BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF029A06

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629251.1|  PREDICTED: fructokinase-1                          190   1e-53   Nicotiana tomentosiformis
emb|CDP06530.1|  unnamed protein product                                189   4e-53   Coffea canephora [robusta coffee]
ref|XP_009772599.1|  PREDICTED: probable fructokinase-4                 182   1e-50   Nicotiana sylvestris
ref|XP_011077603.1|  PREDICTED: fructokinase-like 1, chloroplastic      181   3e-50   Sesamum indicum [beniseed]
gb|ADI87414.1|  fructokinase-like protein 1                             180   4e-50   Nicotiana benthamiana
ref|NP_001275447.1|  fructokinase-like protein 1                        180   6e-50   Solanum tuberosum [potatoes]
ref|XP_004246362.1|  PREDICTED: fructokinase-like 1, chloroplastic      176   1e-48   Solanum lycopersicum
gb|EPS61748.1|  fructokinase-like protein 1                             174   2e-48   Genlisea aurea
gb|EYU26634.1|  hypothetical protein MIMGU_mgv1a005440mg                172   7e-47   Erythranthe guttata [common monkey flower]
ref|XP_002273576.2|  PREDICTED: fructokinase-like 1, chloroplastic      169   5e-46   Vitis vinifera
ref|XP_008388106.1|  PREDICTED: probable fructokinase-4                 169   9e-46   
ref|XP_009358825.1|  PREDICTED: uncharacterized protein LOC103949435    170   2e-45   
emb|CBI30446.3|  unnamed protein product                                169   3e-45   Vitis vinifera
ref|XP_007205056.1|  hypothetical protein PRUPE_ppa004431mg             167   6e-45   Prunus persica
ref|XP_008239829.1|  PREDICTED: uncharacterized protein LOC103338406    168   7e-45   
ref|XP_010256724.1|  PREDICTED: fructokinase-like 1, chloroplastic      166   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010686350.1|  PREDICTED: fructokinase-like 1, chloroplastic      165   2e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|ADI87418.1|  fructokinase-like protein 1                             164   3e-44   Lactuca sativa [cultivated lettuce]
gb|KDP24506.1|  hypothetical protein JCGZ_25070                         165   4e-44   Jatropha curcas
ref|XP_002527877.1|  fructokinase, putative                             164   5e-44   Ricinus communis
ref|XP_010528657.1|  PREDICTED: fructokinase-like 1, chloroplastic      165   7e-44   
gb|KJB36871.1|  hypothetical protein B456_006G180000                    163   1e-43   Gossypium raimondii
gb|ADI87417.1|  fructokinase-like protein 1                             163   1e-43   Gossypium hirsutum [American cotton]
gb|KHG25437.1|  hypothetical protein F383_06753                         163   1e-43   Gossypium arboreum [tree cotton]
ref|XP_010427076.1|  PREDICTED: fructokinase-like 1, chloroplastic      162   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007026821.1|  Fructokinase-like 1                                163   3e-43   
ref|XP_009421323.1|  PREDICTED: fructokinase-1-like                     162   4e-43   
ref|XP_010101836.1|  hypothetical protein L484_023626                   162   6e-43   Morus notabilis
ref|XP_010928949.1|  PREDICTED: fructokinase-like 1, chloroplastic      161   8e-43   Elaeis guineensis
ref|XP_008798949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    162   1e-42   
ref|XP_010504200.1|  PREDICTED: fructokinase-like 1, chloroplastic      160   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009116097.1|  PREDICTED: fructokinase-2                          159   4e-42   Brassica rapa
gb|KEH28950.1|  pfkB family carbohydrate kinase                         158   6e-42   Medicago truncatula
ref|XP_010515923.1|  PREDICTED: fructokinase-like 1, chloroplastic      158   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006291033.1|  hypothetical protein CARUB_v10017145mg             158   9e-42   Capsella rubella
gb|KFK34655.1|  hypothetical protein AALP_AA5G174200                    157   1e-41   Arabis alpina [alpine rockcress]
ref|XP_002876240.1|  pfkB-type carbohydrate kinase family protein       157   1e-41   
ref|XP_006848049.1|  hypothetical protein AMTR_s00029p00193710          157   1e-41   
gb|ADI87419.1|  fructokinase-like protein 1                             157   1e-41   Euphorbia esula [wolf's milk]
ref|XP_006403618.1|  hypothetical protein EUTSA_v10010328mg             157   2e-41   Eutrema salsugineum [saltwater cress]
emb|CDX78206.1|  BnaA09g34010D                                          155   3e-41   
ref|XP_003516930.1|  PREDICTED: fructokinase-2-like                     155   6e-41   Glycine max [soybeans]
ref|XP_008442480.1|  PREDICTED: uncharacterized protein LOC103486334    157   6e-41   
ref|XP_004506641.1|  PREDICTED: fructokinase-2-like                     155   7e-41   Cicer arietinum [garbanzo]
ref|NP_190977.1|  fructokinase-like 1                                   155   1e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73510.1|  BnaC08g24930D                                          154   1e-40   
ref|XP_011009152.1|  PREDICTED: fructokinase-like 1, chloroplastic      154   4e-40   Populus euphratica
ref|XP_004302649.2|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    154   9e-40   Fragaria vesca subsp. vesca
ref|XP_004137741.1|  PREDICTED: fructokinase-2-like                     152   1e-39   
ref|XP_004156589.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    152   1e-39   
ref|XP_010039172.1|  PREDICTED: fructokinase-1                          151   3e-39   Eucalyptus grandis [rose gum]
gb|ADI87420.1|  fructokinase-like protein 1                             150   5e-39   Vigna unguiculata
gb|ADI87415.1|  fructokinase-like protein 1                             147   7e-38   Citrus clementina [clementine]
ref|XP_006480938.1|  PREDICTED: probable fructokinase-4-like            147   8e-38   
ref|XP_006429264.1|  hypothetical protein CICLE_v10011551mg             147   8e-38   Citrus clementina [clementine]
ref|XP_002322950.1|  hypothetical protein POPTR_0016s11690g             147   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_007133958.1|  hypothetical protein PHAVU_010G006700g             145   3e-37   Phaseolus vulgaris [French bean]
gb|EEC71816.1|  hypothetical protein OsI_04455                          130   7e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001044818.1|  Os01g0851000                                       129   2e-31   
gb|EEE55679.1|  hypothetical protein OsJ_04093                          129   3e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CBH32521.1|  protein kinase, putative, expressed                    128   5e-31   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ87729.1|  predicted protein                                      128   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001147575.1|  protein kinase                                     127   8e-31   
tpg|DAA56815.1|  TPA: protein kinase                                    127   8e-31   
ref|XP_002456644.1|  hypothetical protein SORBIDRAFT_03g040010          127   1e-30   Sorghum bicolor [broomcorn]
ref|XP_003564619.1|  PREDICTED: fructokinase-like 1, chloroplastic      127   1e-30   Brachypodium distachyon [annual false brome]
ref|XP_004970597.1|  PREDICTED: fructokinase-2-like                     126   2e-30   
ref|XP_002986741.1|  hypothetical protein SELMODRAFT_44136              116   4e-27   
ref|XP_002973268.1|  hypothetical protein SELMODRAFT_54157              116   4e-27   
gb|KDO58031.1|  hypothetical protein CISIN_1g037052mg                   109   6e-26   Citrus sinensis [apfelsine]
ref|XP_001774794.1|  predicted protein                                  111   3e-25   
ref|XP_010091598.1|  hypothetical protein L484_026446                   105   1e-22   Morus notabilis
ref|XP_010937787.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    104   3e-22   Elaeis guineensis
ref|XP_008777340.1|  PREDICTED: putative fructokinase-5                 104   3e-22   Phoenix dactylifera
ref|XP_010680662.1|  PREDICTED: fructokinase-like 2, chloroplastic      103   6e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010257983.1|  PREDICTED: fructokinase-like 2, chloroplastic      103   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004239035.1|  PREDICTED: fructokinase-like 2, chloroplastic      102   3e-21   Solanum lycopersicum
ref|XP_006348670.1|  PREDICTED: uncharacterized protein LOC102589995    101   5e-21   Solanum tuberosum [potatoes]
ref|XP_011075683.1|  PREDICTED: fructokinase-like 2, chloroplastic      101   5e-21   Sesamum indicum [beniseed]
ref|XP_002273674.2|  PREDICTED: fructokinase-like 2, chloroplasti...    100   5e-21   Vitis vinifera
ref|XP_010649953.1|  PREDICTED: fructokinase-like 2, chloroplasti...    100   1e-20   Vitis vinifera
gb|KDP41324.1|  hypothetical protein JCGZ_15731                         100   1e-20   Jatropha curcas
gb|KDO70322.1|  hypothetical protein CISIN_1g0081612mg                99.4    1e-20   Citrus sinensis [apfelsine]
ref|XP_007222921.1|  hypothetical protein PRUPE_ppa003690mg           99.0    1e-20   
ref|XP_002312288.2|  hypothetical protein POPTR_0008s09690g           99.4    2e-20   Populus trichocarpa [western balsam poplar]
gb|EMS47290.1|  hypothetical protein TRIUR3_20910                     99.0    2e-20   Triticum urartu
ref|XP_006437893.1|  hypothetical protein CICLE_v10031077mg           99.0    2e-20   Citrus clementina [clementine]
ref|XP_006484232.1|  PREDICTED: uncharacterized protein LOC102617588  99.0    3e-20   Citrus sinensis [apfelsine]
gb|KDO70321.1|  hypothetical protein CISIN_1g0081612mg                99.0    3e-20   Citrus sinensis [apfelsine]
ref|XP_004982464.1|  PREDICTED: putative fructokinase-5-like          99.0    3e-20   Setaria italica
ref|XP_008243824.1|  PREDICTED: uncharacterized protein LOC103342040  98.6    3e-20   Prunus mume [ume]
ref|XP_007222920.1|  hypothetical protein PRUPE_ppa003690mg           98.6    3e-20   Prunus persica
ref|XP_011018828.1|  PREDICTED: fructokinase-like 2, chloroplastic    98.6    4e-20   Populus euphratica
gb|ADI87422.1|  fructokinase-like protein 2                           98.6    5e-20   Nicotiana benthamiana
ref|XP_009786224.1|  PREDICTED: uncharacterized protein LOC104234369  98.6    5e-20   Nicotiana sylvestris
ref|XP_009628355.1|  PREDICTED: uncharacterized protein LOC104118730  98.6    5e-20   Nicotiana tomentosiformis
ref|XP_003562305.1|  PREDICTED: fructokinase-like 2, chloroplastic    98.2    6e-20   Brachypodium distachyon [annual false brome]
ref|XP_009356435.1|  PREDICTED: probable fructokinase-4 isoform X3    97.8    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009356434.1|  PREDICTED: probable fructokinase-4 isoform X2    97.8    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009356432.1|  PREDICTED: probable fructokinase-4 isoform X1    97.8    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_010551378.1|  PREDICTED: fructokinase-like 2, chloroplastic    97.8    7e-20   Tarenaya hassleriana [spider flower]
gb|KFK41343.1|  hypothetical protein AALP_AA2G117900                  97.8    8e-20   Arabis alpina [alpine rockcress]
ref|XP_002512061.1|  fructokinase, putative                           97.4    1e-19   
gb|EMT14724.1|  hypothetical protein F775_09742                       97.8    1e-19   
ref|XP_004144690.1|  PREDICTED: fructokinase-2-like                   95.5    2e-19   
ref|XP_004160828.1|  PREDICTED: putative fructokinase-5-like          96.7    2e-19   
gb|KHG26530.1|  Fructokinase-2                                        96.7    2e-19   Gossypium arboreum [tree cotton]
ref|XP_010044389.1|  PREDICTED: uncharacterized protein LOC104433370  96.3    2e-19   Eucalyptus grandis [rose gum]
ref|XP_008442238.1|  PREDICTED: uncharacterized protein LOC103486152  96.3    2e-19   Cucumis melo [Oriental melon]
gb|KGN54881.1|  hypothetical protein Csa_4G571770                     96.3    2e-19   Cucumis sativus [cucumbers]
emb|CDP00452.1|  unnamed protein product                              95.9    3e-19   Coffea canephora [robusta coffee]
gb|EYU28879.1|  hypothetical protein MIMGU_mgv1a003579mg              95.5    4e-19   Erythranthe guttata [common monkey flower]
gb|KJB50552.1|  hypothetical protein B456_008G176200                  95.5    4e-19   Gossypium raimondii
ref|XP_007045821.1|  Fructokinase-like 2 isoform 1                    95.5    4e-19   
ref|XP_007045823.1|  Fructokinase-like 2 isoform 3                    95.5    5e-19   
gb|EPS69174.1|  hypothetical protein M569_05592                       93.6    5e-19   Genlisea aurea
gb|KHN44929.1|  Fructokinase-2                                        95.1    5e-19   Glycine soja [wild soybean]
ref|XP_006391045.1|  hypothetical protein EUTSA_v100183770mg          93.2    5e-19   
ref|XP_006573158.1|  PREDICTED: putative fructokinase-5-like          95.1    5e-19   Glycine max [soybeans]
tpg|DAA50254.1|  TPA: hypothetical protein ZEAMMB73_178722            95.1    6e-19   
ref|XP_007045822.1|  Fructokinase-like 2 isoform 2                    95.1    7e-19   
ref|XP_008389397.1|  PREDICTED: probable fructokinase-1 isoform X1    94.7    7e-19   
ref|XP_003614114.1|  Fructokinase-2                                   94.7    7e-19   Medicago truncatula
ref|XP_008389398.1|  PREDICTED: probable fructokinase-1 isoform X2    94.7    7e-19   
ref|XP_004490214.1|  PREDICTED: uncharacterized protein LOC101493906  94.7    8e-19   Cicer arietinum [garbanzo]
ref|XP_004297219.1|  PREDICTED: fructokinase-like 2, chloroplastic    94.4    8e-19   Fragaria vesca subsp. vesca
ref|XP_008665080.1|  PREDICTED: uncharacterized protein LOC103643674  94.7    1e-18   
gb|KHN29971.1|  Fructokinase-2                                        93.6    2e-18   Glycine soja [wild soybean]
ref|XP_003518781.1|  PREDICTED: probable fructokinase-2-like          93.6    2e-18   Glycine max [soybeans]
ref|XP_006856418.1|  hypothetical protein AMTR_s00047p00218860        93.6    2e-18   Amborella trichopoda
ref|XP_002887225.1|  pfkB-type carbohydrate kinase family protein     92.4    6e-18   
ref|XP_010470895.1|  PREDICTED: fructokinase-like 2, chloroplasti...  92.4    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010470894.1|  PREDICTED: fructokinase-like 2, chloroplasti...  92.4    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010415548.1|  PREDICTED: fructokinase-like 2, chloroplasti...  92.4    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010415552.1|  PREDICTED: fructokinase-like 2, chloroplasti...  92.0    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006650283.1|  PREDICTED: uncharacterized protein LOC102700038  92.0    7e-18   Oryza brachyantha
ref|XP_002466840.1|  hypothetical protein SORBIDRAFT_01g015030        92.0    7e-18   Sorghum bicolor [broomcorn]
ref|XP_010511945.1|  PREDICTED: fructokinase-like 2, chloroplastic    92.0    8e-18   
ref|XP_006301975.1|  hypothetical protein CARUB_v10022455mg           91.3    1e-17   
gb|ABF97502.1|  pfkB-type carbohydrate kinase family protein, put...  90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75710.1|  hypothetical protein OsI_12536                        90.5    2e-17   Oryza sativa Indica Group [Indian rice]
gb|EEE59468.1|  hypothetical protein OsJ_11670                        90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AAT81682.1|  putative kinase                                       90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDY40900.1|  BnaC06g30380D                                        90.5    3e-17   Brassica napus [oilseed rape]
gb|AAF27059.1|AC008262_8  F4N2.16                                     89.7    4e-17   Arabidopsis thaliana [mouse-ear cress]
sp|F4I0K2.2|SCKL2_ARATH  RecName: Full=Fructokinase-like 2, chlor...  89.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177080.2|  fructokinase-like 2                                 89.7    5e-17   
emb|CDX95956.1|  BnaA07g27750D                                        89.4    6e-17   
ref|XP_009105465.1|  PREDICTED: uncharacterized protein LOC103831320  89.4    6e-17   Brassica rapa
ref|XP_007153496.1|  hypothetical protein PHAVU_003G040700g           87.4    2e-16   Phaseolus vulgaris [French bean]
ref|XP_009404276.1|  PREDICTED: fructokinase-1-like                   74.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17236.1|  unknown                                               74.7    3e-12   Picea sitchensis
emb|CDY54150.1|  BnaCnng26300D                                        74.7    4e-12   Brassica napus [oilseed rape]
gb|ABK25140.1|  unknown                                               72.8    1e-11   Picea sitchensis
ref|XP_009104208.1|  PREDICTED: probable fructokinase-4               71.6    2e-11   Brassica rapa
ref|XP_010512210.1|  PREDICTED: probable fructokinase-4               70.9    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009138911.1|  PREDICTED: probable fructokinase-4               70.9    3e-11   Brassica rapa
emb|CDY00619.1|  BnaC04g23060D                                        70.9    3e-11   
ref|XP_002876506.1|  pfkB-type carbohydrate kinase family protein     70.5    4e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_006304792.1|  hypothetical protein CARUB_v10012342mg           70.5    4e-11   Capsella rubella
gb|AAM64445.1|  fructokinase-like protein                             70.5    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191507.1|  probable fructokinase-4                             70.5    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AHE93349.1|  fructokinase                                          70.1    5e-11   Camellia sinensis [black tea]
ref|XP_010526109.1|  PREDICTED: probable fructokinase-4               70.1    6e-11   Tarenaya hassleriana [spider flower]
ref|XP_009379916.1|  PREDICTED: probable fructokinase-1               69.7    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU36729.1|  hypothetical protein MIMGU_mgv1a009780mg              70.1    7e-11   Erythranthe guttata [common monkey flower]
gb|EYU37375.1|  hypothetical protein MIMGU_mgv1a010047mg              69.7    7e-11   Erythranthe guttata [common monkey flower]
emb|CDX98377.1|  BnaC06g17380D                                        69.7    8e-11   
ref|XP_006372862.1|  hypothetical protein POPTR_0017s05770g           68.9    8e-11   
emb|CDX71907.1|  BnaC08g29670D                                        69.7    9e-11   
gb|EYU38801.1|  hypothetical protein MIMGU_mgv1a009756mg              69.7    1e-10   Erythranthe guttata [common monkey flower]
emb|CDY06000.1|  BnaA09g37800D                                        69.3    1e-10   
ref|XP_009396809.1|  PREDICTED: fructokinase-1-like                   69.3    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116612.1|  PREDICTED: probable fructokinase-4               69.3    1e-10   Brassica rapa
emb|CDX67798.1|  BnaA07g18380D                                        69.3    1e-10   
ref|XP_010522182.1|  PREDICTED: probable fructokinase-1               69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010557080.1|  PREDICTED: probable fructokinase-1               69.3    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_006292538.1|  hypothetical protein CARUB_v10018769mg           69.3    1e-10   Capsella rubella
gb|KFK31217.1|  hypothetical protein AALP_AA6G083600                  69.3    1e-10   Arabis alpina [alpine rockcress]
ref|XP_010469311.1|  PREDICTED: probable fructokinase-4               69.3    1e-10   Camelina sativa [gold-of-pleasure]
gb|KFK40243.1|  hypothetical protein AALP_AA3G348700                  69.3    1e-10   Arabis alpina [alpine rockcress]
gb|AFO84081.1|  fructokinase                                          69.3    1e-10   Actinidia chinensis
gb|EPS66213.1|  hypothetical protein M569_08566                       68.9    1e-10   Genlisea aurea
ref|XP_010268185.1|  PREDICTED: probable fructokinase-1               68.9    1e-10   Nelumbo nucifera [Indian lotus]
gb|KFK35169.1|  hypothetical protein AALP_AA5G248700                  68.9    1e-10   Arabis alpina [alpine rockcress]
sp|Q7XJ81.1|SCRK2_SOLHA  RecName: Full=Fructokinase-2                 68.9    1e-10   Solanum habrochaites
gb|AII73555.1|  fructokinase                                          68.9    1e-10   Actinidia eriantha
ref|XP_001759326.1|  predicted protein                                69.3    2e-10   
gb|ABK92748.1|  unknown                                               68.6    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011091648.1|  PREDICTED: fructokinase-2                        68.6    2e-10   Sesamum indicum [beniseed]
ref|XP_006372861.1|  pfkB-type carbohydrate kinase family protein     68.6    2e-10   
gb|ABK94952.1|  unknown                                               68.6    2e-10   Populus trichocarpa [western balsam poplar]
emb|CDP08915.1|  unnamed protein product                              68.9    2e-10   Coffea canephora [robusta coffee]
emb|CDY23944.1|  BnaC03g17470D                                        68.6    2e-10   Brassica napus [oilseed rape]
gb|ACF74294.1|  fructokinase                                          66.6    2e-10   Arachis hypogaea [goober]
ref|XP_009384261.1|  PREDICTED: fructokinase-1-like                   68.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008460045.1|  PREDICTED: probable fructokinase-4               68.6    2e-10   Cucumis melo [Oriental melon]
ref|XP_009383349.1|  PREDICTED: fructokinase-1-like                   68.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB37261.1|  hypothetical protein B456_006G196700                  68.6    2e-10   Gossypium raimondii
ref|XP_007150435.1|  hypothetical protein PHAVU_005G153300g           68.6    2e-10   Phaseolus vulgaris [French bean]
ref|XP_010909223.1|  PREDICTED: fructokinase-1-like                   68.2    2e-10   Elaeis guineensis
gb|EMT33516.1|  hypothetical protein F775_30584                       68.6    3e-10   
ref|XP_009144211.1|  PREDICTED: probable fructokinase-1               68.2    3e-10   Brassica rapa
emb|CDY10801.1|  BnaA05g11350D                                        68.2    3e-10   Brassica napus [oilseed rape]
gb|KHG22422.1|  hypothetical protein F383_26791                       68.6    3e-10   Gossypium arboreum [tree cotton]
gb|AFW90635.1|  fructokinase-like protein                             67.4    3e-10   Solanum tuberosum [potatoes]
gb|KFK26793.1|  hypothetical protein AALP_AA8G294300                  68.2    3e-10   Arabis alpina [alpine rockcress]
ref|XP_003597523.1|  Fructokinase                                     68.2    3e-10   Medicago truncatula
ref|XP_003616371.1|  Fructokinase-2                                   68.6    3e-10   Medicago truncatula
gb|KJB37262.1|  hypothetical protein B456_006G196700                  68.6    3e-10   Gossypium raimondii
ref|XP_003537935.1|  PREDICTED: fructokinase-2-like                   68.2    3e-10   Glycine max [soybeans]
emb|CDY56614.1|  BnaCnng30740D                                        68.2    3e-10   Brassica napus [oilseed rape]
ref|XP_003541157.1|  PREDICTED: fructokinase-2-like                   68.2    3e-10   Glycine max [soybeans]
gb|AIX02985.1|  fructokinase                                          68.2    3e-10   Morella rubra [Chinese arbutus]
ref|XP_010442689.1|  PREDICTED: probable fructokinase-7 isoform X1    68.2    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006280740.1|  hypothetical protein CARUB_v10026709mg           68.2    3e-10   Capsella rubella
gb|ABC01889.1|  fructokinase-like protein                             68.2    3e-10   Solanum tuberosum [potatoes]
gb|ACN40355.1|  unknown                                               68.2    3e-10   Picea sitchensis
ref|XP_002864134.1|  pfkB-type carbohydrate kinase family protein     68.2    3e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_009399727.1|  PREDICTED: fructokinase-1-like                   68.6    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006402684.1|  hypothetical protein EUTSA_v10006096mg           67.8    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010442690.1|  PREDICTED: probable fructokinase-7 isoform X2    68.2    4e-10   Camelina sativa [gold-of-pleasure]
gb|AFK41276.1|  unknown                                               68.2    4e-10   Medicago truncatula
ref|NP_199996.1|  pfkB-like carbohydrate kinase family protein        67.8    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AJK93568.1|  fructokinase                                          67.8    4e-10   Manihot esculenta [manioc]
ref|XP_010443953.1|  PREDICTED: probable fructokinase-7               67.8    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010482526.1|  PREDICTED: probable fructokinase-7               67.8    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002272526.2|  PREDICTED: probable fructokinase-7 isoform X1    68.2    4e-10   Vitis vinifera
