BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028O08

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    2e-16   Sesamum indicum [beniseed]
ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    2e-16   Nicotiana sylvestris
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    2e-16   Nicotiana sylvestris
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    6e-16   Nicotiana tomentosiformis
ref|XP_002318267.2|  PTH-1 family protein                             85.1    2e-15   
ref|XP_007038488.1|  ERECTA-like 1                                    84.3    3e-15   
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    3e-15   Populus euphratica
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    9e-15   Tarenaya hassleriana [spider flower]
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    7e-14   Solanum lycopersicum
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    3e-13   Malus domestica [apple tree]
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    4e-13   Fragaria vesca subsp. vesca
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    5e-13   
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    5e-13   Solanum tuberosum [potatoes]
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  77.8    5e-13   
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg           77.0    8e-13   
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    3e-12   
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    3e-12   
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...  75.5    3e-12   Vitis vinifera
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    4e-12   Populus euphratica
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    5e-12   Brassica rapa
emb|CDX70013.1|  BnaA10g23620D                                        74.7    5e-12   
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    5e-12   
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    5e-12   Cucumis melo [Oriental melon]
gb|KJB39364.1|  hypothetical protein B456_007G009000                  74.7    5e-12   Gossypium raimondii
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...  74.3    6e-12   Gossypium arboreum [tree cotton]
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg           73.9    9e-12   
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...  73.9    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399           73.9    9e-12   
emb|CDX99001.1|  BnaC09g48340D                                        73.9    1e-11   
gb|KGN49592.1|  hypothetical protein Csa_5G014290                     73.6    1e-11   Cucumis sativus [cucumbers]
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...  73.2    2e-11   Brassica rapa
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...  73.2    2e-11   Brassica rapa
emb|CDY00268.1|  BnaA06g21690D                                        73.2    2e-11   
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g           73.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...  72.4    3e-11   Cicer arietinum [garbanzo]
gb|KDP22376.1|  hypothetical protein JCGZ_26207                       71.2    8e-11   Jatropha curcas
gb|KEH43759.1|  LRR receptor-like kinase family protein               70.9    9e-11   Medicago truncatula
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...  70.9    1e-10   Sesamum indicum [beniseed]
ref|XP_010109086.1|  hypothetical protein L484_012962                 65.9    1e-10   
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg           70.5    1e-10   Capsella rubella
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    1e-10   Camelina sativa [gold-of-pleasure]
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                  70.5    1e-10   Arabis alpina [alpine rockcress]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...  70.1    2e-10   Glycine soja [wild soybean]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...  70.1    2e-10   Glycine max [soybeans]
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...  69.7    2e-10   Glycine soja [wild soybean]
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657           69.7    2e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1         69.7    2e-10   Glycine max [soybeans]
ref|NP_001235330.1|  ERECTA-like kinase                               69.7    2e-10   Glycine max [soybeans]
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase              69.7    2e-10   Populus nigra x Populus x canadensis
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    2e-10   Nelumbo nucifera [Indian lotus]
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...  69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g           69.3    3e-10   Phaseolus vulgaris [French bean]
dbj|BAA97187.1|  receptor-like protein kinase                         69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...  69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAP69763.1|  ERECTA-like kinase 1                                  69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86913.1|  BnaC03g51830D                                        69.3    3e-10   
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg              68.9    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_002510897.1|  erecta, putative                                 68.6    5e-10   
ref|XP_002322426.1|  PTH-1 family protein                             68.6    5e-10   
emb|CDP05285.1|  unnamed protein product                              67.8    8e-10   Coffea canephora [robusta coffee]
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg           67.4    1e-09   
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2         65.9    4e-09   Glycine max [soybeans]
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1         65.9    4e-09   Glycine max [soybeans]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    5e-09   Nelumbo nucifera [Indian lotus]
emb|CBI24498.3|  unnamed protein product                              64.7    7e-09   Vitis vinifera
ref|XP_003592397.1|  LRR receptor-like serine/threonine-protein k...  60.5    9e-09   
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                 64.3    1e-08   Citrus sinensis [apfelsine]
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg           64.3    1e-08   
emb|CAB87274.1|  receptor-like protein kinase                         64.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...  64.3    1e-08   Glycine soja [wild soybean]
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    1e-08   Glycine max [soybeans]
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    1e-08   
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    2e-08   Prunus mume [ume]
