAG++GL +AYVL +    V ++E +D LGGHA T  LDGV +D GF+V N  TYP
Sbjct  4    VAVIGAGVAGLTAAYVLQRKH-DVTLFEADDRLGGHAHTHDLDGVHVDSGFIVHNERTYP  62

Query  493  NMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N++ LF  LGV  + S+MS SV  D G G E+       GLFAQ KN  NP +
Sbjct  63   NLIRLFRELGVSTQDSEMSMSVRCD-GCGLEYAGARKLPGLFAQPKNAANPRY  114



>ref|WP_037404758.1| NADH-ubiquinone oxidoreductase subunit 6 [Shinella sp. DD12]
Length=445

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
             +++AVVG GI+GL + ++LA+    V V+E ++ +GGH+ TV   G  +D GF+V+N  
Sbjct  12   PLKIAVVGTGIAGLSAGWLLAQRH-DVTVFEADNRIGGHSHTVQAGGAPVDTGFIVYNEA  70

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+  LF  LGV  + SDMSFSVS+D+G   E+ + N  +GLFAQ+ NL +P FW
Sbjct  71   TYPNLTALFAHLGVPTKASDMSFSVSMDDGQ-LEYAATN-LAGLFAQRSNLASPRFW  125



>ref|WP_008889725.1| NADH-ubiquinone oxidoreductase subunit 6 [Thalassospira profundimaris]
 gb|EKF08624.1| amine oxidase [Thalassospira profundimaris WP0211]
Length=447

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
            K+ +AVVG+GISGL +A++L++    V +YEK+D  GGH+ TV      +D GF+V+N  
Sbjct  8    KLNIAVVGSGISGLSAAWLLSQS-HNVTLYEKDDRAGGHSNTVDAGQTPVDTGFIVYNTR  66

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
             YPN+  LF+ LG++   +DMSF+ S+D G G E+G  +  S LFAQK+NL  P FW
Sbjct  67   CYPNLCALFDHLGIETTPTDMSFAASMDEG-GLEYGGGD-LSALFAQKRNLFRPRFW  121



>ref|WP_011487298.1| NADH-ubiquinone oxidoreductase subunit 6 [Burkholderia xenovorans]
 gb|ABE29552.1| Putative dehydrogenase [Burkholderia xenovorans LB400]
 gb|AIP30073.1| FAD dependent oxidoreductase family protein [Burkholderia xenovorans 
LB400]
Length=433

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +1

Query  310  RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVFN  477
            RVAV+GAGISGL SAY+LA+    V ++E   YLGGH  TV  TLDG    +D GF+VFN
Sbjct  15   RVAVIGAGISGLASAYLLARNHR-VTLFESAGYLGGHTNTVDVTLDGHRHPVDTGFLVFN  73

Query  478  RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
              TYPN++ LF  LGV    SDM+FSVSLD G   EW      + +FAQ++NL +P F
Sbjct  74   DRTYPNLIALFAELGVRSHPSDMTFSVSLDAGR-LEWAG-TSLNTVFAQRRNLFSPTF  129



>ref|WP_041912257.1| NADH-ubiquinone oxidoreductase subunit 6 [Rhizobium sp. JGI 0001005-H05]
Length=446

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = +1

Query  304  KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  483
             M++AVVG GI+GL +A++L+K    V V+E ++ +GGH  TV   GV +D GF+V+N  
Sbjct  12   PMKIAVVGTGIAGLSAAWLLSKRHE-VTVFEADNRVGGHCHTVNAGGVPVDTGFIVYNET  70

Query  484  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  654
            TYPN+  LF  L V  + SDMSF+VS+D G     G+    +GLFAQ+ NL NP FW
Sbjct  71   TYPNLTALFAHLDVSTKASDMSFAVSIDGGQLEYAGT--SLAGLFAQRSNLANPRFW  125



>ref|WP_017923872.1| NADH-ubiquinone oxidoreductase subunit 6, partial [Burkholderia 
glumae]
Length=259

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTV--TLDGV--DLDLGFMVF  474
             R+AVVGAGI+GL SAY+LA+    V ++E  DYLGGH  +V   L+G+   +D GF+VF
Sbjct  12   QRIAVVGAGIAGLASAYLLARRHR-VTLFEAADYLGGHTHSVDVELEGMRHPVDTGFLVF  70

Query  475  NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  651
            N  TYPN++ LF+ LGV    S MSFSVS+D G   EW   N  + +FAQ++NL +P F
Sbjct  71   NDRTYPNLIALFDELGVPAHTSAMSFSVSVDGGR-LEWAGSN-LNTVFAQRRNLFSPSF  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875