ref|XP_003543564.1|  PREDICTED: fructokinase-2-like                   67.8    4e-10   Glycine max [soybeans]
dbj|BAJ95563.1|  predicted protein                                    68.2    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN61782.1|  hypothetical protein VITISV_012349                   68.2    4e-10   Vitis vinifera
ref|XP_002436760.1|  hypothetical protein SORBIDRAFT_10g008280        68.2    4e-10   Sorghum bicolor [broomcorn]
ref|XP_004507340.1|  PREDICTED: fructokinase-2-like                   67.8    4e-10   Cicer arietinum [garbanzo]
ref|XP_006443006.1|  hypothetical protein CICLE_v10021105mg           67.8    4e-10   Citrus clementina [clementine]
sp|P37829.1|SCRK_SOLTU  RecName: Full=Fructokinase                    67.4    4e-10   Solanum tuberosum [potatoes]
gb|KJB37966.1|  hypothetical protein B456_006G229100                  66.6    4e-10   Gossypium raimondii
ref|NP_172092.1|  putative fructokinase-3                             67.8    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889581.1|  pfkB-type carbohydrate kinase family protein     67.8    4e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_001233888.1|  fructokinase-2                                   67.8    5e-10   Solanum lycopersicum
ref|XP_009119097.1|  PREDICTED: probable fructokinase-2               67.8    5e-10   Brassica rapa
ref|XP_004308129.1|  PREDICTED: probable fructokinase-7 isoform X1    67.8    5e-10   Fragaria vesca subsp. vesca
ref|XP_004490806.1|  PREDICTED: probable fructokinase-4-like          67.8    5e-10   Cicer arietinum [garbanzo]
ref|XP_010035062.1|  PREDICTED: probable fructokinase-1               68.2    5e-10   Eucalyptus grandis [rose gum]
ref|XP_003546905.1|  PREDICTED: fructokinase-2-like                   67.4    5e-10   Glycine max [soybeans]
dbj|BAC21160.1|  fructokinase                                         65.5    5e-10   Nicotiana tabacum [American tobacco]
gb|AJK93569.1|  fructokinase                                          67.8    5e-10   Manihot esculenta [manioc]
ref|XP_011470420.1|  PREDICTED: probable fructokinase-7 isoform X2    67.4    5e-10   Fragaria vesca subsp. vesca
ref|XP_001770633.1|  predicted protein                                67.8    5e-10   
gb|AIE16180.1|  fructokinase                                          67.4    5e-10   Nicotiana tabacum [American tobacco]
ref|XP_007141895.1|  hypothetical protein PHAVU_008G234800g           67.8    5e-10   Phaseolus vulgaris [French bean]
ref|XP_010462577.1|  PREDICTED: probable fructokinase-3               67.4    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006347302.1|  PREDICTED: fructokinase-2                        67.4    6e-10   Solanum tuberosum [potatoes]
gb|ABB29956.1|  fructokinase-like                                     67.4    6e-10   Solanum tuberosum [potatoes]
emb|CDY51025.1|  BnaC09g52860D                                        67.4    6e-10   Brassica napus [oilseed rape]
emb|CDY47709.1|  BnaA10g03980D                                        67.4    6e-10   Brassica napus [oilseed rape]
ref|XP_003564826.1|  PREDICTED: fructokinase-1                        67.4    6e-10   Brachypodium distachyon [annual false brome]
ref|XP_009605011.1|  PREDICTED: fructokinase-2                        67.4    6e-10   Nicotiana tomentosiformis
tpg|DAA56390.1|  TPA: hypothetical protein ZEAMMB73_295614            64.3    6e-10   
ref|XP_008222483.1|  PREDICTED: probable fructokinase-4               67.4    6e-10   Prunus mume [ume]
ref|XP_006656815.1|  PREDICTED: putative fructokinase-5-like          67.4    6e-10   
emb|CDM85361.1|  unnamed protein product                              67.0    6e-10   Triticum aestivum [Canadian hard winter wheat]
emb|CDY00501.1|  BnaA10g07720D                                        67.4    6e-10   
ref|XP_009787480.1|  PREDICTED: fructokinase-2 isoform X1             67.0    6e-10   Nicotiana sylvestris
ref|XP_010045714.1|  PREDICTED: probable fructokinase-1               67.4    6e-10   Eucalyptus grandis [rose gum]
ref|XP_009107129.1|  PREDICTED: fructokinase-1                        67.4    6e-10   Brassica rapa
ref|XP_007131943.1|  hypothetical protein PHAVU_011G053800g           67.0    6e-10   Phaseolus vulgaris [French bean]
dbj|BAK01819.1|  predicted protein                                    67.0    7e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAM13316.1|  fructokinase 1                                       67.0    7e-10   Oryza punctata
ref|XP_006430625.1|  hypothetical protein CICLE_v10011546mg           67.8    7e-10   
ref|XP_007222617.1|  hypothetical protein PRUPE_ppa008494mg           67.0    7e-10   Prunus persica
gb|EYU19503.1|  hypothetical protein MIMGU_mgv1a009204mg              67.4    7e-10   Erythranthe guttata [common monkey flower]
emb|CDY32617.1|  BnaC03g15850D                                        67.4    7e-10   Brassica napus [oilseed rape]
dbj|BAM13318.1|  fructokinase 1                                       67.0    7e-10   Oryza australiensis
ref|XP_007038536.1|  PfkB-like carbohydrate kinase family protein...  66.2    7e-10   
ref|NP_001045068.2|  Os01g0894300                                     67.0    7e-10   
sp|A2WXV8.1|SCRK1_ORYSI  RecName: Full=Fructokinase-1; AltName: F...  67.0    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007131942.1|  hypothetical protein PHAVU_011G053800g           67.0    8e-10   Phaseolus vulgaris [French bean]
ref|XP_002268097.1|  PREDICTED: probable fructokinase-4               67.0    8e-10   Vitis vinifera
gb|KJB37967.1|  hypothetical protein B456_006G229100                  66.6    8e-10   Gossypium raimondii
ref|XP_006482137.1|  PREDICTED: fructokinase-2-like                   67.0    8e-10   
gb|KDO63085.1|  hypothetical protein CISIN_1g015777mg                 67.0    8e-10   
ref|XP_010519220.1|  PREDICTED: probable fructokinase-7               67.0    9e-10   
ref|XP_010528532.1|  PREDICTED: probable fructokinase-6, chloropl...  67.0    9e-10   
ref|XP_011037105.1|  PREDICTED: probable fructokinase-4               66.6    9e-10   
ref|XP_009762815.1|  PREDICTED: fructokinase-like                     65.1    9e-10   
ref|XP_006401905.1|  hypothetical protein EUTSA_v10014000mg           67.0    9e-10   
ref|XP_009132586.1|  PREDICTED: fructokinase-1-like                   67.0    9e-10   
ref|XP_010528531.1|  PREDICTED: probable fructokinase-6, chloropl...  67.0    9e-10   
ref|XP_009371257.1|  PREDICTED: fructokinase-1                        67.0    9e-10   
gb|KJB37965.1|  hypothetical protein B456_006G229100                  66.6    9e-10   
ref|XP_001779049.1|  predicted protein                                66.6    9e-10   
gb|AIL30508.1|  fructokinase                                          67.0    9e-10   
gb|AIE16179.1|  fructokinase                                          67.0    1e-09   
gb|EPS68794.1|  fructokinase-like protein                             66.6    1e-09   
ref|XP_009782121.1|  PREDICTED: fructokinase-1-like                   67.0    1e-09   
ref|XP_004145029.1|  PREDICTED: probable fructokinase-4-like          66.6    1e-09   
emb|CDY38879.1|  BnaA03g13000D                                        66.6    1e-09   
gb|KHG15213.1|  hypothetical protein F383_03322                       66.6    1e-09   
gb|AFR11330.1|  fructokinase                                          65.5    1e-09   
gb|AJK93567.1|  fructokinase                                          66.6    1e-09   
gb|AFN08698.1|  FRK2                                                  66.6    1e-09   
ref|XP_010061753.1|  PREDICTED: fructokinase-1-like                   66.6    1e-09   
gb|AAQ10000.1|  putative fructokinase 2                               66.6    1e-09   
ref|XP_010480362.1|  PREDICTED: probable fructokinase-3               65.9    1e-09   
ref|XP_007038535.1|  PfkB-like carbohydrate kinase family protein...  66.6    1e-09   
gb|AAQ09999.1|  putative fructokinase 2                               66.2    1e-09   
ref|XP_008376501.1|  PREDICTED: fructokinase-1-like                   66.6    1e-09   
gb|KDP33160.1|  hypothetical protein JCGZ_13425                       66.6    1e-09   
ref|XP_002974925.1|  hypothetical protein SELMODRAFT_102797           66.6    1e-09   
ref|XP_001762258.1|  predicted protein                                66.6    1e-09   
ref|XP_010111956.1|  Putative fructokinase-5                          66.2    1e-09   
ref|XP_010099603.1|  putative fructokinase-4                          66.2    1e-09   
ref|XP_003564039.1|  PREDICTED: probable fructokinase-6, chloropl...  66.6    1e-09   
ref|XP_002988943.1|  hypothetical protein SELMODRAFT_128887           66.6    1e-09   
ref|XP_010501336.1|  PREDICTED: probable fructokinase-3               66.2    1e-09   
ref|XP_002881172.1|  pfkB-type carbohydrate kinase family protein     66.2    1e-09   
emb|CDY15383.1|  BnaC04g42400D                                        66.2    2e-09   
ref|XP_004143645.1|  PREDICTED: fructokinase-1-like                   66.2    2e-09   
ref|XP_010469704.1|  PREDICTED: probable fructokinase-1               65.9    2e-09   
ref|XP_010414131.1|  PREDICTED: probable fructokinase-1               65.9    2e-09   
ref|XP_010510201.1|  PREDICTED: probable fructokinase-1               65.9    2e-09   
ref|NP_180697.1|  probable fructokinase-1                             65.9    2e-09   
ref|XP_006829109.1|  hypothetical protein AMTR_s00001p00265040        66.2    2e-09   
ref|XP_006294594.1|  hypothetical protein CARUB_v10023630mg           65.9    2e-09   
gb|AAK62446.1|AF387001_1  putative fructokinase                       65.9    2e-09   
gb|KCW90782.1|  hypothetical protein EUGRSUZ_A02848                   66.2    2e-09   
gb|KDP43855.1|  hypothetical protein JCGZ_20865                       65.9    2e-09   
ref|XP_006410273.1|  hypothetical protein EUTSA_v10016928mg           65.9    2e-09   
ref|XP_002305200.1|  pfkB-type carbohydrate kinase family protein     66.2    2e-09   
emb|CDY19092.1|  BnaA04g18320D                                        65.9    2e-09   
gb|KDO60166.1|  hypothetical protein CISIN_1g018696mg                 64.7    2e-09   
ref|NP_001131901.1|  uncharacterized protein LOC100193286             66.2    2e-09   
dbj|BAM13317.1|  fructokinase 1                                       65.9    2e-09   
ref|XP_011099474.1|  PREDICTED: probable fructokinase-6, chloropl...  66.2    2e-09   
ref|XP_010101617.1|  hypothetical protein L484_003616                 65.9    2e-09   
gb|AFK37761.1|  unknown                                               64.3    2e-09   
ref|XP_008788183.1|  PREDICTED: fructokinase-1-like                   65.9    2e-09   
gb|AEK21796.1|  fructokinase                                          65.9    2e-09   
gb|ACG31425.1|  fructokinase-2                                        65.9    2e-09   
ref|XP_010255595.1|  PREDICTED: probable fructokinase-7               65.9    2e-09   
ref|XP_001780342.1|  predicted protein                                65.9    2e-09   
ref|XP_008467254.1|  PREDICTED: fructokinase-1                        65.9    2e-09   
ref|XP_004970880.1|  PREDICTED: fructokinase-1-like                   65.5    2e-09   
ref|XP_007033046.1|  PfkB-like carbohydrate kinase family protein     65.9    2e-09   
ref|XP_007033923.1|  PfkB-like carbohydrate kinase family protein     65.5    2e-09   
ref|XP_011002780.1|  PREDICTED: probable fructokinase-6, chloropl...  65.9    2e-09   
gb|KJB08530.1|  hypothetical protein B456_001G087000                  64.7    2e-09   
ref|XP_004965060.1|  PREDICTED: putative fructokinase-5-like          65.9    2e-09   
tpg|DAA56389.1|  TPA: hypothetical protein ZEAMMB73_295614            64.3    3e-09   
ref|XP_011041646.1|  PREDICTED: probable fructokinase-7 isoform X1    65.5    3e-09   
gb|KJB08531.1|  hypothetical protein B456_001G087000                  65.5    3e-09   
ref|XP_004486913.1|  PREDICTED: probable fructokinase-4-like          65.5    3e-09   
emb|CDY10167.1|  BnaC05g04100D                                        65.5    3e-09   
ref|XP_011041647.1|  PREDICTED: probable fructokinase-7 isoform X2    65.5    3e-09   
ref|XP_010475323.1|  PREDICTED: probable fructokinase-3               65.5    3e-09   
emb|CDP05266.1|  unnamed protein product                              65.5    3e-09   
ref|XP_009132781.1|  PREDICTED: probable fructokinase-1               65.1    3e-09   
gb|KEH30339.1|  pfkB family carbohydrate kinase                       65.1    3e-09   
ref|XP_004513694.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    3e-09   
gb|KJB08529.1|  hypothetical protein B456_001G087000                  65.5    3e-09   
ref|NP_564875.2|  pfkB-like carbohydrate kinase family protein        65.5    3e-09   
gb|KFK41061.1|  hypothetical protein AALP_AA2G080300                  65.5    3e-09   
ref|XP_010927874.1|  PREDICTED: fructokinase-2-like                   65.1    3e-09   
ref|XP_010109032.1|  putative fructokinase-2                          65.5    3e-09   
ref|XP_010415185.1|  PREDICTED: probable fructokinase-6, chloropl...  65.5    3e-09   
ref|NP_001105210.1|  fructokinase-1                                   65.1    3e-09   
gb|EEC80278.1|  hypothetical protein OsI_22272                        65.1    4e-09   
ref|XP_010672224.1|  PREDICTED: probable fructokinase-4               65.1    4e-09   
ref|XP_002458909.1|  hypothetical protein SORBIDRAFT_03g042460        65.1    4e-09   
ref|XP_002533363.1|  fructokinase, putative                           65.1    4e-09   
gb|AFN08699.1|  FRK3                                                  65.1    4e-09   
ref|XP_010415184.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    4e-09   
gb|AAA80675.1|  fructokinase                                          65.1    4e-09   
ref|NP_001234206.1|  fructokinase                                     65.1    4e-09   
ref|XP_010475326.1|  PREDICTED: probable fructokinase-2               65.1    4e-09   
gb|KJB52887.1|  hypothetical protein B456_008G281900                  65.1    4e-09   
ref|XP_011021402.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    4e-09   
ref|XP_006421810.1|  hypothetical protein CICLE_v10005308mg           65.1    4e-09   
ref|XP_010485800.1|  PREDICTED: probable fructokinase-2               64.7    4e-09   
ref|XP_010932642.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    4e-09   
dbj|BAK07333.1|  predicted protein                                    64.7    4e-09   
ref|XP_010470517.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    4e-09   
ref|XP_009341299.1|  PREDICTED: fructokinase-1-like                   65.1    4e-09   
ref|XP_010262186.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    4e-09   
ref|XP_011101149.1|  PREDICTED: probable fructokinase-7               64.7    4e-09   
ref|XP_002887038.1|  pfkB-type carbohydrate kinase family protein     65.1    5e-09   
ref|XP_011026435.1|  PREDICTED: probable fructokinase-1               64.7    5e-09   
gb|KHN41078.1|  Putative fructokinase-4                               65.1    5e-09   
ref|NP_001240145.1|  uncharacterized protein LOC100797023             65.1    5e-09   
ref|XP_008376805.1|  PREDICTED: fructokinase-1-like                   64.7    5e-09   
ref|XP_008234319.1|  PREDICTED: fructokinase-1                        64.7    5e-09   
gb|AHE93348.1|  fructokinase                                          64.7    5e-09   
ref|XP_004309811.1|  PREDICTED: probable fructokinase-4               64.7    5e-09   
gb|KDP41134.1|  hypothetical protein JCGZ_03625                       64.7    5e-09   
gb|EEE65384.1|  hypothetical protein OsJ_20703                        64.7    5e-09   
ref|XP_006341727.1|  PREDICTED: putative fructokinase-5-like          64.7    5e-09   
ref|XP_010062247.1|  PREDICTED: probable fructokinase-4               64.7    5e-09   
dbj|BAD38154.1|  putative fructokinase                                64.7    6e-09   
ref|XP_009382928.1|  PREDICTED: fructokinase-1-like                   64.3    6e-09   
ref|XP_009105206.1|  PREDICTED: fructokinase-1                        64.7    6e-09   
gb|ACJ11715.1|  fructokinase                                          64.3    6e-09   
emb|CDY55675.1|  BnaC06g43510D                                        64.7    6e-09   
ref|NP_001057226.2|  Os06g0232200                                     64.7    6e-09   
ref|NP_001233893.1|  fructokinase                                     64.3    6e-09   
ref|XP_002511766.1|  fructokinase, putative                           64.7    6e-09   
emb|CDX96146.1|  BnaA07g25850D                                        64.7    6e-09   
ref|NP_001274900.1|  probable fructokinase-4-like                     64.7    6e-09   
gb|AFO84082.1|  fructokinase                                          64.3    6e-09   
ref|XP_010511467.1|  PREDICTED: probable fructokinase-6, chloropl...  64.3    7e-09   
ref|XP_006417964.1|  hypothetical protein EUTSA_v10008196mg           64.3    7e-09   
ref|NP_172093.1|  probable fructokinase-2                             64.3    7e-09   
ref|XP_010511466.1|  PREDICTED: probable fructokinase-6, chloropl...  64.3    7e-09   
ref|XP_003548230.1|  PREDICTED: putative fructokinase-5-like isof...  64.3    7e-09   
ref|XP_007218097.1|  hypothetical protein PRUPE_ppa006628mg           64.3    8e-09   
ref|XP_008457065.1|  PREDICTED: probable fructokinase-4               64.3    8e-09   
gb|KDP37795.1|  hypothetical protein JCGZ_06697                       63.9    8e-09   
emb|CDX86540.1|  BnaC08g01630D                                        64.3    8e-09   
ref|XP_004161610.1|  PREDICTED: putative fructokinase-5-like          63.9    8e-09   
ref|XP_009618746.1|  PREDICTED: fructokinase-1-like                   64.3    8e-09   
ref|XP_004149791.1|  PREDICTED: putative fructokinase-5-like          63.9    8e-09   
ref|XP_006302391.1|  hypothetical protein CARUB_v10020459mg           63.5    8e-09   
gb|AIL30505.1|  fructokinase-2                                        63.9    8e-09   
ref|XP_008788319.1|  PREDICTED: fructokinase-2-like                   63.9    8e-09   
ref|XP_002310430.1|  hypothetical protein POPTR_0007s01850g           63.9    8e-09   
ref|XP_006302390.1|  hypothetical protein CARUB_v10020459mg           64.3    8e-09   
gb|KGN57838.1|  hypothetical protein Csa_3G345390                     64.3    9e-09   
ref|XP_006826865.1|  hypothetical protein AMTR_s00010p00123310        64.3    9e-09   
gb|KDP22350.1|  hypothetical protein JCGZ_26181                       63.9    9e-09   
ref|XP_002318851.2|  pfkB-type carbohydrate kinase family protein     63.9    9e-09   
ref|XP_009111012.1|  PREDICTED: probable fructokinase-2               63.9    1e-08   
gb|AJK93565.1|  fructokinase                                          63.9    1e-08   
gb|AJK93566.1|  fructokinase                                          63.5    1e-08   
emb|CDP02702.1|  unnamed protein product                              63.9    1e-08   
ref|XP_006362692.1|  PREDICTED: fructokinase-1-like                   63.5    1e-08   
ref|XP_008790605.1|  PREDICTED: fructokinase-1-like                   63.5    1e-08   
ref|XP_002963683.1|  hypothetical protein SELMODRAFT_165981           63.5    1e-08   
ref|XP_010457717.1|  PREDICTED: probable fructokinase-2 isoform X2    63.5    1e-08   
gb|KHN33305.1|  Fructokinase-2                                        63.2    1e-08   
ref|XP_010907694.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...  63.5    1e-08   
ref|XP_002986057.1|  hypothetical protein SELMODRAFT_425086           63.5    1e-08   
ref|XP_002989626.1|  hypothetical protein SELMODRAFT_428214           63.5    1e-08   
emb|CCW28774.1|  pfkB family kinase                                   63.5    1e-08   
ref|XP_010457716.1|  PREDICTED: probable fructokinase-2 isoform X1    63.5    1e-08   
ref|XP_003592350.1|  Fructokinase                                     63.2    2e-08   
ref|XP_003592351.1|  Fructokinase                                     63.2    2e-08   
gb|EYU44573.1|  hypothetical protein MIMGU_mgv1a010551mg              62.8    2e-08   
ref|XP_001754092.1|  predicted protein                                63.2    2e-08   
ref|XP_004496627.1|  PREDICTED: putative fructokinase-5-like          63.2    2e-08   
ref|XP_003555364.2|  PREDICTED: putative fructokinase-5-like          63.2    2e-08   
ref|XP_008777085.1|  PREDICTED: fructokinase-2-like                   62.8    2e-08   
ref|XP_006391397.1|  hypothetical protein EUTSA_v10018694mg           63.2    2e-08   
ref|NP_001234396.1|  fructokinase 3                                   63.2    2e-08   
ref|XP_009625375.1|  PREDICTED: probable fructokinase-4               63.2    2e-08   
ref|XP_002274388.1|  PREDICTED: probable fructokinase-6, chloropl...  63.2    2e-08   
ref|XP_002889582.1|  pfkB-type carbohydrate kinase family protein     62.8    2e-08   
ref|XP_009771749.1|  PREDICTED: probable fructokinase-4               63.2    2e-08   
gb|KJB71775.1|  hypothetical protein B456_011G141600                  62.0    2e-08   
ref|NP_001183584.1|  uncharacterized protein LOC100502178             62.8    2e-08   
ref|XP_011468527.1|  PREDICTED: probable fructokinase-6, chloropl...  62.8    2e-08   
gb|ACG44849.1|  fructokinase-1                                        62.8    2e-08   
ref|XP_011016156.1|  PREDICTED: probable fructokinase-7 isoform X2    62.8    2e-08   
gb|KHN15693.1|  Putative fructokinase-5                               62.8    3e-08   
ref|XP_011030019.1|  PREDICTED: probable fructokinase-7 isoform X2    62.8    3e-08   
ref|XP_006589570.1|  PREDICTED: putative fructokinase-5-like          62.8    3e-08   
ref|XP_011016155.1|  PREDICTED: probable fructokinase-7 isoform X1    62.8    3e-08   
ref|XP_011030018.1|  PREDICTED: probable fructokinase-7 isoform X1    62.8    3e-08   
ref|XP_010693935.1|  PREDICTED: probable fructokinase-6, chloropl...  62.8    3e-08   
emb|CAN68744.1|  hypothetical protein VITISV_014671                   62.8    3e-08   
ref|XP_001757300.1|  predicted protein                                62.4    3e-08   
ref|XP_002263176.1|  PREDICTED: probable fructokinase-7               62.4    3e-08   
ref|XP_008807640.1|  PREDICTED: putative fructokinase-5 isoform X2    62.8    3e-08   
ref|XP_006858897.1|  hypothetical protein AMTR_s00066p00205100        59.7    3e-08   
ref|XP_008807639.1|  PREDICTED: putative fructokinase-5 isoform X1    62.4    3e-08   
ref|XP_010999528.1|  PREDICTED: probable fructokinase-5               62.0    3e-08   
gb|KJB71774.1|  hypothetical protein B456_011G141600                  62.0    3e-08   
ref|XP_008375884.1|  PREDICTED: probable fructokinase-4               62.4    4e-08   
ref|XP_009385465.1|  PREDICTED: fructokinase-1-like                   62.0    4e-08   
gb|KHN02781.1|  Putative fructokinase-5                               62.0    4e-08   
ref|XP_008378129.1|  PREDICTED: probable fructokinase-4               62.4    4e-08   
ref|XP_009375843.1|  PREDICTED: probable fructokinase-4               62.0    4e-08   
ref|XP_008229214.1|  PREDICTED: probable fructokinase-4               62.0    4e-08   
gb|KJB71773.1|  hypothetical protein B456_011G141600                  62.0    5e-08   
ref|XP_002321869.1|  pfkB-type carbohydrate kinase family protein     62.0    5e-08   
gb|ABK94897.1|  unknown                                               61.6    5e-08   
ref|XP_009334417.1|  PREDICTED: probable fructokinase-4               61.6    6e-08   
ref|XP_006371336.1|  pfkB-type carbohydrate kinase family protein     61.6    6e-08   
ref|XP_007201273.1|  hypothetical protein PRUPE_ppa008482mg           61.6    6e-08   
gb|KJB10970.1|  hypothetical protein B456_001G234200                  61.6    6e-08   
ref|XP_007152360.1|  hypothetical protein PHAVU_004G123400g           61.2    7e-08   
ref|XP_001756304.1|  predicted protein                                61.2    7e-08   
ref|XP_009778351.1|  PREDICTED: fructokinase-1 isoform X1             61.2    7e-08   
ref|XP_007215525.1|  hypothetical protein PRUPE_ppa007069mg           61.2    7e-08   
ref|XP_008237799.1|  PREDICTED: putative fructokinase-5               61.2    8e-08   
gb|ADZ96381.2|  fructokinase                                          61.2    8e-08   
ref|NP_001281027.1|  probable fructokinase-4                          61.2    8e-08   
ref|XP_009778352.1|  PREDICTED: fructokinase-1 isoform X2             61.2    9e-08   
ref|XP_007143920.1|  hypothetical protein PHAVU_007G113500g           60.8    1e-07   
ref|XP_009371791.1|  PREDICTED: probable fructokinase-4               61.2    1e-07   
ref|XP_008232832.1|  PREDICTED: probable fructokinase-4               60.8    1e-07   
ref|XP_010025222.1|  PREDICTED: fructokinase-1-like                   60.8    1e-07   