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...  62.8    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500        61.6    9e-08   
gb|EPS66497.1|  hypothetical protein M569_08274                       60.5    2e-07   Genlisea aurea
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...  60.5    2e-07   Elaeis guineensis
ref|XP_006394419.1|  hypothetical protein EUTSA_v100036150mg          55.5    6e-07   
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...  58.5    8e-07   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...  58.5    8e-07   Phoenix dactylifera
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...  58.5    8e-07   
ref|NP_001237639.1|  ERECTA-like kinase                               57.8    1e-06   Glycine max [soybeans]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2         57.0    2e-06   Glycine max [soybeans]
emb|CBI20727.3|  unnamed protein product                              56.6    4e-06   Vitis vinifera
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...  56.6    4e-06   Vitis vinifera
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...  56.6    4e-06   Nicotiana sylvestris
gb|KDP34024.1|  hypothetical protein JCGZ_07595                       56.2    5e-06   Jatropha curcas
emb|CAN74952.1|  hypothetical protein VITISV_025649                   55.8    6e-06   Vitis vinifera
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...  55.8    6e-06   Nicotiana tomentosiformis
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    9e-06   
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    1e-05   Camelina sativa [gold-of-pleasure]
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...  55.1    1e-05   Glycine soja [wild soybean]
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...  55.1    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    2e-05   Solanum lycopersicum
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    3e-05   Glycine max [soybeans]
gb|KJB07391.1|  hypothetical protein B456_001G019800                  53.9    3e-05   Gossypium raimondii
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...  53.9    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    4e-05   Nelumbo nucifera [Indian lotus]
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    4e-05   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...  53.5    4e-05   Glycine max [soybeans]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...  53.1    5e-05   
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...  53.1    5e-05   
gb|AES59193.2|  LRR receptor-like kinase family protein               53.1    5e-05   Medicago truncatula
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...  53.1    5e-05   Elaeis guineensis
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    6e-05   Cicer arietinum [garbanzo]
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    6e-05   Cicer arietinum [garbanzo]
ref|XP_002516144.1|  erecta, putative                                 52.8    6e-05   Ricinus communis
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    7e-05   Solanum tuberosum [potatoes]
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    7e-05   
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    7e-05   Phoenix dactylifera
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...  52.8    7e-05   Phoenix dactylifera
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...  52.4    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440        52.0    1e-04   
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   Cucumis melo [Oriental melon]
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  52.0    1e-04   Sesamum indicum [beniseed]
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...  52.0    1e-04   Fragaria vesca subsp. vesca
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg           51.6    1e-04   Capsella rubella
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491           51.6    1e-04   
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g           51.6    1e-04   
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase       51.6    1e-04   Brassica napus [oilseed rape]
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...  51.6    2e-04   Sesamum indicum [beniseed]
emb|CDP13474.1|  unnamed protein product                              50.8    2e-04   Coffea canephora [robusta coffee]
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg           50.8    3e-04   
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase    50.8    3e-04   Citrus unshiu [satsuma mandarin]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    3e-04   Citrus sinensis [apfelsine]
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    3e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|AFC88469.1|  ERECTA                                                50.8    3e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    3e-04   Cucumis sativus [cucumbers]
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    4e-04   Brassica rapa
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg           50.4    4e-04   Eutrema salsugineum [saltwater cress]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    4e-04   
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                  50.4    4e-04   Arabis alpina [alpine rockcress]
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...  50.1    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...  50.1    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007161048.1|  hypothetical protein PHAVU_001G038400g           50.1    5e-04   Phaseolus vulgaris [French bean]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...  50.1    5e-04   Oryza brachyantha
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g           50.1    5e-04   Phaseolus vulgaris [French bean]
gb|KJB65471.1|  hypothetical protein B456_010G096300                  49.7    6e-04   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                  49.7    6e-04   Gossypium raimondii
gb|KJB65473.1|  hypothetical protein B456_010G096300                  49.7    6e-04   Gossypium raimondii
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...  49.7    7e-04   
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    8e-04   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    8e-04   Brachypodium distachyon [annual false brome]
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    9e-04   Populus euphratica
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    9e-04   Prunus mume [ume]
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...  49.3    9e-04   Prunus mume [ume]