>ref|XP_009629251.1| PREDICTED: fructokinase-1 [Nicotiana tomentosiformis]
Length=487

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 126/193 (65%), Gaps = 19/193 (10%)
 Frame = +3

Query  66   THFKVSTFLPKHRYVCHPNPPKSSSADDH-TTTQQPSKTSHRALKKTSPSSKPRGRPKKE  242
            THF  ST     +     NP ++SS +DH TTTQ+P K S R  KK+S ++K   +P+K+
Sbjct  20   THFNFSTIFFSSKLPHRKNPLRASSGNDHSTTTQEPPKPSPRGPKKSSRTAKKSSKPQKD  79

Query  243  PQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLIC  422
               ET  ++    ++    K      E+++  V+                FPY +PPL+ 
Sbjct  80   SNFET--NIEKSNTQMDFSKNADDKIEKYDDGVD----------------FPYPNPPLVI  121

Query  423  CFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRA  602
            CFGAAQKEFVPTVRV+ EQM  D YSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRA
Sbjct  122  CFGAAQKEFVPTVRVSHEQMHQDKYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRA  181

Query  603  AFMGKVGDDEFGE  641
            AFMGKVG+DEFG+
Sbjct  182  AFMGKVGNDEFGQ  194



>emb|CDP06530.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 128/205 (62%), Gaps = 41/205 (20%)
 Frame = +3

Query  69   HFKVSTF----LPKHRYVCHPNPPKSSSADDHTTTQQPSKTSHRALKKT-----------  203
            HF++ST     +P+ R      PPKSSS DD  TT +P K S R  KK            
Sbjct  30   HFQISTIWLVPIPEARTFHKLLPPKSSS-DDDPTTAEPPKPSRRGRKKARSTTTTSSSAT  88

Query  204  SPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddydd  383
            S + +PRG  K +PQ+   +          P  + Q + + ++  ++             
Sbjct  89   STTKRPRGPRKSQPQNTQNDV---------PVTDKQEELDYYDDGID-------------  126

Query  384  gvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPS  563
               FPYE PPLICCFGAAQKEFVPT+RVAPEQM PDIYS+WKMLQWNPPEFVR+PGGPPS
Sbjct  127  ---FPYEYPPLICCFGAAQKEFVPTIRVAPEQMHPDIYSQWKMLQWNPPEFVRSPGGPPS  183

Query  564  NVAISHVRLGGRAAFMGKVGDDEFG  638
            NVA+SHVRLGGRAAFMGKVGDDEFG
Sbjct  184  NVAVSHVRLGGRAAFMGKVGDDEFG  208



>ref|XP_009772599.1| PREDICTED: probable fructokinase-4 [Nicotiana sylvestris]
Length=486

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 116/174 (67%), Gaps = 18/174 (10%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  299
            N  K SS D  TTTQ+P K S R  KK+S ++K   +P+K+   ET  ++    ++    
Sbjct  38   NTLKCSSNDHSTTTQEPPKHSPRGPKKSSRTAKKTSKPQKDSNFET--NIEKSNTQMELS  95

Query  300  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQ  479
            K      E+++  V+                FPY +PPL+ CFGAAQKEFVPTVRV+ EQ
Sbjct  96   KNADDKIEKYDDGVD----------------FPYPNPPLVICFGAAQKEFVPTVRVSHEQ  139

Query  480  MDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            M  D YSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVG+DEFG+
Sbjct  140  MHQDKYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGNDEFGQ  193



>ref|XP_011077603.1| PREDICTED: fructokinase-like 1, chloroplastic [Sesamum indicum]
Length=490

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 119/182 (65%), Gaps = 28/182 (15%)
 Frame = +3

Query  111  CHPNPP-KSSSADDHTTTQQPSKTSHRALKKTSPSSKPR--GRPKK--EPQSETIESVAT  275
            CH  PP + S+ DD  +T  P +   R    +SP+S P+   RP K  EP +   E+V  
Sbjct  39   CHKLPPPRCSTTDDAPSTTTPRRRG-RKKSTSSPTSAPKRSKRPTKRAEPSNSQNEAVIF  97

Query  276  KRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVP  455
            K S      +   +  +F+  +E                FPYE PPL+CCFGA QKEF+P
Sbjct  98   KES------DHVEELFDFDDGIE----------------FPYEDPPLVCCFGAVQKEFLP  135

Query  456  TVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEF  635
            TVRVAPEQM PDIYS+WKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAF+GKVG+DEF
Sbjct  136  TVRVAPEQMHPDIYSQWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFIGKVGNDEF  195

Query  636  GE  641
            GE
Sbjct  196  GE  197



>gb|ADI87414.1| fructokinase-like protein 1 [Nicotiana benthamiana]
Length=486

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 116/174 (67%), Gaps = 18/174 (10%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPR  299
            NP KSSS D  +TTQ+P K S R  KK+S ++K   +P K+   ET  ++    +     
Sbjct  38   NPLKSSSNDHSSTTQEPPKHSPRGPKKSSRTAKKSSKPPKDSSFET--NIEKSNTHMEFS  95

Query  300  KETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQ  479
            K      E+++  V+                FPY +PPL+ CFGAAQKEFVPTVRV+ +Q
Sbjct  96   KNADDRIEKYDDGVD----------------FPYPNPPLVICFGAAQKEFVPTVRVSHDQ  139

Query  480  MDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            M  D YSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVG+DEFG+
Sbjct  140  MHQDKYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGNDEFGQ  193



>ref|NP_001275447.1| fructokinase-like protein 1 [Solanum tuberosum]
 gb|ADI87416.1| fructokinase-like protein 1 [Solanum tuberosum]
Length=479

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 125/186 (67%), Gaps = 26/186 (14%)
 Frame = +3

Query  87   FLPKHRYVCHPNPPKSSSADDHTTTQQPSKTSHRALKKTS-PSSKPRGRPKKEPQSETIE  263
            F    ++ C  NPPKS++ D  TTTQ+P   S    KK+S P++  + R  K+   +   
Sbjct  26   FFSSSKFPCRTNPPKSTTNDHPTTTQEPPTPSRGGRKKSSTPTTSRKSRTPKDSNFDI--  83

Query  264  SVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQK  443
            ++A          E+ +  EE + Y +             GVDFPY +PPL+CCFGAAQK
Sbjct  84   NIA----------ESNTQMEEIDDYDD-------------GVDFPYPNPPLVCCFGAAQK  120

Query  444  EFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVG  623
            EFVPTVRV+PEQMD D YSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVG
Sbjct  121  EFVPTVRVSPEQMDKDKYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVG  180

Query  624  DDEFGE  641
            +DEFG+
Sbjct  181  NDEFGQ  186



>ref|XP_004246362.1| PREDICTED: fructokinase-like 1, chloroplastic [Solanum lycopersicum]
Length=478

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 124/188 (66%), Gaps = 26/188 (14%)
 Frame = +3

Query  81   STFLPKHRYVCHPNPPKSSSADDHTTTQQPSKTSHRALKKTS-PSSKPRGRPKKEPQSET  257
            + F    ++    NPPKS++ D  TTTQ+P   S R  KK+S P++  + R  K+   + 
Sbjct  23   TIFFSSSKFPYRTNPPKSTTNDHPTTTQEPPTPSRRGRKKSSTPTTSKKSRTPKDSNFDI  82

Query  258  IESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAA  437
              ++A          E+ +  EE + Y +             GVDFPY +PPL+CCFGAA
Sbjct  83   --NIA----------ESNTQMEEIDDYDD-------------GVDFPYPNPPLVCCFGAA  117

Query  438  QKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGK  617
            QKEFVPTVRV+PEQMD D YSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGK
Sbjct  118  QKEFVPTVRVSPEQMDKDKYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGK  177

Query  618  VGDDEFGE  641
            VG DE G+
Sbjct  178  VGSDELGQ  185



>gb|EPS61748.1| fructokinase-like protein 1, partial [Genlisea aurea]
Length=407

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPLICCFGA QKEF+PTVR+APEQMDPDIYS+WKMLQWNPPEFVRAPGGPPSNVA
Sbjct  31   FPYEDPPLICCFGAVQKEFIPTVRIAPEQMDPDIYSQWKMLQWNPPEFVRAPGGPPSNVA  90

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+HVRLGGRAAF+GK+G+DEFG
Sbjct  91   IAHVRLGGRAAFIGKIGNDEFG  112



>gb|EYU26634.1| hypothetical protein MIMGU_mgv1a005440mg [Erythranthe guttata]
Length=483

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGAAQKEFVPTVRVAPEQM PDIYS+WKMLQWNPPEFVRAPGGPPSNVA
Sbjct  108  FPYEDPPLVCCFGAAQKEFVPTVRVAPEQMHPDIYSQWKMLQWNPPEFVRAPGGPPSNVA  167

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISH RLGGRAAF+GKVG DEFG+
Sbjct  168  ISHSRLGGRAAFIGKVGSDEFGQ  190



>ref|XP_002273576.2| PREDICTED: fructokinase-like 1, chloroplastic [Vitis vinifera]
Length=485

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPLICCFGAAQKEFVPTVRV+  QM PDIYSEWKMLQW+PPEFVRAPGGPPSNVA
Sbjct  110  FPYDDPPLICCFGAAQKEFVPTVRVSEHQMHPDIYSEWKMLQWDPPEFVRAPGGPPSNVA  169

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG DEFGE
Sbjct  170  ISHVRLGGRAAFMGKVGRDEFGE  192



>ref|XP_008388106.1| PREDICTED: probable fructokinase-4 [Malus domestica]
 ref|XP_008350508.1| PREDICTED: probable fructokinase-4 [Malus domestica]
Length=499

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 119/176 (68%), Gaps = 19/176 (11%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKK--TSPSSKPRGRPKKEPQSETIESVATKRSRAR  293
            NPP++S+      + +PSK + R  KK  TS SS+   +PK+  +SET+          +
Sbjct  48   NPPRASTNGADNGSIEPSKPTRRGRKKGPTSSSSEAPKKPKRSKKSETVNGAVEPEPVIQ  107

Query  294  PRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAP  473
            P +   S+ E+++  ++                FPY+ PPL+CCFGAAQKEFVPTVRV+ 
Sbjct  108  P-ENPDSELEDYDDGID----------------FPYDDPPLVCCFGAAQKEFVPTVRVSD  150

Query  474  EQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
             +M PDIYS+WKMLQW+PPEFVRAPGG PSNVAISHVRLGGRAAFMGKVG+D+FG+
Sbjct  151  NRMHPDIYSQWKMLQWDPPEFVRAPGGSPSNVAISHVRLGGRAAFMGKVGEDDFGD  206



>ref|XP_009358825.1| PREDICTED: uncharacterized protein LOC103949435 [Pyrus x bretschneideri]
Length=655

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 119/176 (68%), Gaps = 19/176 (11%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKK--TSPSSKPRGRPKKEPQSETIESVATKRSRAR  293
            NPP++S+      + +PSK + R  KK  TS SS+   +PK+  +SET+          +
Sbjct  204  NPPRASTNGADNGSIEPSKPTRRGRKKGPTSSSSEAPKKPKRSKKSETVNGAVEPELVIQ  263

Query  294  PRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAP  473
            P +   S+ E+++  ++                FPY+ PPL+CCFGAAQKEFVPTVRV+ 
Sbjct  264  P-ENPDSELEDYDDGID----------------FPYDDPPLVCCFGAAQKEFVPTVRVSD  306

Query  474  EQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
             +M PDIYS+WKMLQW+PPEFVRAPGG PSNVAISHVRLGGRAAFMGKVG+D+FG+
Sbjct  307  NRMHPDIYSQWKMLQWDPPEFVRAPGGSPSNVAISHVRLGGRAAFMGKVGEDDFGD  362



>emb|CBI30446.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPLICCFGAAQKEFVPTVRV+  QM PDIYSEWKMLQW+PPEFVRAPGGPPSNVA
Sbjct  314  FPYDDPPLICCFGAAQKEFVPTVRVSEHQMHPDIYSEWKMLQWDPPEFVRAPGGPPSNVA  373

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG DEFGE
Sbjct  374  ISHVRLGGRAAFMGKVGRDEFGE  396



>ref|XP_007205056.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
 gb|EMJ06255.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
Length=510

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGR---PKKEPQSETIESVATKRSRA  290
            NPP++S   +   + + S+ + R  KK   SS        PK+  +SE  +        A
Sbjct  54   NPPRASINGEDNGSIESSEPTRRGRKKGHTSSSSSSATSPPKQTKRSEKAQVENGTVETA  113

Query  291  RPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVA  470
            +P  +T++   E E Y +             G+DFPY+ PPL+CCFGAAQKEFVPTVRV+
Sbjct  114  KPTIQTENPDSELEDYDD-------------GIDFPYDDPPLVCCFGAAQKEFVPTVRVS  160

Query  471  PEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
               M PDIYS+WKMLQW+PPEFVRAPGG PSNVAISHVRLGGRAAFMGKVGDD+FG+
Sbjct  161  DNPMHPDIYSQWKMLQWDPPEFVRAPGGSPSNVAISHVRLGGRAAFMGKVGDDDFGD  217



>ref|XP_008239829.1| PREDICTED: uncharacterized protein LOC103338406 [Prunus mume]
Length=661

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 119/184 (65%), Gaps = 30/184 (16%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKK----------TSPSSKPRGRPKKEPQSETIESV  269
            NPP++S   +   + + S+ + R  KK          TSP  K +   K + ++ T+E+ 
Sbjct  205  NPPRASINGEDNGSIESSEPTRRGRKKGPTSSSSSSATSPLKKTKRLKKAQVENGTVET-  263

Query  270  ATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEF  449
                  A+P  +T++   E E Y +             G+DFPY+ PPL+CCFGAAQKEF
Sbjct  264  ------AKPTIQTENPDSELEDYDD-------------GIDFPYDDPPLVCCFGAAQKEF  304

Query  450  VPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDD  629
            VPTVRV+   M PDIYS+WKMLQW+PPEFVRAPGG PSNVAISHVRLGGRAAFMGKVGDD
Sbjct  305  VPTVRVSDNPMHPDIYSQWKMLQWDPPEFVRAPGGSPSNVAISHVRLGGRAAFMGKVGDD  364

Query  630  EFGE  641
            +FG+
Sbjct  365  DFGD  368



>ref|XP_010256724.1| PREDICTED: fructokinase-like 1, chloroplastic [Nelumbo nucifera]
Length=541

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPLICCFGAAQKEFVPTVRV+  QM PDIYS+WK LQW+PPEFVRAPGGP SNVA
Sbjct  166  FPYEYPPLICCFGAAQKEFVPTVRVSDRQMHPDIYSQWKSLQWDPPEFVRAPGGPASNVA  225

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVGDD+FGE
Sbjct  226  ISHVRLGGRAAFMGKVGDDDFGE  248



>ref|XP_010686350.1| PREDICTED: fructokinase-like 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 101/149 (68%), Gaps = 19/149 (13%)
 Frame = +3

Query  213  SKPRGRPKKEPQSETIESVATKRSRARPRKETQS------DTEEFESYVEPPvnadevdd  374
            SK RGRPK   +S T+    T +      + TQS      + +E  ++ +          
Sbjct  52   SKRRGRPKGSKKSTTLSPQKTAKISDGSSQNTQSTNGSTLNLDELNNFDD----------  101

Query  375  yddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGG  554
               G+DFPY  PPLICCFGA QKEF+PTVRV+ +QM PDIYS WKM+QWNPPEF RAPGG
Sbjct  102  ---GMDFPYLEPPLICCFGAVQKEFLPTVRVSEQQMHPDIYSGWKMMQWNPPEFGRAPGG  158

Query  555  PPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            P SNVAI+HVRLGGRAAFMGKVGDD+FGE
Sbjct  159  PASNVAIAHVRLGGRAAFMGKVGDDDFGE  187



>gb|ADI87418.1| fructokinase-like protein 1 [Lactuca sativa]
Length=469

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 111/176 (63%), Gaps = 33/176 (19%)
 Frame = +3

Query  126  PKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARP---  296
            P++S   DHT +             T+P    RGR K    + T  + ++ R +      
Sbjct  28   PRASINGDHTVS-------------TAPQPARRGRKKSTSTTTTTPTKSSSRMKKSESEV  74

Query  297  -RKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAP  473
             R E + D ++F++ ++                FPYE PPLICCFGAAQK+FVPTVRV+ 
Sbjct  75   NRIEKEEDLQDFDNGID----------------FPYEDPPLICCFGAAQKQFVPTVRVSD  118

Query  474  EQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            +QM PD+YSEWKMLQW+PPEF RAPGGPPSNVAI+HVRLGGRAAF+GKVGDD+ G+
Sbjct  119  QQMHPDMYSEWKMLQWDPPEFARAPGGPPSNVAIAHVRLGGRAAFIGKVGDDDLGQ  174



>gb|KDP24506.1| hypothetical protein JCGZ_25070 [Jatropha curcas]
Length=504

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 114/183 (62%), Gaps = 27/183 (15%)
 Frame = +3

Query  123  PPKSSSADDHTT-TQQPSKTSHRA---------LKKTSPSSKPRGRPKKEPQSETIESVA  272
            PP++S   D T    + SK S R              +P+S  + +  K+ ++E++ ++ 
Sbjct  46   PPQASINGDSTNGAIESSKPSRRGRKKKSTSPSSSAVAPTSAKKTKRSKKIEAESV-NIH  104

Query  273  TKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFV  452
            T   +     E   + E+++  ++                FPY+ PPLICCFGAAQKEFV
Sbjct  105  TNSGKQTSVVELDEEIEDYDDGID----------------FPYDYPPLICCFGAAQKEFV  148

Query  453  PTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDE  632
            P+VRV  +QM PD+YS+WKMLQW+PPEF RAPGG PSNVAISHVRLGGRAAFMGKVGDD+
Sbjct  149  PSVRVHDDQMHPDMYSQWKMLQWDPPEFARAPGGAPSNVAISHVRLGGRAAFMGKVGDDD  208

Query  633  FGE  641
            FGE
Sbjct  209  FGE  211



>ref|XP_002527877.1| fructokinase, putative [Ricinus communis]
 gb|EEF34508.1| fructokinase, putative [Ricinus communis]
Length=500

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGA QKEFVPTVRV   QM PDIYS+WKMLQW+PPEFVRAPGGPPSNVA
Sbjct  123  FPYEYPPLVCCFGAVQKEFVPTVRVHDNQMHPDIYSQWKMLQWDPPEFVRAPGGPPSNVA  182

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG D+FGE
Sbjct  183  ISHVRLGGRAAFMGKVGADDFGE  205



>ref|XP_010528657.1| PREDICTED: fructokinase-like 1, chloroplastic [Tarenaya hassleriana]
Length=654

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 114/181 (63%), Gaps = 23/181 (13%)
 Frame = +3

Query  105  YVCHPNPPKSSSADDHTTTQQPS--KTSHRALKKTSPSSKPRGRPKKEPQSETIESVATK  278
            YVC    PK+S   D T    P   K S R  KK  P+++ R + +    + +IE+    
Sbjct  202  YVC----PKASINGDITNGTAPETPKPSRRGRKKKQPATEERAKLETRMGNGSIETDPET  257

Query  279  RSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPT  458
            RS+ +     + D  E E Y +             G+DFPY+ PPL+CCFG+ +KEFVP 
Sbjct  258  RSQQKE----EGDESELEDYDD-------------GLDFPYDDPPLVCCFGSVRKEFVPV  300

Query  459  VRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
            VRV    M PD+YS+WKMLQW+PPEF RAPGGPPSNVAISHVRLGGRAAFMGKVGDD+FG
Sbjct  301  VRVHDNPMHPDMYSQWKMLQWDPPEFGRAPGGPPSNVAISHVRLGGRAAFMGKVGDDDFG  360

Query  639  E  641
            +
Sbjct  361  D  361



>gb|KJB36871.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
 gb|KJB36872.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
Length=480

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 109/146 (75%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  SPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddydd  383
            +P    RGR KK+P S + E+   KR+  R RK   + TE      E     +E+ D+DD
Sbjct  46   TPKPTRRGR-KKKPTSSSPETPTAKRT-GRKRK---TQTENGSVESESEGEEEELSDFDD  100

Query  384  gvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPS  563
            G+DFPY+ PPLICCFGAAQKEFVPTVRV  EQM PD YS WKMLQW+PPEF RAPGGPPS
Sbjct  101  GMDFPYDEPPLICCFGAAQKEFVPTVRVNEEQMHPDKYSTWKMLQWDPPEFGRAPGGPPS  160

Query  564  NVAISHVRLGGRAAFMGKVGDDEFGE  641
            NVAISHVRLGGRAAFMGKVG+DEFG+
Sbjct  161  NVAISHVRLGGRAAFMGKVGEDEFGD  186



>gb|ADI87417.1| fructokinase-like protein 1 [Gossypium hirsutum]
Length=480

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 109/146 (75%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  SPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddydd  383
            +P    RGR KK+P S + E+   KR+  R RK   + TE      E     +E+ D+DD
Sbjct  46   TPKPTRRGR-KKKPTSSSPETPTAKRT-GRKRK---TQTENGSVESESEGEEEELSDFDD  100

Query  384  gvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPS  563
            G+DFPY+ PPLICCFGAAQKEFVPTVRV  EQM PD YS WKMLQW+PPEF RAPGGPPS
Sbjct  101  GMDFPYDEPPLICCFGAAQKEFVPTVRVNEEQMHPDKYSTWKMLQWDPPEFGRAPGGPPS  160

Query  564  NVAISHVRLGGRAAFMGKVGDDEFGE  641
            NVAISHVRLGGRAAFMGKVG+DEFG+
Sbjct  161  NVAISHVRLGGRAAFMGKVGEDEFGD  186



>gb|KHG25437.1| hypothetical protein F383_06753 [Gossypium arboreum]
Length=480

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 109/146 (75%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  SPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddydd  383
            +P    RGR KK+P S + E+   KR+  R RK   + TE      E     +E+ D+DD
Sbjct  46   TPKPTRRGR-KKKPTSSSPETPTAKRT-GRKRK---TQTENGSVESESEGEEEELSDFDD  100

Query  384  gvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPS  563
            G+DFPY+ PPLICCFGAAQKEFVPTVRV  EQM PD YS WKMLQW+PPEF RAPGGPPS
Sbjct  101  GMDFPYDEPPLICCFGAAQKEFVPTVRVNEEQMHPDKYSTWKMLQWDPPEFGRAPGGPPS  160

Query  564  NVAISHVRLGGRAAFMGKVGDDEFGE  641
            NVAISHVRLGGRAAFMGKVG+DEFG+
Sbjct  161  NVAISHVRLGGRAAFMGKVGEDEFGD  186



>ref|XP_010427076.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 93/140 (66%), Gaps = 16/140 (11%)
 Frame = +3

Query  222  RGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPY  401
            +GR KK+  S  IE   T+        E   + E+++  +E                +PY
Sbjct  59   KGRKKKQQTSTVIEKDDTENITIETDAELNPELEDYDDGIE----------------YPY  102

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            + PPL+CCFGA QKEFVP VRV    M PDIYS+WKMLQW+PPEF RAPGGPPSNVAISH
Sbjct  103  DDPPLVCCFGAVQKEFVPVVRVHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSNVAISH  162

Query  582  VRLGGRAAFMGKVGDDEFGE  641
            VRLGGRAAFMGKVG+DEFG+
Sbjct  163  VRLGGRAAFMGKVGEDEFGD  182



>ref|XP_007026821.1| Fructokinase-like 1 [Theobroma cacao]
 gb|EOY07323.1| Fructokinase-like 1 [Theobroma cacao]
Length=647

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPLICCFGAAQKEFVPTVRV  E+M PD YS WKMLQW+PPEF RAPGGPPSNVA
Sbjct  271  FPYEEPPLICCFGAAQKEFVPTVRVNEEKMHPDKYSHWKMLQWDPPEFGRAPGGPPSNVA  330

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVGDDE+G+
Sbjct  331  ISHVRLGGRAAFMGKVGDDEYGD  353



>ref|XP_009421323.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 109/151 (72%), Gaps = 10/151 (7%)
 Frame = +3

Query  216  KPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFES----------YVEPPvnade  365
            KP  R +K+  +++  +   KR+R R +K+T  D    E            V  PV  +E
Sbjct  78   KPTRRGRKKKSADSSPATPVKRTRRRSQKKTPEDEAAAEGPRMPEEAKAPTVAAPVEEEE  137

Query  366  vddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRA  545
             +D+DDG+DFPYESPPL+CCFGAA++EFVPTVRV+  QM PD YS WK LQW+PPEFVRA
Sbjct  138  EEDFDDGMDFPYESPPLVCCFGAARREFVPTVRVSERQMHPDQYSSWKQLQWSPPEFVRA  197

Query  546  PGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
            PGGPPSNVAISH RLGGRAAFMGKVGDD+FG
Sbjct  198  PGGPPSNVAISHARLGGRAAFMGKVGDDDFG  228



>ref|XP_010101836.1| hypothetical protein L484_023626 [Morus notabilis]
 gb|EXB89973.1| hypothetical protein L484_023626 [Morus notabilis]
Length=519

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGAAQKEF+PTVRV+   M PDIYS+WKMLQW+PPEFVRAPGGP SNVA
Sbjct  144  FPYEDPPLVCCFGAAQKEFLPTVRVSDNPMHPDIYSQWKMLQWDPPEFVRAPGGPSSNVA  203

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVGDD++G+
Sbjct  204  ISHVRLGGRAAFMGKVGDDDYGD  226



>ref|XP_010928949.1| PREDICTED: fructokinase-like 1, chloroplastic [Elaeis guineensis]
Length=519

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+SPPLICCFGAAQ+EFVPTVRV+  QM  D YS WK LQWNPPEFVRAPGGPPSNVA
Sbjct  140  FPYQSPPLICCFGAAQREFVPTVRVSERQMHSDQYSSWKALQWNPPEFVRAPGGPPSNVA  199

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            ISHVRLGGRAAFMGKVGDD+FG
Sbjct  200  ISHVRLGGRAAFMGKVGDDDFG  221



>ref|XP_008798949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713712 
[Phoenix dactylifera]
Length=665

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 99/126 (79%), Gaps = 8/126 (6%)
 Frame = +3

Query  273  TKRSRARPRKETQSDTEEFESYVEPP----vnadevddyddgvdFPYESPPLICCFGAAQ  440
            T+RSR +P    +S  EE     +PP       +E +D+DDG+DFPY SPPLICCFGAAQ
Sbjct  246  TRRSRKKPEAVEESQNEE----EKPPPLAIDEDEEEEDFDDGMDFPYGSPPLICCFGAAQ  301

Query  441  KEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKV  620
            +EFVPTVRV+ +QM PD YS WK LQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKV
Sbjct  302  REFVPTVRVSEQQMHPDQYSSWKALQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKV  361

Query  621  GDDEFG  638
            GDD+ G
Sbjct  362  GDDDLG  367



>ref|XP_010504200.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=471

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 100/140 (71%), Gaps = 15/140 (11%)
 Frame = +3

Query  222  RGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPY  401
            +GR KK+  S  IE               + DTEE  +    P    E++DYDDG++FPY
Sbjct  54   KGRKKKQQTSTVIE---------------KDDTEENGTIETEPELNPELEDYDDGIEFPY  98

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            + PPL+CCFGA QKEFVP VRV    M PDIYS+WKMLQW+PPEF RAPGGPPSNVAISH
Sbjct  99   DDPPLVCCFGAVQKEFVPVVRVHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSNVAISH  158

Query  582  VRLGGRAAFMGKVGDDEFGE  641
            VRLGGRAAFMGKVG+DEFG+
Sbjct  159  VRLGGRAAFMGKVGEDEFGD  178



>ref|XP_009116097.1| PREDICTED: fructokinase-2 [Brassica rapa]
Length=463

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPL+CCFGA QKEFVP VRV    MDPDIYS+WKMLQW+PPEF RAPGGPPSNVA
Sbjct  88   FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMDPDIYSQWKMLQWDPPEFGRAPGGPPSNVA  147

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG+D++GE
Sbjct  148  ISHVRLGGRAAFMGKVGEDDYGE  170



>gb|KEH28950.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=462

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPLICCFGAAQ+EF+PTVRV    MDPDIY+EWKMLQW PPEF RAPGGPPSNVA
Sbjct  86   FPYDDPPLICCFGAAQREFLPTVRVQEFPMDPDIYTEWKMLQWKPPEFARAPGGPPSNVA  145

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++HVRLGGRAA +GKVG+DEFGE
Sbjct  146  VAHVRLGGRAALLGKVGEDEFGE  168



>ref|XP_010515923.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 93/141 (66%), Gaps = 17/141 (12%)
 Frame = +3

Query  222  RGRPKKEPQSETIESVATKRSRA-RPRKETQSDTEEFESYVEPPvnadevddyddgvdFP  398
            +GR KK+  S  IE   T+ + A     E   + E+++  +E                FP
Sbjct  58   KGRKKKQQTSTVIEKDDTEENGAIETDAELNPELEDYDDGIE----------------FP  101

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGA QKEFVP VR     M PDIYS+WKMLQW+PPEF RAPGGPPSNVAIS
Sbjct  102  YDDPPLVCCFGAVQKEFVPVVRAHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSNVAIS  161

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
            HVRLGGRAAFMGKVG DEFG+
Sbjct  162  HVRLGGRAAFMGKVGGDEFGD  182



>ref|XP_006291033.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
 gb|EOA23931.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
Length=475

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 96/145 (66%), Gaps = 17/145 (12%)
 Frame = +3

Query  210  SSKPRGRPKKEPQSET-IESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddg  386
            ++KP  + +K+ QS T IE   T         E   + E+++  +E              
Sbjct  54   AAKPSRKGRKKKQSSTVIEKDDTDNGTIETGPELNPELEDYDDGIE--------------  99

Query  387  vdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSN  566
              FPY+ PPL+CCFGA QKEFVP VRV    M PDIYS+WKMLQW+PPEF RAPGGPPSN
Sbjct  100  --FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSN  157

Query  567  VAISHVRLGGRAAFMGKVGDDEFGE  641
            VAISHVRLGGRAAFMGKVG+D+FG+
Sbjct  158  VAISHVRLGGRAAFMGKVGEDDFGD  182



>gb|KFK34655.1| hypothetical protein AALP_AA5G174200 [Arabis alpina]
Length=460

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +3

Query  285  RARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVR  464
            + R +K+T   T++ E+    P    ++ DYDDG++FPY+ PPL+CCFGA QKEFVP VR
Sbjct  49   KGRKKKQTSPITKKEETIDSDPELNPDLVDYDDGIEFPYDDPPLVCCFGAVQKEFVPVVR  108

Query  465  VAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            V    M PD+YS+WKMLQW+PPEF RAPGGPPSNVAISHVRLGGRAAFMGKVG+D+FGE
Sbjct  109  VHDNPMHPDMYSQWKMLQWDPPEFGRAPGGPPSNVAISHVRLGGRAAFMGKVGEDDFGE  167



>ref|XP_002876240.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52499.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=477

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 102/156 (65%), Gaps = 17/156 (11%)
 Frame = +3

Query  174  KTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPv  353
            K ++ A  +T+     +GR KK+  S  IE           +  T+SDT E +  + P +
Sbjct  46   KITNGAAAETAAKPSRKGRKKKQT-STVIE-----------KNNTESDTTETDPELNPAL  93

Query  354  nadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPE  533
               +         FPY+ PPL+CCFGA QKEFVP VRV    M PD+YS+WKMLQW+PPE
Sbjct  94   VDYDDGIE-----FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDMYSQWKMLQWDPPE  148

Query  534  FVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            F RAPGGPPSNVAISHVRLGGRAAFMGKVG+D+FG+
Sbjct  149  FGRAPGGPPSNVAISHVRLGGRAAFMGKVGEDDFGD  184



>ref|XP_006848049.1| hypothetical protein AMTR_s00029p00193710 [Amborella trichopoda]
 gb|ERN09630.1| hypothetical protein AMTR_s00029p00193710 [Amborella trichopoda]
Length=452

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPLICCFGAAQ+EF+PTVRVA  QM PDIYS WK LQW+PPEF RAPGGPP NVA
Sbjct  288  FPYEWPPLICCFGAAQREFLPTVRVAERQMHPDIYSTWKGLQWSPPEFTRAPGGPPFNVA  347

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG D++G+
Sbjct  348  ISHVRLGGRAAFMGKVGGDDYGD  370



>gb|ADI87419.1| fructokinase-like protein 1 [Euphorbia esula]
Length=427

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY SPPL+CCFGA +KEFVPTVRV   QM  D YS WKMLQW+PPEF RAPGGPPSNVA
Sbjct  65   FPYLSPPLVCCFGAVKKEFVPTVRVHDNQMHQDKYSHWKMLQWDPPEFARAPGGPPSNVA  124

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVGDD+FG+
Sbjct  125  ISHVRLGGRAAFMGKVGDDDFGD  147



>ref|XP_006403618.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
 gb|ESQ45071.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
Length=481

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGA QKEFVP VRV    M PD+YS+WKMLQW+PPEF RAPGGPPSNVA
Sbjct  106  FPYEDPPLVCCFGAVQKEFVPVVRVHDNPMHPDMYSQWKMLQWDPPEFGRAPGGPPSNVA  165

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG+D+FGE
Sbjct  166  ISHVRLGGRAAFMGKVGEDDFGE  188



>emb|CDX78206.1| BnaA09g34010D [Brassica napus]
Length=378

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPL+CCFGA QKEFVP VRV    M PDIYS+WKMLQW+PPEF RAPGGPPSNVA
Sbjct  3    FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSNVA  62

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG+D++GE
Sbjct  63   ISHVRLGGRAAFMGKVGEDDYGE  85



>ref|XP_003516930.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=467

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 105/157 (67%), Gaps = 19/157 (12%)
 Frame = +3

Query  174  KTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKR-SRARPRKETQSDTEEFESYVEPP  350
            K + RA    SP+ K RGR KK+P+++T  S  T     A P+KE + +  +++  V+  
Sbjct  36   KIALRASTVESPTPKRRGR-KKKPETQTPPSNDTPPPQDADPKKE-EDEVYDYDDGVD--  91

Query  351  vnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPP  530
                          FPY  PPLICCFGAA++EF+P VRV    M PDIYSEWKMLQW PP
Sbjct  92   --------------FPYSDPPLICCFGAARREFIPAVRVQDYPMHPDIYSEWKMLQWKPP  137

Query  531  EFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            EF RAPGGPPSNVA++H RLGGRAAF+GKVGDD+FGE
Sbjct  138  EFARAPGGPPSNVAVAHTRLGGRAAFLGKVGDDDFGE  174



>ref|XP_008442480.1| PREDICTED: uncharacterized protein LOC103486334 [Cucumis melo]
Length=662

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             PYE PPLICCFGAAQKEFVP++RV   QMD D YSEWKMLQW+PPEF RAPGG PSNVA
Sbjct  287  IPYEDPPLICCFGAAQKEFVPSIRVHDNQMDADKYSEWKMLQWDPPEFARAPGGSPSNVA  346

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+HVRLGGRAAFMGKVG D+FG+
Sbjct  347  IAHVRLGGRAAFMGKVGKDDFGD  369



>ref|XP_004506641.1| PREDICTED: fructokinase-2-like [Cicer arietinum]
Length=458

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGA Q+EF+PTVRV    M PDIYSEWKMLQW PPEF RAPGGPPSNVA
Sbjct  83   FPYEDPPLVCCFGATQREFIPTVRVHEFPMHPDIYSEWKMLQWKPPEFARAPGGPPSNVA  142

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++HVRLGGRAA +GKVG+DEFGE
Sbjct  143  VAHVRLGGRAALLGKVGEDEFGE  165



>ref|NP_190977.1| fructokinase-like 1 [Arabidopsis thaliana]
 sp|Q9M394.1|SCKL1_ARATH RecName: Full=Fructokinase-like 1, chloroplastic; AltName: Full=PEP-associated 
protein 6; AltName: Full=pfkB-type carbohydrate 
kinase family protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB70983.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM13160.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM91217.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AEE79187.1| fructokinase-like 1 [Arabidopsis thaliana]
Length=471

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPL+CCFGA QKEFVP VRV    M PD+YS+WKMLQW+PPEF RAPGGPPSNVA
Sbjct  96   FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDMYSQWKMLQWDPPEFGRAPGGPPSNVA  155

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAFMGKVG+D+FG+
Sbjct  156  ISHVRLGGRAAFMGKVGEDDFGD  178



>emb|CDX73510.1| BnaC08g24930D [Brassica napus]
Length=463

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPL+CCFGA QKEFVP VRV    M PDIYS+WKMLQW+PPEF RAPGGPPSNVA
Sbjct  88   FPYDDPPLVCCFGAVQKEFVPVVRVHDNPMHPDIYSQWKMLQWDPPEFGRAPGGPPSNVA  147

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ISHVRLGGRAAF+GKVG+D++GE
Sbjct  148  ISHVRLGGRAAFIGKVGEDDYGE  170



>ref|XP_011009152.1| PREDICTED: fructokinase-like 1, chloroplastic [Populus euphratica]
Length=485

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 110/179 (61%), Gaps = 31/179 (17%)
 Frame = +3