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            F   PL S + DEGK LMSIK SFS VANVLLDWD+VHN+ FCSWRGVSCG
Sbjct  28   FLLFPLASPLSDEGKALMSIKASFSNVANVLLDWDEVHNDDFCSWRGVSCG  78



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  403  FVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
             +P+ S + +EGK LMSIKESFS VANVLLDWDDVHNE FCSWRGV CG
Sbjct  15   LLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGVLCG  63



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  403  FVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
             +P+ S + +EGK LMSIKESFS VANVLLDWDDVHNE FCSWRGV CG
Sbjct  15   LLPIVSSLNEEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGVLCG  63



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +1

Query  403  FVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
             +P+ S + +EGK LMSIKESFS VAN+LLDWDDVHNE FCSWRGV CG
Sbjct  15   LLPIVSSLNEEGKALMSIKESFSNVANMLLDWDDVHNEDFCSWRGVFCG  63



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/46 (80%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            PL S + DEGK LMSIKESFS V NVLLDWDDVHNE FCSWRGV C
Sbjct  23   PLVSPLNDEGKALMSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFC  68



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P+ S + DEGK LMSIKESFS VANVLLDWDDVHN  FCSWRGV C
Sbjct  31   PIASSLNDEGKALMSIKESFSNVANVLLDWDDVHNADFCSWRGVFC  76



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/46 (80%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            PL   + DEGK LMSIKESFS VANVLLDWDDVHNE FCSWRGV C
Sbjct  23   PLVFPLNDEGKALMSIKESFSNVANVLLDWDDVHNEDFCSWRGVFC  68



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  V + S I DEGK LM+IK SFS VANVLLDWDDVHN+ FCSWRGV C
Sbjct  17   FVLVGVASSINDEGKALMAIKASFSNVANVLLDWDDVHNDDFCSWRGVYC  66



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            P+   + +EGK LMSIK SFS VANVLLDWDD+H+E FCSWRGV CG
Sbjct  24   PIVLALTEEGKALMSIKASFSNVANVLLDWDDIHDEDFCSWRGVLCG  70



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  334  ESFVPWDQEDGVCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHN  513
            E  V W ++  +  C          PL S + DEGK LMSIK SFS VANVLLDW+D H+
Sbjct  2    ERRVLWRKKTELVFCFGLALMAVLFPLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHD  61

Query  514  EXFCSWRGVSC  546
              FCSWRGV C
Sbjct  62   GDFCSWRGVFC  72



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  349  WDQEDGVCSCLRTG-SHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFC  525
            W ++  V   L  G + F   P+ S + DEGK LM+IK SFS VANVLLDW+D H++ FC
Sbjct  10   WRRKKDVVLVLWFGLALFLLFPVASSLNDEGKALMAIKASFSNVANVLLDWNDAHDDDFC  69

Query  526  SWRGVSC  546
            SWRGV C
Sbjct  70   SWRGVFC  76



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            +EGK LMSIK SFS VANVLLDWDDVH+E FCSWRGV CG
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCG  69



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            +EGK LMSIK SFS VANVLLDWDDVH+E FCSWRGV CG
Sbjct  30   EEGKALMSIKASFSNVANVLLDWDDVHDEDFCSWRGVLCG  69



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  +   S + +EGK LM+IK SFS VAN+LLDWDDVHN  FCSWRGVSC
Sbjct  19   FMLIGAVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVSC  68



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  +   S + +EGK LM+IK SFS VAN+LLDWDDVHN  FCSWRGVSC
Sbjct  13   FMLIGAVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVSC  62



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  +   S + +EGK LM+IK SFS VAN+LLDWDDVHN  FCSWRGVSC
Sbjct  19   FMLIGAVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVSC  68



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F F+   S I +EGK LM+IK SFS VAN+LLDWD+VHN  FCSWRGV C
Sbjct  13   FTFLGFVSPINNEGKALMAIKASFSNVANMLLDWDNVHNNDFCSWRGVIC  62



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            PL S + DEGK LMSIK SFS VANVLLDW+D H+  FCSWRGV C
Sbjct  6    PLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFC  51



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            PL S + DEGK LMSIK SFS VANVLLDW+D H+  FCSWRGV C
Sbjct  6    PLGSPLNDEGKALMSIKASFSNVANVLLDWNDAHDGDFCSWRGVFC  51



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + DEGK LMSIK SFS VAN LLDWDDVHN  FCSWRGV C
Sbjct  33   LNDEGKALMSIKASFSNVANALLDWDDVHNADFCSWRGVFC  73



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + DEGK LMS+KESFS V NVL+DWDDVHN  FCSWRGV C
Sbjct  29   SPLNDEGKALMSLKESFSNVVNVLVDWDDVHNVDFCSWRGVFC  71



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + DEG  LMSIK SFS VANVLLDWDD  NE +CSWRGVSC
Sbjct  28   VASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSC  72



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + DEG  LMSIK SFS VANVLLDWDD  NE +CSWRGVSC
Sbjct  28   VASPLSDEGNALMSIKASFSNVANVLLDWDDARNEDYCSWRGVSC  72



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + DEGK LM +K SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  14   FMLCGVVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLC  63



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + DEGK LM +K SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  14   FMLCGVVSPMNDEGKALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLC  63