Query  120  NPPKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETI----ESVATKRSR  287
            NPPK+S+ +       PS+               RGR KK   + T     +  ATKRS+
Sbjct  39   NPPKASATNGAVDAPPPSR---------------RGRKKKPATTPTTDTATKGTATKRSK  83

Query  288  -ARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVR  464
                   + SDTE  +            +DYDDG+DFPYE PPL+CCFGA QKEFVPTVR
Sbjct  84   KTEAENGSVSDTELLDG-----------EDYDDGIDFPYEYPPLVCCFGAVQKEFVPTVR  132

Query  465  VAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            V    M  D+YS+WKMLQW+PPEF RAPGGP SNVAI+H RLGGRAAFMGKVGDDE GE
Sbjct  133  VHDNPMHQDMYSQWKMLQWDPPEFARAPGGPVSNVAIAHARLGGRAAFMGKVGDDELGE  191



>ref|XP_004302649.2| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=647

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 108/171 (63%), Gaps = 21/171 (12%)
 Frame = +3

Query  126  PKSSSADDHTTTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKE  305
            P  +S +D+ + ++P + + R  KK+S S+     P K+ Q       A K        E
Sbjct  204  PLRASGEDNGSIEEPKQPARRGRKKSSTSASSS--PPKKTQR------AKKAQVENGPVE  255

Query  306  TQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMD  485
             +SD  E E Y +             G+DFPY+ PPL+CCFGAAQKEFVPTVRV+   M 
Sbjct  256  PESDDSELEDYDD-------------GIDFPYDDPPLVCCFGAAQKEFVPTVRVSDNPMH  302

Query  486  PDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
            PD+YS WKMLQW+PPEF RAPG  PSNVAISHVRLGGRAAFMGKVG DEFG
Sbjct  303  PDMYSRWKMLQWDPPEFSRAPGSSPSNVAISHVRLGGRAAFMGKVGGDEFG  353



>ref|XP_004137741.1| PREDICTED: fructokinase-2-like [Cucumis sativus]
 gb|KGN58805.1| hypothetical protein Csa_3G732620 [Cucumis sativus]
Length=511

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             PYE PPLICCFGAAQKEFVP++RV   QM  D YSEWKMLQW+PPEF RAPGG PSNVA
Sbjct  136  IPYEDPPLICCFGAAQKEFVPSIRVHDNQMHHDKYSEWKMLQWDPPEFARAPGGSPSNVA  195

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+HVRLGGRAAFMGKVG D+FG+
Sbjct  196  IAHVRLGGRAAFMGKVGKDDFGD  218



>ref|XP_004156589.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2-like [Cucumis 
sativus]
Length=511

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             PYE PPLICCFGAAQKEFVP++RV   QM  D YSEWKMLQW+PPEF RAPGG PSNVA
Sbjct  136  IPYEDPPLICCFGAAQKEFVPSIRVHDNQMHHDKYSEWKMLQWDPPEFARAPGGSPSNVA  195

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+HVRLGGRAAFMGKVG D+FG+
Sbjct  196  IAHVRLGGRAAFMGKVGKDDFGD  218



>ref|XP_010039172.1| PREDICTED: fructokinase-1 [Eucalyptus grandis]
 gb|KCW49483.1| hypothetical protein EUGRSUZ_K03004 [Eucalyptus grandis]
Length=503

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ+EFVPTVRV    + PDIYS+WKMLQW+PPEF RAPGGPPSNVAIS
Sbjct  130  YDDPPLVCCFGAAQREFVPTVRVHHNPLHPDIYSQWKMLQWDPPEFARAPGGPPSNVAIS  189

Query  579  HVRLGGRAAFMGKVGDDEFG  638
            HVRLGGRAAFMGKVG DEFG
Sbjct  190  HVRLGGRAAFMGKVGRDEFG  209



>gb|ADI87420.1| fructokinase-like protein 1 [Vigna unguiculata]
Length=468

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGAAQ+EF+P VRV    M PD YSEWKMLQW PPEF RAPGGPPSNVA
Sbjct  93   FPYEDPPLVCCFGAAQREFIPGVRVQMYPMHPDKYSEWKMLQWKPPEFARAPGGPPSNVA  152

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++HVRLGGRAAF+GKVG DEFG+
Sbjct  153  VAHVRLGGRAAFLGKVGRDEFGD  175



>gb|ADI87415.1| fructokinase-like protein 1 [Citrus clementina]
Length=479

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LICCFGA QKEFVPTVRV   QM PDIYS WKM+QW+PPEFVRAPGGPPSNVAISHVRLG
Sbjct  111  LICCFGAVQKEFVPTVRVHDNQMHPDIYSTWKMVQWDPPEFVRAPGGPPSNVAISHVRLG  170

Query  594  GRAAFMGKVGDDEFGE  641
            GRAAF+GKVG D+FG+
Sbjct  171  GRAAFLGKVGADDFGD  186



>ref|XP_006480938.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
Length=496

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LICCFGA QKEFVPTVRV   QM PDIYS WKM+QW+PPEFVRAPGGPPSNVAISHVRLG
Sbjct  128  LICCFGAVQKEFVPTVRVHDNQMHPDIYSTWKMVQWDPPEFVRAPGGPPSNVAISHVRLG  187

Query  594  GRAAFMGKVGDDEFGE  641
            GRAAF+GKVG D+FG+
Sbjct  188  GRAAFLGKVGADDFGD  203



>ref|XP_006429264.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
 gb|ESR42504.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
Length=496

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LICCFGA QKEFVPTVRV   QM PDIYS WKM+QW+PPEFVRAPGGPPSNVAISHVRLG
Sbjct  128  LICCFGAVQKEFVPTVRVHDNQMHPDIYSTWKMVQWDPPEFVRAPGGPPSNVAISHVRLG  187

Query  594  GRAAFMGKVGDDEFGE  641
            GRAAF+GKVG D+FG+
Sbjct  188  GRAAFLGKVGADDFGD  203



>ref|XP_002322950.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
 gb|EEF04711.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
Length=485

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CCFGA QKEFVPTVRV    M  D+YS+WKMLQW+PPEF RAPGGP SNVA
Sbjct  109  FPYEYPPLVCCFGAVQKEFVPTVRVHDNPMHQDMYSQWKMLQWDPPEFARAPGGPVSNVA  168

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+H RLGGRAA +GKVGDDE GE
Sbjct  169  IAHARLGGRAAVIGKVGDDELGE  191



>ref|XP_007133958.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
 gb|ESW05952.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
Length=470

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPYE PPL+CC+GAA++EF+P VRV    M  D YSEWKMLQW PPEF RAPGGPPSNVA
Sbjct  95   FPYEDPPLVCCYGAARREFIPGVRVQLHPMHADKYSEWKMLQWKPPEFARAPGGPPSNVA  154

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++HVRLGGRAAF+GKVG DEFG+
Sbjct  155  VAHVRLGGRAAFLGKVGRDEFGD  177



>gb|EEC71816.1| hypothetical protein OsI_04455 [Oryza sativa Indica Group]
Length=398

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            PY+ PPL+CCFGA + EFVPTVRV+  QM PDIYS W  LQW PPEF RAPG   SNVAI
Sbjct  150  PYDWPPLVCCFGAPRWEFVPTVRVSDRQMHPDIYSTWLHLQWEPPEFARAPGSAASNVAI  209

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGGRAA +GKVGDD+FG
Sbjct  210  ALTRLGGRAAVLGKVGDDDFG  230



>ref|NP_001044818.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAD82650.1| putative fructokinase [Oryza sativa Japonica Group]
 dbj|BAF06732.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAG89476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            PY+ PPL+CCFGA + EFVPTVRV+  QM PDIYS W  LQW PPEF RAPG   SNVAI
Sbjct  150  PYDWPPLVCCFGAPRWEFVPTVRVSDRQMHPDIYSTWLHLQWEPPEFARAPGSAASNVAI  209

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGGRAA +GKVGDD+FG
Sbjct  210  ALTRLGGRAAVLGKVGDDDFG  230



>gb|EEE55679.1| hypothetical protein OsJ_04093 [Oryza sativa Japonica Group]
Length=590

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            PY+ PPL+CCFGA + EFVPTVRV+  QM PDIYS W  LQW PPEF RAPG   SNVAI
Sbjct  148  PYDWPPLVCCFGAPRWEFVPTVRVSDRQMHPDIYSTWLHLQWEPPEFARAPGSAASNVAI  207

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGGRAA +GKVGDD+FG
Sbjct  208  ALTRLGGRAAVLGKVGDDDFG  228



>emb|CBH32521.1| protein kinase, putative, expressed [Triticum aestivum]
 emb|CDM85037.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 96/162 (59%), Gaps = 14/162 (9%)
 Frame = +3

Query  171  SKTSHRALKKTSPSSKPRGR--PKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVE  344
            +K + R  KK    S   G   P  +P++        +R++  P++E +    E ++  E
Sbjct  70   AKATRRKTKKAGQESDSEGEEEPAAKPRA--------RRTKKSPKQEAKQQQGEEDAQAE  121

Query  345  PPvnadevddyddgvd----FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKM  512
             P +A   +D  D        PYE PPL+CCFGA + EFVPTVRV+ +QM PD YS W  
Sbjct  122  EPRSAAREEDAGDDGGDGADLPYEWPPLVCCFGAPRWEFVPTVRVSDQQMHPDQYSTWLH  181

Query  513  LQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
            LQW PPEF R+PG   SNVAI+  RLGGRAA +GKVGDD+FG
Sbjct  182  LQWEPPEFARSPGSASSNVAIALTRLGGRAAVLGKVGDDDFG  223



>dbj|BAJ87729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 105/189 (56%), Gaps = 20/189 (11%)
 Frame = +3

Query  111  CHPN-------PPKSSSADDHTTTQQP------SKTSHRALKKTSPSSKPRGRPKKEPQS  251
            C PN       PPKS+         +P      +K + R  KK    S   G  ++EP +
Sbjct  38   CSPNGAAAPEPPPKSTPRRGRKKASEPGSSPPKAKATRRKTKKAGQESDSEG--EEEPAA  95

Query  252  ETIESVATKRSRARPRKETQSDTEEFESYVEPPvnadevddyddgvdFPYESPPLICCFG  431
            +      T+R++  P +E +   EE E         D  +D D   D PYE PPL+CCFG
Sbjct  96   KP----KTRRTKKSPEQEAKQPGEEEEPQT-AAREEDAGNDGDGVADLPYEWPPLVCCFG  150

Query  432  AAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFM  611
            A + EFVPTVRV+ +QM PD YS W  LQW PPEF R+PG   SNVAI+  RLGGRAA +
Sbjct  151  APRWEFVPTVRVSDQQMHPDQYSSWLHLQWEPPEFARSPGSASSNVAIALTRLGGRAAVL  210

Query  612  GKVGDDEFG  638
            GKVGDD+FG
Sbjct  211  GKVGDDDFG  219



>ref|NP_001147575.1| protein kinase [Zea mays]
 gb|ACG27971.1| protein kinase [Zea mays]
Length=521

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F  E PPL+CCFGA + EFVPTVRV+  QM PD+YS W+ LQW PPEF RAPG   SNVA
Sbjct  139  FANEWPPLVCCFGAPRWEFVPTVRVSDRQMHPDMYSTWRHLQWEPPEFARAPGSAASNVA  198

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGGRAA +GKVGDD+FG
Sbjct  199  IALTRLGGRAAVLGKVGDDDFG  220



>tpg|DAA56815.1| TPA: protein kinase [Zea mays]
Length=521

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F  E PPL+CCFGA + EFVPTVRV+  QM PD+YS W+ LQW PPEF RAPG   SNVA
Sbjct  139  FANEWPPLVCCFGAPRWEFVPTVRVSDRQMHPDMYSTWRHLQWEPPEFARAPGSAASNVA  198

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGGRAA +GKVGDD+FG
Sbjct  199  IALTRLGGRAAVLGKVGDDDFG  220



>ref|XP_002456644.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
 gb|EES01764.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
Length=524

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F  E PPL+CCFGA + EFVPTVRV+  QM PD+YS W+ LQW PPEF RAPG   SNVA
Sbjct  142  FANEWPPLVCCFGAPRWEFVPTVRVSDRQMHPDMYSTWRHLQWEPPEFARAPGSAASNVA  201

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGGRAA +GKVGDD+FG
Sbjct  202  IALTRLGGRAAVLGKVGDDDFG  223



>ref|XP_003564619.1| PREDICTED: fructokinase-like 1, chloroplastic [Brachypodium distachyon]
Length=526

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            FPY+ PPL+CCFGA + EFVPTVRV+  QM PD YS W  LQW PPEF R PG   SNVA
Sbjct  145  FPYDWPPLVCCFGAPRWEFVPTVRVSDRQMHPDQYSSWLHLQWEPPEFARTPGSAASNVA  204

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGGRAA +GKVGDD+FG
Sbjct  205  IALTRLGGRAAVLGKVGDDDFG  226



>ref|XP_004970597.1| PREDICTED: fructokinase-2-like [Setaria italica]
Length=528

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F  + PPL+CCFGA + EFVPTVRV+  QM PD YS W  LQW PPEF RAPG   SNVA
Sbjct  146  FANDWPPLVCCFGAPRWEFVPTVRVSDRQMHPDQYSTWLHLQWEPPEFARAPGSAASNVA  205

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+H RLGGRAA +GKVGDD+FG
Sbjct  206  IAHTRLGGRAAVLGKVGDDDFG  227



>ref|XP_002986741.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
 gb|EFJ12304.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
Length=382

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A K+F+P+VRV  +QMD D YS WK LQW PPEF R+PG  P+NVAIS  RL
Sbjct  15   PLVCCFGEAYKDFIPSVRVCVKQMDEDAYSTWKGLQWMPPEFARSPGTSPANVAISIARL  74

Query  591  GGRAAFMGKVGDDEFGE  641
             G+AAF+GK+G+D+ G+
Sbjct  75   AGKAAFIGKLGNDDLGK  91



>ref|XP_002973268.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
 gb|EFJ25642.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
Length=382

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A K+F+P+VRV  +QMD D YS WK LQW PPEF R+PG  P+NVAIS  RL
Sbjct  15   PLVCCFGEAYKDFIPSVRVCVKQMDEDAYSTWKGLQWMPPEFARSPGTSPANVAISIARL  74

Query  591  GGRAAFMGKVGDDEFGE  641
             G+AAF+GK+G+D+ G+
Sbjct  75   AGKAAFIGKLGNDDLGK  91



>gb|KDO58031.1| hypothetical protein CISIN_1g037052mg, partial [Citrus sinensis]
Length=183

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            LICCFGA QKEFVPTVRV   QM PDIYS WKM+QW+PPEFVRAPGGPPSNVAISH
Sbjct  128  LICCFGAVQKEFVPTVRVHDNQMHPDIYSTWKMVQWDPPEFVRAPGGPPSNVAISH  183



>ref|XP_001774794.1| predicted protein [Physcomitrella patens]
 gb|EDQ60335.1| predicted protein, partial [Physcomitrella patens]
Length=390

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 3/84 (4%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAP---EQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNV  569
            ++ PPL+CCFG A KEF+PTVR      E  D D+YS WK LQW+PPEFVRAPG  PSN+
Sbjct  4    FDWPPLVCCFGEAHKEFIPTVRYHERNYELYDEDVYSSWKGLQWSPPEFVRAPGTSPSNL  63

Query  570  AISHVRLGGRAAFMGKVGDDEFGE  641
            A++  RL  R AF+GKVG+D  G+
Sbjct  64   AVALARLNARVAFVGKVGNDVHGQ  87



>ref|XP_010091598.1| hypothetical protein L484_026446 [Morus notabilis]
 gb|EXB44864.1| hypothetical protein L484_026446 [Morus notabilis]
Length=569

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 95/177 (54%), Gaps = 17/177 (10%)
 Frame = +3

Query  138  SADDHTTTQQPSKTSHRALKKTSPSS-------KPRGRPKKEPQSETIESVATKRSRARP  296
            SA    T + P +T  +A    + SS       + RGR K + +  T E + +K      
Sbjct  107  SAAGKDTKRSPWRTRKKASSAATTSSDEVKTEKRVRGRRKTKQKEATAEDLVSKSE----  162

Query  297  RKETQSDTEE--FESYVEPPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVA  470
                 S+TEE  + +  E   + +   D  + + F Y  PPL+CCFGAAQ  FVP+ R+A
Sbjct  163  ----VSETEEPTYAANAEEESDEELKIDEGEDISFTYGWPPLVCCFGAAQHAFVPSGRLA  218

Query  471  PEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
               +D +I+   K   W+P +FVRAPGG   +VAI+   LGG+ AFMGK+G D++GE
Sbjct  219  NRLVDYEIHERMKDALWSPEKFVRAPGGSAGSVAIALASLGGKVAFMGKLGSDDYGE  275



>ref|XP_010937787.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 2, chloroplastic 
[Elaeis guineensis]
Length=559

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  F+P+ R A   +D +I+   K + W+P +F+RAPGGP S+VA
Sbjct  189  FTYRWPPLVCCFGAAQHLFIPSGRPANRLIDHEIHDSKKDMFWSPTKFIRAPGGPSSSVA  248

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++  ++GGR  FMGK+GDDE+G+
Sbjct  249  VALAKIGGRVEFMGKLGDDEYGQ  271



>ref|XP_008777340.1| PREDICTED: putative fructokinase-5 [Phoenix dactylifera]
Length=559

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 12/160 (8%)
 Frame = +3

Query  195  KKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSD--TEEFESYVEPPvnadev  368
            +K +   + +  P   P++++ E  ATKR R R + +T  D    E  + +EP       
Sbjct  113  RKVTRKGRKKVTPLPSPEADSNEKKATKR-RTRKKVDTMKDQSVSEKLNNLEPICTNVLD  171

Query  369  ddyddgv---------dFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQW  521
             + ++            F Y  PPL+CCFGAAQ  F+P+ R A   +D +I+   K   W
Sbjct  172  SENEELQLIEDEGEDISFTYSWPPLVCCFGAAQHLFIPSGRPANRLIDHEIHDAMKDTFW  231

Query  522  NPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            +P +F+RAPGGP S VA++  ++GGR  FMGK+GDDE+G+
Sbjct  232  SPTKFIRAPGGPSSGVAVALAKIGGRVEFMGKLGDDEYGQ  271



>ref|XP_010680662.1| PREDICTED: fructokinase-like 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=577

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 88/168 (52%), Gaps = 22/168 (13%)
 Frame = +3

Query  204  SPSSKPRGRPKKEPQSET----IESVAT-KRSRARPRKETQSDTEEFESYVE--------  344
            S S KP+ R +K+  S T    +E V T K+SR R  KE  S  E+  S +E        
Sbjct  111  SDSEKPKRRTRKKVVSPTSTSGMEEVKTNKKSRGRKSKEEISKVEDQTSEMEVNDLEEVV  170

Query  345  ---------PPvnadevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIY  497
                       ++        D + F Y  PPL+CCFGAAQ  FVP+ R A   +D +I+
Sbjct  171  YRTSQDNDDSDIDLQLGKSDGDDISFSYGWPPLVCCFGAAQHAFVPSGRPANRLIDYEIH  230

Query  498  SEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
               K   W P +FVRAPGG    VAI+   LGGR AFMGK+G+D++G+
Sbjct  231  DSLKDALWEPEKFVRAPGGSAGGVAIALASLGGRVAFMGKLGNDDYGQ  278



>ref|XP_010257983.1| PREDICTED: fructokinase-like 2, chloroplastic [Nelumbo nucifera]
Length=709

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 86/146 (59%), Gaps = 13/146 (9%)
 Frame = +3

Query  243  PQSETIESVATKRSRARPR--------KETQSDTEEFESYVEPPvnadevddy-----dd  383
            P+ E I+   ++RS+A+ +         E++ D  E  ++ E PV+  E D       +D
Sbjct  251  PEGENIDKKVSRRSKAKKKVNETEDQDSESEPDDHEGPTFNEIPVSEKEDDIEFGKEGED  310

Query  384  gvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPS  563
             + F Y+ PPL+CCFGAAQ  FVP+ R +   +D +I+       W P +FVRAPGG  S
Sbjct  311  DISFTYDWPPLVCCFGAAQHAFVPSGRPSNRLIDHEIHESMNDALWAPKKFVRAPGGSSS  370

Query  564  NVAISHVRLGGRAAFMGKVGDDEFGE  641
            NVA++   LGGR  FMGK+GDD++G+
Sbjct  371  NVAVALASLGGRVTFMGKLGDDDYGQ  396



>ref|XP_004239035.1| PREDICTED: fructokinase-like 2, chloroplastic [Solanum lycopersicum]
Length=645

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R +   +D + +   K + W+P +F+RAPGG  SNVA
Sbjct  269  FTYGWPPLVCCFGAAQHAFVPSGRPSNRLVDHEWHERMKDVMWDPEKFIRAPGGCSSNVA  328

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD+FG+
Sbjct  329  VALASLGGKVAFMGKLGDDDFGQ  351



>ref|XP_006348670.1| PREDICTED: uncharacterized protein LOC102589995 [Solanum tuberosum]
Length=650

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R +   +D + +   K + W+P +F+RAPGG  SNVA
Sbjct  274  FTYGWPPLVCCFGAAQHAFVPSGRPSNRLVDHEWHERMKDVMWDPEKFIRAPGGCSSNVA  333

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD+FG+
Sbjct  334  VALASLGGKVAFMGKLGDDDFGQ  356



>ref|XP_011075683.1| PREDICTED: fructokinase-like 2, chloroplastic [Sesamum indicum]
Length=570

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP  R A   +D +I+   K   W P +FVRA GG  SNVA
Sbjct  195  FTYGWPPLVCCFGAAQHAFVPAGRQANRLIDYEIHDRKKEALWEPEKFVRASGGCSSNVA  254

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD FG+
Sbjct  255  VALASLGGKVAFMGKLGDDAFGQ  277



>ref|XP_002273674.2| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Vitis 
vinifera]
 emb|CBI27307.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   WNP +FVRAPGG   +VA++
Sbjct  191  YGWPPLVCCFGAAQHAFVPSGRPANRLIDHEIHERMKDTFWNPEKFVRAPGGSAGSVAVA  250