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            DEGK LM+IK SFS +ANVLLDWDDVHN  FCSWRGV C
Sbjct  17   DEGKALMAIKASFSNLANVLLDWDDVHNSDFCSWRGVFC  55



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P++S   +EG+ LMSIK SFS VANVLLDWDD HN  FCSWRGV C
Sbjct  35   PVSSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFC  80



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F      S + DEGK LMSIK SFS VANVLLDWDDV+N  FCSWRGV C
Sbjct  27   FLLCSHASSLNDEGKALMSIKASFSNVANVLLDWDDVNNFDFCSWRGVFC  76



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + DEGK LMSIK SFS VANVLLDWDDV+N  FCSWRGV C
Sbjct  32   SSLNDEGKALMSIKASFSNVANVLLDWDDVNNFDFCSWRGVFC  74



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  + + S + ++GK LM+IK SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  19   FMLLGVVSPMNNQGKALMAIKASFSNVANMLLDWDDVHNNDFCSWRGVFC  68



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  +   S + +EGK LM+IK SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  19   FMLLGSVSPMNNEGKALMAIKASFSNVANMLLDWDDVHNHDFCSWRGVFC  68



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F  + + S I +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  17   FLLLGVASSINNEGKALMAIKGSFSNLVNMLLDWDDVHNSDFCSWRGVYC  66



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + DEG+ LM +K SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  11   FMLCGVVSPMNDEGRALMEMKASFSNVANMLLDWDDVHNSDFCSWRGVLC  60



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P+ S   +EG+ LMSIK SFS VANVLLDWDD HN  FCSWRGV C
Sbjct  32   PVYSLPHNEGRALMSIKASFSNVANVLLDWDDDHNHDFCSWRGVFC  77



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + DEGK LM+IK SFS V N+LLDWDDVHN  FCSWRGV C
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFC  62



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + DEGK LM+IK SFS V N+LLDWDDVHN  FCSWRGV C
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFC  62



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + DEGK LM+IK SFS V N+LLDWDDVHN  FCSWRGV C
Sbjct  18   VASPMNDEGKALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFC  62



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P  S + DEG+ LM IK SFS VA+VL DWDD+HN+ FCSWRGV C
Sbjct  31   PFASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLC  76



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  403  FVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F P  S + +EG+ LM++K SF+ +A+VLLDWDDVHN+  CSWRGV C
Sbjct  34   FSPFASPLSEEGQALMAMKSSFNNIADVLLDWDDVHNDDLCSWRGVFC  81



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + +EGK LM +K SFS VANVLLDWDDVHN  FCSWRGV C
Sbjct  38   LNNEGKALMVMKASFSNVANVLLDWDDVHNGDFCSWRGVFC  78



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P    + +EG+ LM++K SF+ +A+VLLDWDDVHN+ FCSWRGV C
Sbjct  33   PFAFSLQEEGQALMAMKSSFNNIADVLLDWDDVHNDDFCSWRGVFC  78



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            MSIK SFS VANVLLDWD+VHN+ FCSWRGVSCG
Sbjct  1    MSIKASFSNVANVLLDWDEVHNDDFCSWRGVSCG  34



>ref|XP_010109086.1| hypothetical protein L484_012962 [Morus notabilis]
 gb|EXC20886.1| hypothetical protein L484_012962 [Morus notabilis]
Length=107

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +1

Query  334  ESFVPWDQEDGVCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHN  513
             +F+ W ++D     +         P+ S + DEGK LM+IK SFS VANVLL W+D H+
Sbjct  4    NAFLQWRKKD-TNFLVVMALLLLLTPIASPLNDEGKALMAIKASFSNVANVLLGWNDDHD  62

Query  514  EXFCSWRGVSC  546
              FCSWRGV C
Sbjct  63   GDFCSWRGVIC  73



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  20   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  64



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  20   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  64



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  23   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  67



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  23   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  67



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EGK LM+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  20   VASSMNNEGKALMAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  64



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  367  VCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +C CL     F  +   S + DEGK LM IK SFS + N+LLDWDDVH+  FCSWRGV C
Sbjct  8    MCLCLAM-VVFMLLGSASPLNDEGKALMEIKGSFSNLVNMLLDWDDVHSNDFCSWRGVFC  66



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
              S + DEG+ LM IK SFS VA+VL DWDD+HN+ FCSWRGV C
Sbjct  34   FASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLC  78



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
              S + DEG+ LM IK SFS VA+VL DWDD+HN+ FCSWRGV C
Sbjct  34   FASPLSDEGQALMKIKASFSNVADVLHDWDDLHNDDFCSWRGVLC  78



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P  S + DEG+ LM IK SFS VA+VL DWD +HN+ FCSWRGV C
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLC  77