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  251  LASLGGKVAFMGKLGDDDFGQ  271



>ref|XP_010649953.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Vitis 
vinifera]
Length=627

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   WNP +FVRAPGG   +VA++
Sbjct  253  YGWPPLVCCFGAAQHAFVPSGRPANRLIDHEIHERMKDTFWNPEKFVRAPGGSAGSVAVA  312

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  313  LASLGGKVAFMGKLGDDDFGQ  333



>gb|KDP41324.1| hypothetical protein JCGZ_15731 [Jatropha curcas]
Length=580

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P  FVRAPGG   +VA
Sbjct  194  YTYGWPPLVCCFGAAQHAFVPSGRPANRLIDYEIHERMKDALWAPKNFVRAPGGSAGSVA  253

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+GDDE+G+
Sbjct  254  IALASLGGKVAFMGKLGDDEYGQ  276



>gb|KDO70322.1| hypothetical protein CISIN_1g0081612mg, partial [Citrus sinensis]
Length=500

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFG+AQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   + A
Sbjct  199  FTYGWPPLVCCFGSAQHAFVPSGRPANRLIDHEIHERMKDALWAPEKFIRSPGGCTGSAA  258

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+  RLGG+ AFMGK+GDDE+G+
Sbjct  259  IALARLGGKVAFMGKLGDDEYGQ  281



>ref|XP_007222921.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24120.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=485

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   +VA
Sbjct  180  YTYDWPPLVCCFGAAQHAFVPSGRPANRLIDYEIHERKKDALWAPEKFIRSPGGSAGSVA  239

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+GDDE+G+
Sbjct  240  IALASLGGKVAFMGKLGDDEYGQ  262



>ref|XP_002312288.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
 gb|EEE89655.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
Length=607

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y+ PPL+CCFGAAQ  FVPT R A   ++ +I+   +   W P +F+RAPGG    VA
Sbjct  193  YTYDWPPLVCCFGAAQHAFVPTGRPANRLLNYEIHDRMREAYWEPEKFMRAPGGSAGGVA  252

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDDEFG+
Sbjct  253  VALASLGGKVAFMGKLGDDEFGQ  275



>gb|EMS47290.1| hypothetical protein TRIUR3_20910 [Triticum urartu]
Length=540

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+S  K + W+P EFVRAPGG  SNVA++   L
Sbjct  159  PLVCCFGPAKYSFIPSGRPAKRLVDREIHSRMKDMFWSPDEFVRAPGGSSSNVALALAAL  218

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDDE+G+
Sbjct  219  GGRVVFMGKLGDDEYGQ  235



>ref|XP_006437893.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
 gb|ESR51133.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
Length=575

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFG+AQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   + A
Sbjct  199  FTYGWPPLVCCFGSAQHAFVPSGRPANRLIDHEIHERMKDALWAPEKFIRSPGGCTGSAA  258

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+  RLGG+ AFMGK+GDDE+G+
Sbjct  259  IALARLGGKVAFMGKLGDDEYGQ  281



>ref|XP_006484232.1| PREDICTED: uncharacterized protein LOC102617588 [Citrus sinensis]
Length=575

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFG+AQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   + A
Sbjct  199  FTYGWPPLVCCFGSAQHAFVPSGRPANRLIDHEIHERMKDALWAPEKFIRSPGGCTGSAA  258

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+  RLGG+ AFMGK+GDDE+G+
Sbjct  259  IALARLGGKVAFMGKLGDDEYGQ  281



>gb|KDO70321.1| hypothetical protein CISIN_1g0081612mg [Citrus sinensis]
Length=575

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFG+AQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   + A
Sbjct  199  FTYGWPPLVCCFGSAQHAFVPSGRPANRLIDHEIHERMKDALWAPEKFIRSPGGCTGSAA  258

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+  RLGG+ AFMGK+GDDE+G+
Sbjct  259  IALARLGGKVAFMGKLGDDEYGQ  281



>ref|XP_004982464.1| PREDICTED: putative fructokinase-5-like [Setaria italica]
Length=581

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y   PL+CCFG A+  F+P+ R A   +D +I+   + + W+P +FVRAPGGP SNVA++
Sbjct  195  YSLMPLVCCFGPAKYSFIPSGRPANRLIDHEIHDRMRDMFWSPDKFVRAPGGPSSNVALA  254

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               +GGR AFMGK+GDDE+G+
Sbjct  255  LAAIGGRVAFMGKLGDDEYGQ  275



>ref|XP_008243824.1| PREDICTED: uncharacterized protein LOC103342040 [Prunus mume]
Length=555

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   +VA
Sbjct  180  YTYDWPPLVCCFGAAQHAFVPSGRPANRLIDYEIHERKKDALWAPEKFIRSPGGSAGSVA  239

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+GDDE+G+
Sbjct  240  IALASLGGKVAFMGKLGDDEYGQ  262



>ref|XP_007222920.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24119.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=555

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   +VA
Sbjct  180  YTYDWPPLVCCFGAAQHAFVPSGRPANRLIDYEIHERKKDALWAPEKFIRSPGGSAGSVA  239

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+GDDE+G+
Sbjct  240  IALASLGGKVAFMGKLGDDEYGQ  262



>ref|XP_011018828.1| PREDICTED: fructokinase-like 2, chloroplastic [Populus euphratica]
Length=607

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y+ PPL+CCFGAAQ  FVPT R A   ++ +I+   +   W P +F+R+PGG    VA
Sbjct  193  YTYDWPPLVCCFGAAQHAFVPTGRPASRLLNYEIHDRMREAYWEPEKFMRSPGGSAGGVA  252

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDDEFG+
Sbjct  253  VALASLGGKVAFMGKLGDDEFGQ  275



>gb|ADI87422.1| fructokinase-like protein 2 [Nicotiana benthamiana]
Length=624

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R +   +D + +   K   W+P +F RAPGG  SNVA
Sbjct  248  FSYGWPPLVCCFGAAQHAFVPSGRPSNRLVDHEWHERMKDAIWDPEKFTRAPGGCSSNVA  307

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD+FG+
Sbjct  308  VALASLGGKVAFMGKLGDDDFGQ  330



>ref|XP_009786224.1| PREDICTED: uncharacterized protein LOC104234369 [Nicotiana sylvestris]
Length=648

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R +   +D + +   K   W+P +F RAPGG  SNVA
Sbjct  272  FSYGWPPLVCCFGAAQHAFVPSGRPSNRLVDHEWHERMKDAIWDPEKFTRAPGGCSSNVA  331

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD+FG+
Sbjct  332  VALASLGGKVAFMGKLGDDDFGQ  354



>ref|XP_009628355.1| PREDICTED: uncharacterized protein LOC104118730 [Nicotiana tomentosiformis]
Length=648

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R +   +D + +   K   W+P +F RAPGG  SNVA
Sbjct  272  FSYGWPPLVCCFGAAQHAFVPSGRPSNRLVDHEWHERMKDAIWDPEKFTRAPGGCSSNVA  331

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD+FG+
Sbjct  332  VALASLGGKVAFMGKLGDDDFGQ  354



>ref|XP_003562305.1| PREDICTED: fructokinase-like 2, chloroplastic [Brachypodium distachyon]
Length=578

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S PL+CCFG ++  F+P+ R A   +D +I+S  K + W+P EFVRAPGGP SNVA++  
Sbjct  193  SMPLVCCFGPSKYSFIPSGRPANRLVDHEIHSRMKDMFWSPDEFVRAPGGPSSNVALALA  252

Query  585  RLGGRAAFMGKVGDDEFGE  641
             LG R  FMGK+GDDE+G+
Sbjct  253  ALGSRVVFMGKLGDDEYGQ  271



>ref|XP_009356435.1| PREDICTED: probable fructokinase-4 isoform X3 [Pyrus x bretschneideri]
Length=558

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +FVR+PGG   +VAI+
Sbjct  183  YDWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERKKDALWAPEKFVRSPGGSAGSVAIA  242

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  243  LASLGGKVAFMGKLGDDQFGQ  263



>ref|XP_009356434.1| PREDICTED: probable fructokinase-4 isoform X2 [Pyrus x bretschneideri]
Length=559

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +FVR+PGG   +VAI+
Sbjct  184  YDWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERKKDALWAPEKFVRSPGGSAGSVAIA  243

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  244  LASLGGKVAFMGKLGDDQFGQ  264



>ref|XP_009356432.1| PREDICTED: probable fructokinase-4 isoform X1 [Pyrus x bretschneideri]
Length=561

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +FVR+PGG   +VAI+
Sbjct  186  YDWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERKKDALWAPEKFVRSPGGSAGSVAIA  245

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  246  LASLGGKVAFMGKLGDDQFGQ  266



>ref|XP_010551378.1| PREDICTED: fructokinase-like 2, chloroplastic [Tarenaya hassleriana]
Length=604

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 87/171 (51%), Gaps = 22/171 (13%)
 Frame = +3

Query  156  TTQQPSKTSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFES  335
            +T QP +T  +AL  +S   + +   K             +R RA  + +   +  E   
Sbjct  113  STTQPRRTRRKALASSSDVDEAKTEKK------------VRRRRAAKKDKDIDNASEVSD  160

Query  336  YVEPPvnadevddyddgvdFP-YES---------PPLICCFGAAQKEFVPTVRVAPEQMD  485
              EPP   +   + ++ +D   YES         PPL+CCFG+AQ  FVP+ R A   +D
Sbjct  161  LEEPPTIENVDAESEEDIDLDKYESEDISYTYGWPPLVCCFGSAQHAFVPSGRRANRLLD  220

Query  486  PDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
             +++   +   W P +F+RAPGG    VAI+   LGG+ AFMGK+GDD++G
Sbjct  221  YELHDRMRDAFWAPEKFIRAPGGCAGGVAIALASLGGKVAFMGKLGDDDYG  271



>gb|KFK41343.1| hypothetical protein AALP_AA2G117900 [Arabis alpina]
Length=615

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   ++ DI+   K   W+P +++RAPGG    VAI+
Sbjct  201  YGWPPLVCCFGSAQHAFVPSGRPANRLLNYDIHERMKDAVWSPEKYIRAPGGCAGGVAIA  260

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+AAFMGK+GDD+FG+
Sbjct  261  LASLGGKAAFMGKLGDDDFGQ  281



>ref|XP_002512061.1| fructokinase, putative [Ricinus communis]
 gb|EEF50730.1| fructokinase, putative [Ricinus communis]
Length=575

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   ++ +I+   K   W P +FVRAPGG   +VAI+
Sbjct  198  YGWPPLVCCFGAAQHAFVPSGRPANRLLNYEIHERMKDAYWAPEKFVRAPGGSAGSVAIA  257

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  258  LANLGGKVAFMGKLGDDEYGQ  278



>gb|EMT14724.1| hypothetical protein F775_09742 [Aegilops tauschii]
Length=774

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+S  K + W+P EFVRAPGG  SNVA++   L
Sbjct  393  PLVCCFGPAKYSFIPSGRPANRLVDREIHSRMKDMFWSPDEFVRAPGGSSSNVALALAAL  452

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDDE+G+
Sbjct  453  GGRVVFMGKLGDDEYGQ  469



>ref|XP_004144690.1| PREDICTED: fructokinase-2-like, partial [Cucumis sativus]
Length=447

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAA   FVP+ R A   +D +I+   K   W P +FVRAPGG   +VAI+
Sbjct  74   YSWPPLVCCFGAAHHAFVPSGRPANRLLDYEIHDRLKDALWAPEKFVRAPGGSAGSVAIA  133

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD++G+
Sbjct  134  LSSLGGKVAFMGKLGDDDYGQ  154



>ref|XP_004160828.1| PREDICTED: putative fructokinase-5-like [Cucumis sativus]
Length=568

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAA   FVP+ R A   +D +I+   K   W P +FVRAPGG   +VAI+
Sbjct  195  YSWPPLVCCFGAAHHAFVPSGRPANRLLDYEIHDRLKDALWAPEKFVRAPGGSAGSVAIA  254

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD++G+
Sbjct  255  LSSLGGKVAFMGKLGDDDYGQ  275



>gb|KHG26530.1| Fructokinase-2 [Gossypium arboreum]
Length=585

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 78/152 (51%), Gaps = 20/152 (13%)
 Frame = +3

Query  186  RALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvnade  365
            R +KK   +    G P+    S+T ES     S     +E + + +E E           
Sbjct  132  RTMKKDDDADGQSGEPE---ISDTEESTLMTNSGDESEEELELNIDEGEDI---------  179

Query  366  vddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRA  545
                     + Y  PPL+CCFGAAQ  FVP+ R A    D +I+   K  +W P +FVRA
Sbjct  180  --------SYTYGWPPLVCCFGAAQHAFVPSGRPANRLTDYEIHERLKDARWAPEKFVRA  231

Query  546  PGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            PGG   +VA++   LGG+ AFMGK+G+D++G+
Sbjct  232  PGGSAGSVALALASLGGKVAFMGKLGNDDYGQ  263



>ref|XP_010044389.1| PREDICTED: uncharacterized protein LOC104433370 [Eucalyptus grandis]
 gb|KCW86476.1| hypothetical protein EUGRSUZ_B03142 [Eucalyptus grandis]
Length=564

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P ++VRAPGG   +VA
Sbjct  189  YTYGWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERMKDALWAPDKYVRAPGGSAGSVA  248

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ A MGK+GDD++G+
Sbjct  249  IALANLGGKVALMGKLGDDDYGQ  271



>ref|XP_008442238.1| PREDICTED: uncharacterized protein LOC103486152 [Cucumis melo]
Length=588

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAA   FVP+ R A   +D +I++  K   W P +FVRAPGG   +VAI+
Sbjct  215  YSWPPLVCCFGAAHHAFVPSGRPANRLLDYEIHNRLKDALWAPEKFVRAPGGSAGSVAIA  274

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD++G+
Sbjct  275  LSSLGGKVAFMGKLGDDDYGQ  295



>gb|KGN54881.1| hypothetical protein Csa_4G571770 [Cucumis sativus]
Length=588

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAA   FVP+ R A   +D +I+   K   W P +FVRAPGG   +VAI+
Sbjct  215  YSWPPLVCCFGAAHHAFVPSGRPANRLLDYEIHDRLKDALWAPEKFVRAPGGSAGSVAIA  274

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD++G+
Sbjct  275  LSSLGGKVAFMGKLGDDDYGQ  295



>emb|CDP00452.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP  R +   +D +++   K   W P +FVR+PGG  SNVA
Sbjct  196  FTYGWPPLVCCFGAAQHAFVPVGRRSNRLIDHEMHEIKKDAIWAPEKFVRSPGGCASNVA  255

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD +G+
Sbjct  256  VALACLGGKVAFMGKLGDDAYGQ  278



>gb|EYU28879.1| hypothetical protein MIMGU_mgv1a003579mg [Erythranthe guttata]
Length=576

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP  R +   +D +I+   +   + P +FVRAPGG  SNVA
Sbjct  200  YTYGWPPLVCCFGAAQNAFVPAGRRSNRLIDYEIHDRKRDALYEPEKFVRAPGGSSSNVA  259

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            ++   LGG+ AFMGK+GDD +G
Sbjct  260  VALASLGGKVAFMGKLGDDAYG  281



>gb|KJB50552.1| hypothetical protein B456_008G176200 [Gossypium raimondii]
Length=587

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K  +W P +FVRAPGG   +VA
Sbjct  181  YTYGWPPLVCCFGAAQHAFVPSGRPANRLIDYEIHERMKDARWAPEKFVRAPGGCAGSVA  240

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ +FMGK+G+D++G+
Sbjct  241  LALASLGGKVSFMGKLGNDDYGQ  263



>ref|XP_007045821.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY01653.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
Length=577

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W   +FVRAPGG   +VA
Sbjct  190  YTYGWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERMKDAIWAAEKFVRAPGGSAGSVA  249

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD++G+
Sbjct  250  LALASLGGKVAFMGKLGDDDYGQ  272



>ref|XP_007045823.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
 gb|EOY01655.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
Length=585

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W   +FVRAPGG   +VA
Sbjct  190  YTYGWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERMKDAIWAAEKFVRAPGGSAGSVA  249

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD++G+
Sbjct  250  LALASLGGKVAFMGKLGDDDYGQ  272



>gb|EPS69174.1| hypothetical protein M569_05592, partial [Genlisea aurea]
Length=374

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 82/155 (53%), Gaps = 8/155 (5%)
 Frame = +3

Query  177  TSHRALKKTSPSSKPRGRPKKEPQSETIESVATKRSRARPRKETQSDTEEFESYVEPPvn  356
            + ++ ++KT+     RGR  K+     IE+     +      +++ +T     Y +  + 
Sbjct  8    SDNKTIQKTA-----RGRRSKKNDGAMIENQVDSETET---NDSEVETSSLYLYEDSELE  59

Query  357  adevddyddgvdFPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEF  536
             +   +  + + F Y  PPL+CCFG     FVP  R A   +D +++   +   W P +F
Sbjct  60   TELEIEEGEDISFTYGWPPLVCCFGEIHYAFVPNGRRANRLIDYELHDRNRDALWEPEKF  119

Query  537  VRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFGE  641
            VR+ GG  SNVAIS  +LGG+ AFMGK+G+D+ G+
Sbjct  120  VRSSGGCASNVAISLAKLGGKVAFMGKLGNDDLGQ  154



>gb|KHN44929.1| Fructokinase-2 [Glycine soja]
Length=557

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGA Q  FVP+ R A   ++ +I+   K   W+P +FVRAPGG   +VA
Sbjct  179  FTYGWPPLVCCFGAVQHAFVPSGRPANRLINHEIHESMKDALWSPEKFVRAPGGSAGSVA  238

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+ DD++G+
Sbjct  239  IALATLGGKVAFMGKLADDDYGQ  261



>ref|XP_006391045.1| hypothetical protein EUTSA_v100183770mg, partial [Eutrema salsugineum]
 gb|ESQ28331.1| hypothetical protein EUTSA_v100183770mg, partial [Eutrema salsugineum]
Length=310

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +     K   W+P +++RAPGG    VAI+
Sbjct  204  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYERQERMKDAIWSPEKYIRAPGGCAGGVAIA  263

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDEFG+
Sbjct  264  LASLGGKVAFMGKLGDDEFGQ  284



>ref|XP_006573158.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=573

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGA Q  FVP+ R A   ++ +I+   K   W+P +FVRAPGG   +VA
Sbjct  195  FTYGWPPLVCCFGAVQHAFVPSGRPANRLINHEIHESMKDALWSPEKFVRAPGGSAGSVA  254

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+ DD++G+
Sbjct  255  IALATLGGKVAFMGKLADDDYGQ  277



>tpg|DAA50254.1| TPA: hypothetical protein ZEAMMB73_178722 [Zea mays]
Length=656

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++   +
Sbjct  274  PLVCCFGPAKYSFIPSGRPANRLIDHEIHDRMKDMFWSPDKFVRAPGGSSSNVALALAAI  333

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR AFMGK+GDD++G+
Sbjct  334  GGRVAFMGKLGDDDYGQ  350



>ref|XP_007045822.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
 gb|EOY01654.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
Length=594

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W   +FVRAPGG   +VA
Sbjct  190  YTYGWPPLVCCFGAAQHAFVPSGRPANRLVDYEIHERMKDAIWAAEKFVRAPGGSAGSVA  249

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            ++   LGG+ AFMGK+GDD++G+
Sbjct  250  LALASLGGKVAFMGKLGDDDYGQ  272



>ref|XP_008389397.1| PREDICTED: probable fructokinase-1 isoform X1 [Malus domestica]
Length=559

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ  FV + R A   +D +I+   K   W P +F+R+PGG   +VAI+
Sbjct  184  YDWPPLVCCFGAAQHAFVXSGRPANRLVDYEIHERKKDALWAPEKFIRSPGGSAGSVAIA  243

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  244  LASLGGKVAFMGKLGDDQFGQ  264



>ref|XP_003614114.1| Fructokinase-2 [Medicago truncatula]
 gb|AES97072.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=578

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   +D +++   K   W+P +FVRAPGG   +VAI+
Sbjct  205  YGWPPLVCCFGAAQHAFVPSGRPANRLIDHELHERMKDALWSPEKFVRAPGGCAGSVAIA  264

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+ DDE+G+
Sbjct  265  LASLGGKVAFMGKLADDEYGQ  285



>ref|XP_008389398.1| PREDICTED: probable fructokinase-1 isoform X2 [Malus domestica]
Length=556

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y+ PPL+CCFGAAQ  FV + R A   +D +I+   K   W P +F+R+PGG   +VAI+
Sbjct  181  YDWPPLVCCFGAAQHAFVXSGRPANRLVDYEIHERKKDALWAPEKFIRSPGGSAGSVAIA  240

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  241  LASLGGKVAFMGKLGDDQFGQ  261



>ref|XP_004490214.1| PREDICTED: uncharacterized protein LOC101493906 [Cicer arietinum]
Length=577

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   +D +++   K   W+P +FVRAPGG   +VAI+
Sbjct  204  YGWPPLVCCFGAAQHAFVPSGRPANRLIDHELHERMKDALWSPEKFVRAPGGSAGSVAIA  263

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+ DDE+G+
Sbjct  264  LASLGGKVAFMGKLADDEYGQ  284



>ref|XP_004297219.1| PREDICTED: fructokinase-like 2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=554

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            + Y  PPL+CCFGAAQ  FVP+ R A   +D +I+   K   W P +F+R+PGG   +VA
Sbjct  177  YTYGWPPLVCCFGAAQHAFVPSGRPANRLLDYEIHERKKDALWAPEKFIRSPGGCAGSVA  236

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+GDD++G+
Sbjct  237  IALASLGGKVAFMGKLGDDDYGK  259



>ref|XP_008665080.1| PREDICTED: uncharacterized protein LOC103643674 [Zea mays]
Length=730

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++   +
Sbjct  348  PLVCCFGPAKYSFIPSGRPANRLIDHEIHDRMKDMFWSPDKFVRAPGGSSSNVALALAAI  407