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +EGK LM+IK SFS VAN+LLDW DVHN  FCSWRGV C
Sbjct  29   NEGKALMAIKASFSNVANMLLDWGDVHNNDFCSWRGVFC  67



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P  S + DEG+ LM IK SFS VA+VL DWD +HN+ FCSWRGV C
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLC  77



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  409  PLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            P  S + DEG+ LM IK SFS VA+VL DWD +HN+ FCSWRGV C
Sbjct  32   PFVSPLGDEGQALMKIKSSFSNVADVLHDWDALHNDDFCSWRGVLC  77



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIKESFS V NVLLDWDDVHNE FCSWRGV C
Sbjct  1    MSIKESFSNVVNVLLDWDDVHNEDFCSWRGVFC  33



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F F  +   + DEG  LMSIK SFS VANVLLDWD   NE  CSWRGV+C
Sbjct  21   FLFFQVVLPLSDEGNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVNC  70



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + +EGK LM+IK SFS + N+LLDWDDVHN   CSWRGV C
Sbjct  17   FMVFGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSWRGVFC  66



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + +EG+ LM++K +FS + +VLLDWDDVHN+ FCSWRGVSC
Sbjct  38   LSEEGQALMAMKATFSNMPDVLLDWDDVHNDDFCSWRGVSC  78



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + +EGK LM+IK SFS + N+LLDWDDVHN   CSWRGV C
Sbjct  17   FMVFGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSWRGVFC  66



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + +EGK LM+IK SFS + N+LLDWDDVHN   CSWRGV C
Sbjct  17   FMVFGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSWRGVFC  66



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    + S + +EGK LM+IK SFS + N+LLDWDDVHN   CSWRGV C
Sbjct  17   FMVFGVASAMNNEGKALMAIKGSFSNLVNMLLDWDDVHNSDLCSWRGVFC  66



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S + +EG  LM+IK SFS V N+LLDWDDVHN  FCSWRGV C
Sbjct  17   VASPMNNEGTALMAIKGSFSNVVNMLLDWDDVHNSDFCSWRGVFC  61



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            MSIK SFS +ANVLLDWD+VHN+ FCSW+GVSCG
Sbjct  1    MSIKASFSNIANVLLDWDEVHNDDFCSWKGVSCG  34



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIKESFS VANVLLDWDDVHN  FCSWRGV C
Sbjct  1    MSIKESFSNVANVLLDWDDVHNGDFCSWRGVFC  33



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIKESFS V NVL+DWDDVHNE FCSWRGV C
Sbjct  1    MSIKESFSNVVNVLVDWDDVHNEDFCSWRGVFC  33



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            MSIK SFS VANVLLDW+D+HNE FC+WRGV CG
Sbjct  1    MSIKASFSNVANVLLDWNDIHNEDFCTWRGVICG  34



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 42/85 (49%), Gaps = 22/85 (26%)
 Frame = +1

Query  358  EDGVCSCLRTGSHFAFVPLTSCIXDEG----------------------KTLMSIKESFS  471
            E+ V  C+       F P  S + DEG                      K LMSIK SFS
Sbjct  2    EERVVFCVGLALLPLFFPFASPLNDEGSSLSLSLSLSPAASLSAFMLKRKALMSIKASFS  61

Query  472  XVANVLLDWDDVHNEXFCSWRGVSC  546
             VANVLLDW+D H+E FCSWRGV C
Sbjct  62   NVANVLLDWNDAHDEDFCSWRGVFC  86



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S   +EG+ LM++K  FS +A+VLLDWDD HN+ FCSWRGV C
Sbjct  36   SSFSEEGQALMAMKALFSNMADVLLDWDDAHNDDFCSWRGVFC  78



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S   +EG+ LM++K  FS +A+VLLDWDD HN+ FCSWRGV C
Sbjct  36   SSFSEEGQALMAMKALFSNMADVLLDWDDAHNDDFCSWRGVFC  78



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIK SFS VANVLLDWDD  NE +CSWRGVSC
Sbjct  1    MSIKASFSNVANVLLDWDDARNEDYCSWRGVSC  33



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIK SFS VAN LLDWDDVHN  FCSWRGV C
Sbjct  1    MSIKASFSNVANALLDWDDVHNADFCSWRGVFC  33



>ref|XP_003592397.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Medicago 
truncatula]
Length=99

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  436  GKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            G+ LM++K SF+ +A+VLLDWDDVHN+ FCSWRGV C
Sbjct  51   GQALMAMKSSFNNIADVLLDWDDVHNDDFCSWRGVFC  87



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M+IK SFS +ANVLLDWDDVHN  FCSWRGV C
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFC  33