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR AFMGK+GDD++G+
Sbjct  408  GGRVAFMGKLGDDDYGQ  424



>gb|KHN29971.1| Fructokinase-2 [Glycine soja]
Length=557

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R A   ++ +I+   K   W+P  FVRAPG    +VA
Sbjct  179  FTYGWPPLVCCFGAAQHAFVPSGRPANRLINHEIHESMKDALWSPENFVRAPGSSAGSVA  238

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+ DD++G+
Sbjct  239  IALATLGGKVAFMGKLADDDYGQ  261



>ref|XP_003518781.1| PREDICTED: probable fructokinase-2-like [Glycine max]
Length=573

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
            F Y  PPL+CCFGAAQ  FVP+ R A   ++ +I+   K   W+P  FVRAPG    +VA
Sbjct  195  FTYGWPPLVCCFGAAQHAFVPSGRPANRLINHEIHESMKDALWSPENFVRAPGSSAGSVA  254

Query  573  ISHVRLGGRAAFMGKVGDDEFGE  641
            I+   LGG+ AFMGK+ DD++G+
Sbjct  255  IALATLGGKVAFMGKLADDDYGQ  277



>ref|XP_006856418.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
 gb|ERN17885.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
Length=611

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 83/163 (51%), Gaps = 19/163 (12%)
 Frame = +3

Query  207  PSSKPRGRPKKEPQSETIESVATKRSRARPRK--------ETQSDTEEFESYVEPPvnad  362
            P    RGR KK   S T E  +T +   R RK        E +S   E    +E P++ +
Sbjct  119  PKISSRGRKKKASPSTTSEKESTTKKVGRRRKSKEVLNETEDESKNNEDSKDLEKPISTE  178

Query  363  evddyddgvdFP-----------YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWK  509
               +  D    P           Y+ PPL+CCFG A+  F+P+ R A   +D D++   K
Sbjct  179  SGSESKDSDLEPKEDEDEDASITYDWPPLVCCFGPAKYSFIPSGRPANRLVDYDMHESRK  238

Query  510  MLQWNPPEFVRAPGGPPSNVAISHVRLGGRAAFMGKVGDDEFG  638
             L W P +FVRAPG    +VA++   LGG+ A+MGK+GDD++G
Sbjct  239  GLIWTPTKFVRAPGTSSYHVALALASLGGKVAYMGKLGDDDYG  281



>ref|XP_002887225.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63484.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=612

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  200  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYELHKRMSDAKWAPEKYIRAPGGCAGGVAIA  259

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD++G+
Sbjct  260  LASLGGKVAFMGKLGDDDYGQ  280



>ref|XP_010470895.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=619

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  206  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  265

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  266  LASLGGKVAFMGKLGDDEYGQ  286



>ref|XP_010470894.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
Length=623

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  210  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  269

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  270  LASLGGKVAFMGKLGDDEYGQ  290



>ref|XP_010415548.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010415551.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=624

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  211  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  270

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  271  LASLGGKVAFMGKLGDDEYGQ  291



>ref|XP_010415552.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X3 [Camelina 
sativa]
Length=620

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  207  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  266

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  267  LASLGGKVAFMGKLGDDEYGQ  287



>ref|XP_006650283.1| PREDICTED: uncharacterized protein LOC102700038 [Oryza brachyantha]
Length=584

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   ++ +I+   K + W+P EFVRAPGG  SNVA++    
Sbjct  202  PLVCCFGPAKYSFIPSGRPANRLINHEIHEGMKDMFWSPDEFVRAPGGSSSNVALALAAT  261

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDDE+G+
Sbjct  262  GGRVEFMGKLGDDEYGQ  278



>ref|XP_002466840.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
 gb|EER93838.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
Length=583

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG   NVA++   +
Sbjct  201  PLVCCFGPAKYSFIPSGRPANRLIDHEIHDRMKDMFWSPDKFVRAPGGSSPNVALALAAI  260

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR AFMGK+GDD++G+
Sbjct  261  GGRVAFMGKLGDDDYGQ  277



>ref|XP_010511945.1| PREDICTED: fructokinase-like 2, chloroplastic [Camelina sativa]
Length=621

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  208  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  267

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDDE+G+
Sbjct  268  LASLGGKVAFMGKLGDDEYGQ  288



>ref|XP_006301975.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
 gb|EOA34873.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
Length=618

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP  R A   +D +++      +W P +++RAPGG    VAI+
Sbjct  206  YGWPPLVCCFGSAQHAFVPWGRPANRLLDYELHERMSDAKWAPEKYIRAPGGCAGGVAIA  265

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG  AFMGK+GDDE+G+
Sbjct  266  LASLGGNVAFMGKLGDDEYGQ  286



>gb|ABF97502.1| pfkB-type carbohydrate kinase family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=575

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++    
Sbjct  207  PLVCCFGPAKYSFIPSGRPANRLIDHEIHEGMKDMFWSPDQFVRAPGGSSSNVALALAAS  266

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDD++G+
Sbjct  267  GGRVEFMGKLGDDDYGQ  283



>gb|EEC75710.1| hypothetical protein OsI_12536 [Oryza sativa Indica Group]
Length=586

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++    
Sbjct  204  PLVCCFGPAKYSFIPSGRPANRLIDHEIHEGMKDMFWSPDQFVRAPGGSSSNVALALAAS  263

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDD++G+
Sbjct  264  GGRVEFMGKLGDDDYGQ  280



>gb|EEE59468.1| hypothetical protein OsJ_11670 [Oryza sativa Japonica Group]
Length=586

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++    
Sbjct  204  PLVCCFGPAKYSFIPSGRPANRLIDHEIHEGMKDMFWSPDQFVRAPGGSSSNVALALAAS  263

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDD++G+
Sbjct  264  GGRVEFMGKLGDDDYGQ  280



>gb|AAT81682.1| putative kinase [Oryza sativa Japonica Group]
Length=589

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+CCFG A+  F+P+ R A   +D +I+   K + W+P +FVRAPGG  SNVA++    
Sbjct  207  PLVCCFGPAKYSFIPSGRPANRLIDHEIHEGMKDMFWSPDQFVRAPGGSSSNVALALAAS  266

Query  591  GGRAAFMGKVGDDEFGE  641
            GGR  FMGK+GDD++G+
Sbjct  267  GGRVEFMGKLGDDDYGQ  283



>emb|CDY40900.1| BnaC06g30380D [Brassica napus]
Length=616

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +     K   W P +++RAPGG    VAI+
Sbjct  202  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYEQQERIKDAVWAPEKYIRAPGGCAGGVAIA  261

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+GDD+FG+
Sbjct  262  LASLGGKVAFMGKLGDDDFGQ  282



>gb|AAF27059.1|AC008262_8 F4N2.16 [Arabidopsis thaliana]
Length=568

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +++   +  +W P +++RAPGG    VAI+
Sbjct  155  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYELHERMRDAKWAPEKYIRAPGGCAGGVAIA  214

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+G D++G+
Sbjct  215  LASLGGKVAFMGKLGADDYGQ  235



>sp|F4I0K2.2|SCKL2_ARATH RecName: Full=Fructokinase-like 2, chloroplastic; AltName: Full=pfkB-type 
carbohydrate kinase family protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52502.1|AC018364_20 putative fructokinase; 80884-78543 [Arabidopsis thaliana]
Length=614

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +++   +  +W P +++RAPGG    VAI+
Sbjct  201  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYELHERMRDAKWAPEKYIRAPGGCAGGVAIA  260

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+G D++G+
Sbjct  261  LASLGGKVAFMGKLGADDYGQ  281



>ref|NP_177080.2| fructokinase-like 2 [Arabidopsis thaliana]
 gb|AEE34893.1| fructokinase-like 2 [Arabidopsis thaliana]
Length=616

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +++   +  +W P +++RAPGG    VAI+
Sbjct  203  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYELHERMRDAKWAPEKYIRAPGGCAGGVAIA  262

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+G D++G+
Sbjct  263  LASLGGKVAFMGKLGADDYGQ  283



>emb|CDX95956.1| BnaA07g27750D [Brassica napus]
Length=608

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +     K   W P +++RAPGG    VAI+
Sbjct  203  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYERQERMKDAVWAPEKYIRAPGGCAGGVAIA  262

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG  AFMGK+GDD+FG+
Sbjct  263  LASLGGNVAFMGKLGDDDFGQ  283



>ref|XP_009105465.1| PREDICTED: uncharacterized protein LOC103831320 [Brassica rapa]
Length=617

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFG+AQ  FVP+ R A   +D +     K   W P +++RAPGG    VAI+
Sbjct  203  YGWPPLVCCFGSAQHAFVPSGRPANRLLDYERQERMKDAVWAPEKYIRAPGGCAGGVAIA  262

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG  AFMGK+GDD+FG+
Sbjct  263  LASLGGNVAFMGKLGDDDFGQ  283



>ref|XP_007153496.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
 gb|ESW25490.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
Length=578

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  399  YESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAIS  578
            Y  PPL+CCFGAAQ  FVP+ R A   ++ +I+   K   W+P +F RAPG    +VAI+
Sbjct  204  YGWPPLVCCFGAAQHAFVPSGRPANRLINHEIHESKKDALWSPDKFFRAPGTSAGSVAIA  263

Query  579  HVRLGGRAAFMGKVGDDEFGE  641
               LGG+ AFMGK+ DD +GE
Sbjct  264  LATLGGKVAFMGKLADDIYGE  284



>ref|XP_009404276.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=321

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI CFG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  5    LIVCFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVARLG  50

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  51   GRAAFVGKLGDDEFG  65



>gb|ABR17236.1| unknown [Picea sitchensis]
Length=408

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 45/81 (56%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P E  PL+ CFG    +FVPTV                +     P F +APGG P+NVA+
Sbjct  83   PSEVSPLVVCFGEMLIDFVPTVS--------------GVSLAKAPAFKKAPGGAPANVAV  128

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
               RLGG +AFMGKVGDDEFG
Sbjct  129  GIARLGGSSAFMGKVGDDEFG  149



>emb|CDY54150.1| BnaCnng26300D [Brassica napus]
Length=472

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+ CFG+AQ   V + R A   +D +     K   W P +++RAPGG    VAI+   L
Sbjct  71   PLVFCFGSAQHACVRSGRPANRLLDYEQQERIKDAVWAPEKYIRAPGGCAGGVAIALASL  130

Query  591  GGRAAFMGKVGDDEFGE  641
            GG  AFMGK+GDD+FG+
Sbjct  131  GGNVAFMGKLGDDDFGQ  147



>gb|ABK25140.1| unknown [Picea sitchensis]
Length=408

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P E  PL+ CFG    +FVPTV                +     P F +APGG P+NVA+
Sbjct  83   PSEVSPLVVCFGEMLIDFVPTVS--------------GVSLAEAPAFKKAPGGAPANVAV  128

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
               RLGG +AF+GKVGDDEFG
Sbjct  129  GIARLGGSSAFIGKVGDDEFG  149



>ref|XP_009104208.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGGPP+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGPPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_010512210.1| PREDICTED: probable fructokinase-4 [Camelina sativa]
Length=326

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFGE  641
            GRAAF+GK+GDDEFG+
Sbjct  56   GRAAFVGKLGDDEFGQ  71



>ref|XP_009138911.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
 emb|CDX89022.1| BnaA04g01640D [Brassica napus]
Length=326

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV            SE        P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVS-------LSE-------APGFIKAPGGAPANVAIAVARLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>emb|CDY00619.1| BnaC04g23060D [Brassica napus]
Length=326

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV            SE        P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVS-------LSE-------APGFIKAPGGAPANVAIAVARLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_002876506.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52765.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_006304792.1| hypothetical protein CARUB_v10012342mg [Capsella rubella]
 gb|EOA37690.1| hypothetical protein CARUB_v10012342mg [Capsella rubella]
Length=329

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 16/76 (21%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVR-VAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            LI  FG    +FVPTV  V+  Q                P FV+APGG P+NVAI+  RL
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLSQ---------------SPGFVKAPGGAPANVAIAVSRL  54

Query  591  GGRAAFMGKVGDDEFG  638
            GGRAAF+GK+GDDEFG
Sbjct  55   GGRAAFVGKLGDDEFG  70



>gb|AAM64445.1| fructokinase-like protein [Arabidopsis thaliana]
Length=326

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|NP_191507.1| probable fructokinase-4 [Arabidopsis thaliana]
 sp|Q9M1B9.1|SCRK4_ARATH RecName: Full=Probable fructokinase-4 [Arabidopsis thaliana]
 emb|CAB75445.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|ABI49475.1| At3g59480 [Arabidopsis thaliana]
 gb|AEE79930.1| probable fructokinase-4 [Arabidopsis thaliana]
Length=326

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>gb|AHE93349.1| fructokinase [Camellia sinensis]
Length=327

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 45/78 (58%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI CFG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  10   SGSLIVCFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAIT  55

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG+++F+GK+GDDEFG
Sbjct  56   RLGGKSSFVGKLGDDEFG  73



>ref|XP_010526109.1| PREDICTED: probable fructokinase-4 [Tarenaya hassleriana]
Length=326

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAIARLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_009379916.1| PREDICTED: probable fructokinase-1 [Musa acuminata subsp. malaccensis]
Length=321

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  5    LIASFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVARLG  50

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  51   GRAAFVGKLGDDEFG  65



>gb|EYU36729.1| hypothetical protein MIMGU_mgv1a009780mg [Erythranthe guttata]
Length=332

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 44/79 (56%), Gaps = 14/79 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  10   SNGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVT  55

Query  585  RLGGRAAFMGKVGDDEFGE  641
            RLGG AAF+GK+GDDEFG+
Sbjct  56   RLGGNAAFVGKLGDDEFGQ  74



>gb|EYU37375.1| hypothetical protein MIMGU_mgv1a010047mg [Erythranthe guttata]
Length=324

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  LI  FG    +FVPTV                      P F++APGG P+NVAI+ 
Sbjct  3    KSNGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAV  48

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG+AAF+GK+GDDEFG
Sbjct  49   ARLGGKAAFLGKLGDDEFG  67



>emb|CDX98377.1| BnaC06g17380D [Brassica napus]
Length=326

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_006372862.1| hypothetical protein POPTR_0017s05770g [Populus trichocarpa]
 gb|ERP50659.1| hypothetical protein POPTR_0017s05770g [Populus trichocarpa]
Length=267

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 43/76 (57%), Gaps = 14/76 (18%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P FV+APGG P+NVAI+  RLG
Sbjct  11   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFVKAPGGAPANVAIAVARLG  56

Query  594  GRAAFMGKVGDDEFGE  641
            G+AAF+GK+GDDEFG 
Sbjct  57   GKAAFVGKLGDDEFGN  72



>emb|CDX71907.1| BnaC08g29670D [Brassica napus]
Length=326

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>gb|EYU38801.1| hypothetical protein MIMGU_mgv1a009756mg [Erythranthe guttata]
Length=332

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 44/79 (56%), Gaps = 14/79 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  10   SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVA  55

Query  585  RLGGRAAFMGKVGDDEFGE  641
            RLGG AAF+GK+GDDEFG+
Sbjct  56   RLGGNAAFVGKLGDDEFGQ  74



>emb|CDY06000.1| BnaA09g37800D [Brassica napus]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_009396809.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=324

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  8    LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  53

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  54   GRAAFVGKLGDDEFG  68



>ref|XP_009116612.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>emb|CDX67798.1| BnaA07g18380D [Brassica napus]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>ref|XP_010522182.1| PREDICTED: probable fructokinase-1 [Tarenaya hassleriana]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  9    LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  54

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  55   GRAAFVGKLGDDEFG  69



>ref|XP_010557080.1| PREDICTED: probable fructokinase-1 [Tarenaya hassleriana]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  9    LVVSFGEMLIDFVPTVSGVSLA--------------DAPGFLKAPGGAPANVAIAVARLG  54

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  55   GRAAFVGKLGDDEFG  69



>ref|XP_006292538.1| hypothetical protein CARUB_v10018769mg [Capsella rubella]
 gb|EOA25436.1| hypothetical protein CARUB_v10018769mg [Capsella rubella]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>gb|KFK31217.1| hypothetical protein AALP_AA6G083600 [Arabis alpina]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PLI  FG    +FVPT              E  +     P F++APGG P+NVAI+  RL
Sbjct  8    PLIVSFGEMLIDFVPT--------------ESGVSLAEAPGFLKAPGGAPANVAIAVTRL  53

Query  591  GGRAAFMGKVGDDEFG  638
            GGR+AF+GK+GDDEFG
Sbjct  54   GGRSAFVGKLGDDEFG  69



>ref|XP_010469311.1| PREDICTED: probable fructokinase-4 [Camelina sativa]
Length=326

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  56   GRAAFVGKLGDDEFG  70



>gb|KFK40243.1| hypothetical protein AALP_AA3G348700 [Arabis alpina]
Length=327

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GR+AF+GK+GDDEFG
Sbjct  56   GRSAFVGKLGDDEFG  70



>gb|AFO84081.1| fructokinase [Actinidia chinensis]
Length=329

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  10   SGGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAIT  55

Query  585  RLGGRAAFMGKVGDDEFGE  641
            RLGGR+AF+GK+GDDEFG+
Sbjct  56   RLGGRSAFVGKLGDDEFGQ  74



>gb|EPS66213.1| hypothetical protein M569_08566, partial [Genlisea aurea]
Length=323

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 14/80 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  LI  FG    +FVPTV                    + P F++APGG P+NVAI+ 
Sbjct  6    KSGGLIVSFGEMLIDFVPTVSGVSLA--------------DAPGFLKAPGGAPANVAIAV  51

Query  582  VRLGGRAAFMGKVGDDEFGE  641
             RLGG AAF+GK+GDDEFG+
Sbjct  52   ARLGGMAAFVGKLGDDEFGQ  71



>ref|XP_010268185.1| PREDICTED: probable fructokinase-1 [Nelumbo nucifera]
Length=324

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  6    SDGLILSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVA  51

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGGR+AF+GK+GDDEFG
Sbjct  52   RLGGRSAFVGKLGDDEFG  69



>gb|KFK35169.1| hypothetical protein AALP_AA5G248700 [Arabis alpina]
Length=327

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                    + P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------DAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GR+AF+GK+GDDEFG
Sbjct  56   GRSAFVGKLGDDEFG  70



>sp|Q7XJ81.1|SCRK2_SOLHA RecName: Full=Fructokinase-2 [Solanum habrochaites]
 gb|AAP87283.1| fructokinase 2 [Solanum habrochaites]
Length=328

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  8    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  53

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGGR+AF+GK+GDDEFG
Sbjct  54   RLGGRSAFVGKLGDDEFG  71



>gb|AII73555.1| fructokinase [Actinidia eriantha]
Length=318

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  10   SGGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAIT  55

Query  585  RLGGRAAFMGKVGDDEFGE  641
            RLGGR+AF+GK+GDDEFG+
Sbjct  56   RLGGRSAFVGKLGDDEFGQ  74



>ref|XP_001759326.1| predicted protein [Physcomitrella patens]
 gb|EDQ76010.1| predicted protein, partial [Physcomitrella patens]
Length=353

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+ CFG    +FVPTV                +   + P F +APGG P+NVA+   RLG
Sbjct  5    LVVCFGELLIDFVPTV--------------GGLSLADAPAFKKAPGGAPANVAVGIARLG  50

Query  594  GRAAFMGKVGDDEFG  638
            G AAF+GKVGDDEFG
Sbjct  51   GNAAFVGKVGDDEFG  65



>gb|ABK92748.1| unknown [Populus trichocarpa]
Length=328

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P FV+APGG P+NVAI+  RLG
Sbjct  11   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFVKAPGGAPANVAIAVARLG  56

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  57   GKAAFVGKLGDDEFG  71



>ref|XP_011091648.1| PREDICTED: fructokinase-2 [Sesamum indicum]
Length=329

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  9    SNGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVA  54

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG+AAF+GK+GDDEFG
Sbjct  55   RLGGKAAFVGKLGDDEFG  72



>ref|XP_006372861.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|ERP50658.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=328

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P FV+APGG P+NVAI+  RLG
Sbjct  11   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFVKAPGGAPANVAIAVARLG  56

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  57   GKAAFVGKLGDDEFG  71



>gb|ABK94952.1| unknown [Populus trichocarpa]
Length=328

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P FV+APGG P+NVAI+  RLG
Sbjct  11   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFVKAPGGAPANVAIAVARLG  56

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  57   GKAAFVGKLGDDEFG  71



>emb|CDP08915.1| unnamed protein product [Coffea canephora]
Length=381

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P +SP L+ CFG    +FVPTV                      P F +APGG P+NVA+
Sbjct  55   PVKSPGLVACFGELLIDFVPTVSGVSLA--------------EAPGFKKAPGGAPANVAV  100

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
               RLGG +AF+GKVG DEFG
Sbjct  101  GIARLGGSSAFIGKVGQDEFG  121



>emb|CDY23944.1| BnaC03g17470D [Brassica napus]
 emb|CDX84788.1| BnaA03g14420D [Brassica napus]
Length=325

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 46/81 (57%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P    PLI  FG    +FVPT              E  +     P F++APGG P+NVAI
Sbjct  3    PTGEKPLIVSFGEMLIDFVPT--------------ESGVSLAEAPGFLKAPGGAPANVAI  48

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGGR+AF+GK+GDDEFG
Sbjct  49   AVSRLGGRSAFVGKLGDDEFG  69



>gb|ACF74294.1| fructokinase [Arachis hypogaea]
Length=191

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 14/82 (17%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             P     L+  FG    +FVPTV                +     P F++APGG P+NVA
Sbjct  7    IPATGSGLVVSFGEMLIDFVPTVS--------------GVSLAEAPGFLKAPGGAPANVA  52

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGG+AAF+GK+GDDEFG
Sbjct  53   IAVARLGGKAAFVGKLGDDEFG  74



>ref|XP_009384261.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=329

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  13   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  58

Query  594  GRAAFMGKVGDDEFG  638
            GR AF+GK+GDDEFG
Sbjct  59   GRCAFLGKLGDDEFG  73



>ref|XP_008460045.1| PREDICTED: probable fructokinase-4 [Cucumis melo]
 gb|ADN34093.1| fructokinase [Cucumis melo subsp. melo]
Length=331