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M+IK SFS +ANVLLDWDDVHN  FCSWRGV C
Sbjct  1    MAIKASFSNLANVLLDWDDVHNSDFCSWRGVFC  33



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M+IK SFS VAN+LLDWDDVHN  FCSWRGV C
Sbjct  1    MAIKASFSNVANMLLDWDDVHNHDFCSWRGVFC  33



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +EG+ LM++K SF  +A+ LLDWDD HN+ FCSWRGV C
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFC  78



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +EG+ LM++K SF  +A+ LLDWDD HN+ FCSWRGV C
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFC  78



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +EG+ LM++K SF  +A+ LLDWDD HN+ FCSWRGV C
Sbjct  40   EEGQALMAMKASFGNMADTLLDWDDAHNDDFCSWRGVFC  78



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIK SFS VANVLLDWDD HN  FCSWRGV C
Sbjct  1    MSIKASFSNVANVLLDWDDDHNHDFCSWRGVFC  33



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            MSIK SFS VANVLLDW+D H+E FCSWRGV C
Sbjct  1    MSIKASFSNVANVLLDWNDAHDEDFCSWRGVFC  33



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  436  GKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            G  LMSIK SFS VANVLLDWD   NE  CSWRGV+C
Sbjct  18   GNALMSIKASFSDVANVLLDWDAARNEDHCSWRGVNC  54



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
              F+   S   DEG+ L+S+K SFS VANVLLDW++   +  CSWRGVSC
Sbjct  11   LVFLQALSAQSDEGRALLSLKASFSDVANVLLDWNEDSIDDHCSWRGVSC  60



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSCG  549
            MSIK SFS VANVL DWDD H+   CSWRGV CG
Sbjct  1    MSIKASFSNVANVLPDWDDAHSSDLCSWRGVVCG  34



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 8/58 (14%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDV--------HNEXFCSWRGVSC  546
             AF P  S   DEG+ LM++K SFS VANVLLDW+ V         ++  C+WRGV C
Sbjct  21   LAFFPAVSSFSDEGRALMALKASFSNVANVLLDWNPVAAGGDANRSSDDHCAWRGVVC  78



>ref|XP_006394419.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
 gb|ESQ31705.1| hypothetical protein EUTSA_v100036150mg, partial [Eutrema salsugineum]
Length=115

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M+IK SFS + N+LLDWDDVHN  FCSWRGV C
Sbjct  1    MAIKGSFSNLVNMLLDWDDVHNTDFCSWRGVFC  33



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 8/58 (14%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDV--------HNEXFCSWRGVSC  546
             AF P  S   DEG+ LM++K SFS V NVLLDW+ V         ++  C+WRGV C
Sbjct  21   LAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRSSDDHCAWRGVVC  78



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 8/58 (14%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDV--------HNEXFCSWRGVSC  546
             AF P  S   DEG+ LM++K SFS V NVLLDW+ V         ++  C+WRGV C
Sbjct  21   LAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRSSDDHCAWRGVVC  78



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 8/58 (14%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDV--------HNEXFCSWRGVSC  546
             AF P  S   DEG+ LM++K SFS V NVLLDW+ V         ++  C+WRGV C
Sbjct  21   LAFFPAVSSFSDEGRALMALKASFSNVVNVLLDWNPVAAGGDANRSSDDHCAWRGVVC  78



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M++K  FS +A+VLLDWDD HN+ FCSWRGV C
Sbjct  1    MAMKALFSNMADVLLDWDDAHNDDFCSWRGVFC  33



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M IK SFS VA+VL DWD +HN+ FCSWRGV C
Sbjct  1    MKIKSSFSNVADVLHDWDALHNDDFCSWRGVLC  33



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + D+G TL+ IK+SF  V NVL DW D  +  +C WRGVSC
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSC  62



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + D+G TL+ IK+SF  V NVL DW D  +  +C WRGVSC
Sbjct  28   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSC  70



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + D+G TL+ IK+SF  V NVL DW D  +  +C+WRGV+C
Sbjct  31   SVLSDDGSTLLEIKKSFMDVENVLYDWTDSPSSDYCAWRGVTC  73



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 6/57 (11%)
 Frame = +1

Query  394  HFAFVPLTSCI------XDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
             F F+ L  C+       D+G TL+ IK+SF  V NVL DW D  +  +C WRG++C
Sbjct  6    QFFFLALVLCLGFGSVTSDDGSTLLEIKKSFRDVGNVLYDWTDSPSSDYCVWRGITC  62



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + D+G TL+ IK+SF  V NVL DW D  +  +C WRGVSC
Sbjct  20   SVVSDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVSC  62



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + D+G TL+ IK+SF  V NVL DW D  +  +C+WRGV+C
Sbjct  33   VSDDGSTLLEIKKSFRDVENVLYDWTDSPSSDYCAWRGVTC  73



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  448  MSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            M++K SF  VAN LLDWDD H+  FC+WRGV C
Sbjct  1    MAVKASFINVANALLDWDDAHDGDFCAWRGVFC  33



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 7/61 (11%)
 Frame = +1

Query  364  GVCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVS  543
            G   CL  GS       T+   DEG TL+ IK+SF  V NVL DW    +  +C WRGVS
Sbjct  11   GFLICLSFGS-------TAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVS  63

Query  544  C  546
            C
Sbjct  64   C  64



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 7/61 (11%)
 Frame = +1

Query  364  GVCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVS  543
            G   CL  GS       T+   DEG TL+ IK+SF  V NVL DW    +  +C WRGVS
Sbjct  11   GFLICLSFGS-------TAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVS  63

Query  544  C  546
            C
Sbjct  64   C  64



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 7/61 (11%)
 Frame = +1

Query  364  GVCSCLRTGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVS  543
            G   CL  GS       T+   DEG TL+ IK+SF  V NVL DW    +  +C WRGVS
Sbjct  16   GFLICLSFGS-------TAVNSDEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVS  68

Query  544  C  546
            C
Sbjct  69   C  69



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V NVL DW D  +  +C+WRG+SC
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGISC  62



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
             +S + ++G TL+ IK+SF  V NVL DW D  +  +C+WRG++C
Sbjct  18   FSSSVSNDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGITC  62



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  403  FVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F    S + D+G  L+ IK+S   V NVL DW D  +  +C+WRGV+C
Sbjct  24   FFSFGSVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTC  71



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G TL+ IK+SF  V NVL DW D  +  +C+WRG++C
Sbjct  18   VNSVESDDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCAWRGIAC  62



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 5/50 (10%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            FAFV       ++G TL+ IK+SF  V NVL DW D  +  +C WRGV+C
Sbjct  21   FAFVD-----SEDGTTLLEIKKSFKDVDNVLYDWTDTPSSDYCVWRGVTC  65



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            L  C  D+G TL+ +K+SF  V NVL DW D  +  +C WRGVSC
Sbjct  20   LVDC--DDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWRGVSC  62



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
             A++   S   ++G TL+ IK+SF  V NVL DW D     +CSWRG++C
Sbjct  13   LAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITC  62



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
             A++   S   ++G TL+ IK+SF  V NVL DW D     +CSWRG++C
Sbjct  13   LAWLSFGSSDSNDGATLLEIKKSFRDVDNVLYDWTDSPTYGYCSWRGITC  62



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  433  EGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +G+TL+ IK+SFS V NVL DW D  +  +C WRGV+C
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTC  63



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  433  EGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +G+TL+ IK+SFS V NVL DW D  +  +C WRGV+C
Sbjct  26   DGETLLEIKKSFSDVDNVLYDWTDSPSSDYCVWRGVTC  63



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 5/50 (10%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            FAFV       ++G TL+ IK+SF  V NVL DW D  +  +C WRGV+C
Sbjct  21   FAFVD-----SEDGATLLEIKKSFRDVDNVLYDWADTPSSDYCVWRGVTC  65



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G T++ IK+SF  V NVL DW D     +C+WRG++C
Sbjct  19   VNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRGITC  63



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G T++ IK+SF  V NVL DW D     +C+WRG++C
Sbjct  19   VNSVESDDGSTMLEIKKSFRDVDNVLYDWTDSPTSDYCAWRGITC  63



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  433  EGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            +G TLM IK+SF  V NVL DW +     +CSWRGV+C
Sbjct  30   DGATLMEIKKSFRNVDNVLYDWTEATGSDYCSWRGVTC  67



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G TL+ IK+SF  V NVL DW +     +C+WRG+SC
Sbjct  19   VNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISC  63



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G TL+ IK+SF  V NVL DW +     +C+WRG+SC
Sbjct  19   VNSVDSDDGATLLEIKKSFRDVDNVLYDWTNSPTSDYCAWRGISC  63



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 6/54 (11%)
 Frame = +1

Query  403  FVPLTSCI------XDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F+ L  C+       D+G TL+ +K+SF  V NVL DW D  +  +C WRGV+C
Sbjct  9    FLALLLCLGFGFVDSDDGATLLEVKKSFRDVDNVLYDWTDSPSSDYCVWRGVTC  62