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  14   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVSRLG  59

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDDEFG
Sbjct  60   GRAAFVGKLGDDEFG  74



>ref|XP_009383349.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009383350.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=327

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++  L+  FG    +FVPTV                      P F++APGG P+NVAI+ 
Sbjct  7    DAAGLVVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAV  52

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGGR AF+GK+GDDEFG
Sbjct  53   ARLGGRCAFLGKLGDDEFG  71



>gb|KJB37261.1| hypothetical protein B456_006G196700 [Gossypium raimondii]
Length=362

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++ PL+ CFG    +FVPTV                +     P F +APGG P+NVA+  
Sbjct  35   KNKPLVVCFGELLIDFVPTV--------------GGVSLAEAPAFKKAPGGAPANVAVGV  80

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  81   SRLGGSSAFVGKVGDDEFG  99



>ref|XP_007150435.1| hypothetical protein PHAVU_005G153300g [Phaseolus vulgaris]
 gb|ESW22429.1| hypothetical protein PHAVU_005G153300g [Phaseolus vulgaris]
Length=330

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P     LI  FG    +FVPTV                      P F++APGG P+NVAI
Sbjct  8    PATGSGLIASFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAI  53

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGG+AAF+GK+GDDEFG
Sbjct  54   AVARLGGKAAFVGKLGDDEFG  74



>ref|XP_010909223.1| PREDICTED: fructokinase-1-like [Elaeis guineensis]
Length=328

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+  FG    +FVPTV                      P FV+APGG P+NVAI+  RLG
Sbjct  12   LVVSFGEMLIDFVPTVAAVSLA--------------EAPGFVKAPGGAPANVAIAVSRLG  57

Query  594  GRAAFMGKVGDDEFG  638
            GR+AF+GK+GDDEFG
Sbjct  58   GRSAFVGKLGDDEFG  72



>gb|EMT33516.1| hypothetical protein F775_30584 [Aegilops tauschii]
Length=344

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            P + CFG    +FVPTV                    + P F +APGG P+NVA+   RL
Sbjct  64   PHVVCFGELLIDFVPTVSGVSLA--------------DAPAFKKAPGGAPANVAVGIARL  109

Query  591  GGRAAFMGKVGDDEFG  638
            GG AAF+GKVGDDEFG
Sbjct  110  GGSAAFIGKVGDDEFG  125



>ref|XP_009144211.1| PREDICTED: probable fructokinase-1 [Brassica rapa]
Length=325

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PLI  FG    +FVPT              E  +     P F++APGG P+NVAI+  RL
Sbjct  8    PLIVSFGEMLIDFVPT--------------ESGVSLAEAPGFLKAPGGAPANVAIAVSRL  53

Query  591  GGRAAFMGKVGDDEFG  638
            GGR+AF+GK+GDDEFG
Sbjct  54   GGRSAFVGKLGDDEFG  69



>emb|CDY10801.1| BnaA05g11350D [Brassica napus]
Length=325

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PLI  FG    +FVPT              E  +     P F++APGG P+NVAI+  RL
Sbjct  8    PLIVSFGEMLIDFVPT--------------ESGVSLAEAPGFLKAPGGAPANVAIAVSRL  53

Query  591  GGRAAFMGKVGDDEFG  638
            GGR+AF+GK+GDDEFG
Sbjct  54   GGRSAFVGKLGDDEFG  69



>gb|KHG22422.1| hypothetical protein F383_26791 [Gossypium arboreum]
Length=357

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++ PL+ CFG    +FVPTV                +     P F +APGG P+NVA+  
Sbjct  30   KNKPLVVCFGELLIDFVPTV--------------GGVSLAEAPAFKKAPGGAPANVAVGV  75

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  76   SRLGGSSAFVGKVGDDEFG  94



>gb|AFW90635.1| fructokinase-like protein [Solanum tuberosum]
Length=266

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  9    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  54

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG++AF+GK+GDDEFG
Sbjct  55   RLGGKSAFVGKLGDDEFG  72



>gb|KFK26793.1| hypothetical protein AALP_AA8G294300 [Arabis alpina]
Length=343

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  16   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  61

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  62   SRLGGSSAFIGKVGDDEFG  80



>ref|XP_003597523.1| Fructokinase [Medicago truncatula]
 gb|AES67774.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=329

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 14/82 (17%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             P     LI  FG    +FVPTV                      P F++APGG P+NVA
Sbjct  7    IPTTGTGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVA  52

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGG+AAF+GK+GDDEFG
Sbjct  53   IAVSRLGGKAAFVGKLGDDEFG  74



>ref|XP_003616371.1| Fructokinase-2 [Medicago truncatula]
 gb|AES99329.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=386

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+ CFG    +FVPTV                +   + P F +APGG P+NVA+   RL
Sbjct  66   PLVVCFGEMLIDFVPTVS--------------GLSLADAPAFKKAPGGAPANVAVGISRL  111

Query  591  GGRAAFMGKVGDDEFG  638
            GG +AF+GKVG+DEFG
Sbjct  112  GGSSAFIGKVGEDEFG  127



>gb|KJB37262.1| hypothetical protein B456_006G196700 [Gossypium raimondii]
Length=362

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++ PL+ CFG    +FVPTV                +     P F +APGG P+NVA+  
Sbjct  35   KNKPLVVCFGELLIDFVPTV--------------GGVSLAEAPAFKKAPGGAPANVAVGV  80

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  81   SRLGGSSAFVGKVGDDEFG  99



>ref|XP_003537935.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=331

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  15   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  60

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  61   GKAAFVGKLGDDEFG  75



>emb|CDY56614.1| BnaCnng30740D [Brassica napus]
Length=325

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PLI  FG    +FVPT              E  +     P F++APGG P+NVAI+  RL
Sbjct  8    PLIVSFGEMLIDFVPT--------------ESGVSLAEAPGFLKAPGGAPANVAIAVSRL  53

Query  591  GGRAAFMGKVGDDEFG  638
            GGR+AF+GK+GDDEFG
Sbjct  54   GGRSAFVGKLGDDEFG  69



>ref|XP_003541157.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=330

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  14   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  59

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  60   GKAAFVGKLGDDEFG  74



>gb|AIX02985.1| fructokinase [Morella rubra]
Length=332

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P     LI  FG    +FVPTV                      P FV+APGG P+NVAI
Sbjct  10   PQTGSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFVKAPGGAPANVAI  55

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGG+AAF+GK+GDDEFG
Sbjct  56   AVSRLGGKAAFVGKLGDDEFG  76



>ref|XP_010442689.1| PREDICTED: probable fructokinase-7 isoform X1 [Camelina sativa]
Length=359

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>ref|XP_006280740.1| hypothetical protein CARUB_v10026709mg [Capsella rubella]
 gb|EOA13638.1| hypothetical protein CARUB_v10026709mg [Capsella rubella]
Length=346

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>gb|ABC01889.1| fructokinase-like protein [Solanum tuberosum]
Length=329

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  9    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  54

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG++AF+GK+GDDEFG
Sbjct  55   RLGGKSAFVGKLGDDEFG  72



>gb|ACN40355.1| unknown [Picea sitchensis]
Length=347

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+ CFG    +FVPTV         D+         + P F +A GG P+NVA+   RLG
Sbjct  29   LVVCFGEMLIDFVPTV--------SDVSLA------DAPGFQKAAGGAPANVAVGISRLG  74

Query  594  GRAAFMGKVGDDEFG  638
            GR+AF+GKVGDDEFG
Sbjct  75   GRSAFVGKVGDDEFG  89



>ref|XP_002864134.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40393.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=343

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>ref|XP_009399727.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=389

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI CFG    +FVPTV                +     P F +APGG P+NVA+   RLG
Sbjct  70   LIVCFGEMLIDFVPTVS--------------GLSLAEAPAFKKAPGGAPANVAVGIARLG  115

Query  594  GRAAFMGKVGDDEFG  638
            G +AF+GKVGDDEFG
Sbjct  116  GSSAFIGKVGDDEFG  130



>ref|XP_006402684.1| hypothetical protein EUTSA_v10006096mg [Eutrema salsugineum]
 gb|ESQ44137.1| hypothetical protein EUTSA_v10006096mg [Eutrema salsugineum]
Length=326

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFIKAPGGAPANVAIAISRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GR+AF+GK+GDDEFG
Sbjct  56   GRSAFVGKLGDDEFG  70



>ref|XP_010442690.1| PREDICTED: probable fructokinase-7 isoform X2 [Camelina sativa]
Length=346

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>gb|AFK41276.1| unknown [Medicago truncatula]
Length=386

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+ CFG    +FVPTV                +   + P F +APGG P+NVA+   RL
Sbjct  66   PLVVCFGEMLIDFVPTVS--------------GLSLADAPAFKKAPGGAPANVAVGISRL  111

Query  591  GGRAAFMGKVGDDEFG  638
            GG +AF+GKVG+DEFG
Sbjct  112  GGSSAFIGKVGEDEFG  127



>ref|NP_199996.1| pfkB-like carbohydrate kinase family protein [Arabidopsis thaliana]
 sp|Q9FLH8.1|SCRK7_ARATH RecName: Full=Probable fructokinase-7 [Arabidopsis thaliana]
 gb|AAK44104.1|AF370289_1 putative fructokinase 1 [Arabidopsis thaliana]
 dbj|BAB11252.1| fructokinase 1 [Arabidopsis thaliana]
 gb|AAL34211.1| putative fructokinase 1 [Arabidopsis thaliana]
 gb|AED96132.1| pfkB-like carbohydrate kinase family protein [Arabidopsis thaliana]
Length=343

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>gb|AJK93568.1| fructokinase [Manihot esculenta]
Length=331

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  14   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  59

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  60   GKAAFVGKLGDDEFG  74



>ref|XP_010443953.1| PREDICTED: probable fructokinase-7 [Camelina sativa]
Length=348

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSETLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>ref|XP_010482526.1| PREDICTED: probable fructokinase-7 [Camelina sativa]
Length=346

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            +S  L+ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  19   DSENLVVCFGEMLIDFVPTVGGVSLA--------------EAPAFKKAPGGAPANVAVGV  64

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVGDDEFG
Sbjct  65   SRLGGSSAFIGKVGDDEFG  83



>ref|XP_002272526.2| PREDICTED: probable fructokinase-7 isoform X1 [Vitis vinifera]
 ref|XP_010661603.1| PREDICTED: probable fructokinase-7 isoform X1 [Vitis vinifera]
 ref|XP_010661604.1| PREDICTED: probable fructokinase-7 isoform X1 [Vitis vinifera]
 ref|XP_010661605.1| PREDICTED: probable fructokinase-7 isoform X1 [Vitis vinifera]
 ref|XP_010661606.1| PREDICTED: probable fructokinase-7 isoform X1 [Vitis vinifera]
 emb|CBI38824.3| unnamed protein product [Vitis vinifera]
Length=371

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            E  PL+ CFG    +FVPTV            SE        P F +APGG P+NVA+  
Sbjct  47   EKRPLVVCFGEMLIDFVPTVGGVS-------LSE-------SPAFKKAPGGAPANVAVGI  92

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVG+DEFG
Sbjct  93   SRLGGSSAFIGKVGEDEFG  111



>ref|XP_003543564.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=331

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P     LI  FG    +FVPTV                      P F++APGG P+NVAI
Sbjct  8    PATGTGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAI  53

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGG+AAF+GK+GDDEFG
Sbjct  54   AVSRLGGKAAFVGKLGDDEFG  74



>dbj|BAJ95563.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 42/76 (55%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            P + CFG    +FVPTV                    + P F +APGG P+NVA+   RL
Sbjct  64   PHVVCFGELLIDFVPTVSGVSLS--------------DAPAFKKAPGGAPANVAVGIARL  109

Query  591  GGRAAFMGKVGDDEFG  638
            GG AAF+GKVGDDEFG
Sbjct  110  GGSAAFIGKVGDDEFG  125



>emb|CAN61782.1| hypothetical protein VITISV_012349 [Vitis vinifera]
Length=371

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 45/79 (57%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            E  PL+ CFG    +FVPTV            SE        P F +APGG P+NVA+  
Sbjct  47   EKRPLVVCFGEMLIDFVPTVGGVS-------LSE-------SPAFKKAPGGAPANVAVGI  92

Query  582  VRLGGRAAFMGKVGDDEFG  638
             RLGG +AF+GKVG+DEFG
Sbjct  93   SRLGGSSAFIGKVGEDEFG  111



>ref|XP_002436760.1| hypothetical protein SORBIDRAFT_10g008280 [Sorghum bicolor]
 gb|EER88127.1| hypothetical protein SORBIDRAFT_10g008280 [Sorghum bicolor]
Length=388

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 43/78 (55%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            + P + CFG    +FVPTV                +     P F +APGG P+NVA+   
Sbjct  66   NSPHVVCFGELLIDFVPTVN--------------GLSLSEAPAFKKAPGGAPANVAVGIA  111

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG AAF+GKVGDDEFG
Sbjct  112  RLGGSAAFIGKVGDDEFG  129



>ref|XP_004507340.1| PREDICTED: fructokinase-2-like [Cicer arietinum]
Length=330

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 14/82 (17%)
 Frame = +3

Query  393  FPYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVA  572
             P     LI  FG    +FVPTV                      P F++APGG P+NVA
Sbjct  7    IPSTGEGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVA  52

Query  573  ISHVRLGGRAAFMGKVGDDEFG  638
            I+  RLGG+AAF+GK+GDDEFG
Sbjct  53   IAVSRLGGKAAFVGKLGDDEFG  74



>ref|XP_006443006.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
 ref|XP_006478719.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
 gb|ESR56246.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
Length=329

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  13   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  58

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GK+GDDEFG
Sbjct  59   GKAAFVGKLGDDEFG  73



>sp|P37829.1|SCRK_SOLTU RecName: Full=Fructokinase [Solanum tuberosum]
 emb|CAA78283.1| fructokinase [Solanum tuberosum]
 prf||2108342A fructokinase
Length=319

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  9    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  54

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG++AF+GK+GDDEFG
Sbjct  55   RLGGKSAFVGKLGDDEFG  72



>gb|KJB37966.1| hypothetical protein B456_006G229100 [Gossypium raimondii]
Length=255

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV                      P F++APGG P+NVAI+  RLG
Sbjct  12   LIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVARLG  57

Query  594  GRAAFMGKVGDDEFG  638
            G+A+F+GK+GDDEFG
Sbjct  58   GKASFVGKLGDDEFG  72



>ref|NP_172092.1| putative fructokinase-3 [Arabidopsis thaliana]
 sp|Q9LNE4.1|SCRK3_ARATH RecName: Full=Probable fructokinase-3 [Arabidopsis thaliana]
 gb|AAF80125.1|AC024174_7 Contains similarity to a fructokinase from Lycopersicon esculentum 
gi|1915974 and is a member of the pfkB carbohydrate kinase 
family PF|00294 [Arabidopsis thaliana]
 gb|AAY78603.1| pfkB-type carbohydrate kinase family protein [Arabidopsis thaliana]
 gb|AEE27930.1| putative fructokinase-3 [Arabidopsis thaliana]
Length=345

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV            SE        P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVS-------LSE-------SPGFLKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDD+FG
Sbjct  56   GRAAFVGKLGDDDFG  70



>ref|XP_002889581.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65840.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=345

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV            SE        P F++APGG P+NVAI+  RLG
Sbjct  10   LIVSFGEMLIDFVPTVSGVS-------LSE-------SPGFLKAPGGAPANVAIAVSRLG  55

Query  594  GRAAFMGKVGDDEFG  638
            GRAAF+GK+GDD+FG
Sbjct  56   GRAAFVGKLGDDDFG  70



>ref|NP_001233888.1| fructokinase-2 [Solanum lycopersicum]
 sp|Q42896.2|SCRK2_SOLLC RecName: Full=Fructokinase-2 [Solanum lycopersicum]
 gb|AAB51108.1| fructokinase [Solanum lycopersicum]
 gb|AAB57734.1| fructokinase [Solanum lycopersicum]
Length=328

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  8    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  53

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG++AF+GK+GDDEFG
Sbjct  54   RLGGKSAFVGKLGDDEFG  71



>ref|XP_009119097.1| PREDICTED: probable fructokinase-2 [Brassica rapa]
Length=367

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 20/78 (26%)
 Frame = +3

Query  414  LICCFGAAQKEFVPT---VRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            LI  FG    +FVPT   V +A                   P F++APGG P+NVAI+  
Sbjct  51   LIVSFGEMLIDFVPTQSGVSLAE-----------------SPGFLKAPGGAPANVAIAVT  93

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGGRAAF+GK+GDDEFG
Sbjct  94   RLGGRAAFVGKLGDDEFG  111



>ref|XP_004308129.1| PREDICTED: probable fructokinase-7 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 14/80 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++  ++ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  32   DNKSMVVCFGEMLIDFVPTVAGVSLA--------------EAPAFKKAPGGAPANVAVGI  77

Query  582  VRLGGRAAFMGKVGDDEFGE  641
             RLGG AAF+GKVGDDEFG+
Sbjct  78   SRLGGSAAFIGKVGDDEFGK  97



>ref|XP_004490806.1| PREDICTED: probable fructokinase-4-like [Cicer arietinum]
Length=385

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+ CFG    +FVPT+                +   + P F +APGG P+NVA+   RL
Sbjct  65   PLVVCFGEMLIDFVPTIS--------------GVSLADAPAFKKAPGGAPANVAVGISRL  110

Query  591  GGRAAFMGKVGDDEFG  638
            GG +AF+GKVG+DEFG
Sbjct  111  GGSSAFIGKVGEDEFG  126



>ref|XP_010035062.1| PREDICTED: probable fructokinase-1 [Eucalyptus grandis]
Length=421

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 14/79 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++  L+ CFG    +F+PTV               K+   + P F +APGG P+NVA+  
Sbjct  96   DNNLLVLCFGEMLIDFIPTV--------------GKVSLADAPAFEKAPGGAPANVAVGI  141

Query  582  VRLGGRAAFMGKVGDDEFG  638
             +LGG +AF+GKVGDDEFG
Sbjct  142  SKLGGSSAFIGKVGDDEFG  160



>ref|XP_003546905.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=330

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = +3

Query  396  PYESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAI  575
            P     LI  FG    +FVPTV                      P F++APGG P+NVAI
Sbjct  8    PATGTGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAI  53

Query  576  SHVRLGGRAAFMGKVGDDEFG  638
            +  RLGG+AAF+GK+GDDEFG
Sbjct  54   AVSRLGGKAAFVGKLGDDEFG  74



>dbj|BAC21160.1| fructokinase [Nicotiana tabacum]
Length=169

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            LI  FG    +FVPTV            S   + +   P F++APGG P+NVAI+  RLG
Sbjct  2    LIVSFGEMLIDFVPTV------------SGVSLAEV--PGFLKAPGGAPANVAIAVTRLG  47

Query  594  GRAAFMGKVGDDEFG  638
            G++AF+GK+GDDEFG
Sbjct  48   GKSAFVGKLGDDEFG  62



>gb|AJK93569.1| fructokinase [Manihot esculenta]
Length=370

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+ CFG    +FVPTV                      P F +APGG P+NVA+   RLG
Sbjct  47   LVVCFGEILIDFVPTVAGVSLA--------------EAPGFKKAPGGAPANVAVGIARLG  92

Query  594  GRAAFMGKVGDDEFG  638
            G +AF+GKVGDDEFG
Sbjct  93   GNSAFIGKVGDDEFG  107



>ref|XP_011470420.1| PREDICTED: probable fructokinase-7 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=339

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 14/80 (18%)
 Frame = +3

Query  402  ESPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISH  581
            ++  ++ CFG    +FVPTV                      P F +APGG P+NVA+  
Sbjct  13   DNKSMVVCFGEMLIDFVPTVAGVSLA--------------EAPAFKKAPGGAPANVAVGI  58

Query  582  VRLGGRAAFMGKVGDDEFGE  641
             RLGG AAF+GKVGDDEFG+
Sbjct  59   SRLGGSAAFIGKVGDDEFGK  78



>ref|XP_001770633.1| predicted protein [Physcomitrella patens]
 gb|EDQ64616.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 14/75 (19%)
 Frame = +3

Query  414  LICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRLG  593
            L+ CFG    +FVPTV                +   + P F +APGG P+NVA    +LG
Sbjct  85   LVACFGELLIDFVPTV--------------GGLSLADAPAFKKAPGGAPANVACGIAKLG  130

Query  594  GRAAFMGKVGDDEFG  638
            G+AAF+GKVGDDEFG
Sbjct  131  GKAAFIGKVGDDEFG  145



>gb|AIE16180.1| fructokinase [Nicotiana tabacum]
Length=327

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 14/78 (18%)
 Frame = +3

Query  405  SPPLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHV  584
            S  LI  FG    +FVPTV                      P F++APGG P+NVAI+  
Sbjct  7    SSGLIVSFGEMLIDFVPTVSGVSLA--------------EAPGFLKAPGGAPANVAIAVT  52

Query  585  RLGGRAAFMGKVGDDEFG  638
            RLGG++AF+GK+GDDEFG
Sbjct  53   RLGGKSAFVGKLGDDEFG  70



>ref|XP_007141895.1| hypothetical protein PHAVU_008G234800g [Phaseolus vulgaris]
 gb|ESW13889.1| hypothetical protein PHAVU_008G234800g [Phaseolus vulgaris]
Length=383

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 14/76 (18%)
 Frame = +3

Query  411  PLICCFGAAQKEFVPTVRVAPEQMDPDIYSEWKMLQWNPPEFVRAPGGPPSNVAISHVRL  590
            PL+ CFG    +FVPTV                +     P F +APGG P+NVA+   RL
Sbjct  63   PLVVCFGEMLIDFVPTVN--------------GLSLAEAPAFKKAPGGAPANVAVGISRL  108

Query  591  GGRAAFMGKVGDDEFG  638
            GG +AF+GKVG+DEFG
Sbjct  109  GGSSAFIGKVGEDEFG  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750