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  418  SCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            S + D+G  L+ IK+S   V NVL DW D  +  +C+WRGV+C
Sbjct  29   SVVSDDGSALLEIKKSIRDVENVLYDWTDSPSSDYCAWRGVTC  71



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW +     +CSWRGV+C
Sbjct  29   NDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTC  67



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW +     +CSWRGV+C
Sbjct  29   NDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTC  67



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW +     +CSWRGV+C
Sbjct  29   NDGATLLEIKKSFRNVENVLYDWTEATGSDYCSWRGVTC  67



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +1

Query  388  GSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            G  F    + +   +EG TL+ IK+SF  V NVL DW    +  +C WRGVSC
Sbjct  11   GFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSC  63



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK++F  V NVL DW    +  +CSWRG++C
Sbjct  35   DDGATLLEIKKAFRDVDNVLYDWTGASSSEYCSWRGITC  73



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V NVL DW    +  FC WRGV+C
Sbjct  32   DDGATLLEIKKSFRDVDNVLYDWTSSPSSDFCVWRGVTC  70



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 35/65 (54%), Gaps = 4/65 (6%)
 Frame = +1

Query  364  GVCSCLR----TGSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSW  531
             + +CL+     G    F+   S   D+G  L+ +K+SF  V NVL DW D  +  +C W
Sbjct  14   AMANCLKQYVLVGFLVVFLNSASVDSDDGAILLEVKKSFRDVDNVLYDWTDTPSSDYCVW  73

Query  532  RGVSC  546
            RG++C
Sbjct  74   RGITC  78



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V NVL DW D  +   C WRGV+C
Sbjct  33   DDGATLLEIKKSFKDVNNVLYDWTDSSSSDCCVWRGVTC  71



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            DEG TL+ IK+SF    NVL DW D  +  +C+WRGV+C
Sbjct  25   DEGATLLEIKKSFRDEDNVLYDWRDSPSLDYCAWRGVTC  63



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            DEG TL+ IK+SF  V NVL DW    +  +C WRGV+C
Sbjct  25   DEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTC  63



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            DEG TL+ IK+SF  V NVL DW    +  +C WRGV+C
Sbjct  25   DEGATLLEIKKSFKDVNNVLYDWTASPSSDYCVWRGVTC  63



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V NVL DW D  +  +C WRGV C
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDYCVWRGVIC  62



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  TSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            T+   D G TL+ IK+SF  V NVL DW    +  +C+WRGV+C
Sbjct  20   TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCAWRGVTC  63



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G  L+ IK SF  V NVL DW D  +  +C+WRGV+C
Sbjct  33   DDGTVLLEIKRSFRDVENVLYDWIDSPSSDYCAWRGVTC  71



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
 Frame = +1

Query  397  FAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            F+F  + S   D+G TL+ IK+SF  V NVL DW D  +   C WRGV+C
Sbjct  26   FSFGSVDS---DDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVTC  72



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW D  +  +C WRGV+C
Sbjct  24   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVTC  62



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW D  +  +C WRG++C
Sbjct  25   EDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRGITC  63



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW D  +  +C WRG++C
Sbjct  25   EDGATLLKIKKSFRDVDNVLYDWTDSPSSDYCVWRGITC  63



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            L S   D+G TL+ IK+S   V NVL DW D  +  +C WRGV+C
Sbjct  30   LGSVDSDDGVTLLEIKKSIRDVDNVLYDWSDSPSADYCVWRGVTC  74



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 3/53 (6%)
 Frame = +1

Query  388  GSHFAFVPLTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            G+  AF+ +     D+G TL+ IK+SF  V NVL DW       +CSWRGV C
Sbjct  12   GTLIAFLLVAGAAADDGSTLLEIKKSFRNVDNVLYDW---AGGDYCSWRGVLC  61



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+S+  V NVL DW    +  FC WRGV+C
Sbjct  32   DDGATLLEIKKSYRDVDNVLYDWTSSPSSDFCVWRGVTC  70



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/44 (48%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  TSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            T+   D G TL+ IK+SF  V NVL DW    +  +C WRGV+C
Sbjct  20   TTVNSDNGATLLEIKKSFKDVNNVLYDWTGSPSSDYCVWRGVTC  63



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  415  TSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            T+   D G TL+ IK+SF  V N+L DW    +  +C WRGV+C
Sbjct  20   TTVNSDNGATLLEIKKSFKDVNNILYDWTSSPSSDYCVWRGVTC  63



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G+TL+ IK++F  V NVL +W D  +  +C WRGV+C
Sbjct  35   DQGRTLLGIKKAFRDVDNVLYEWTDSPSLDYCVWRGVTC  73



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G+TL+ IK++F  V NVL +W D  +  +C WRGV+C
Sbjct  35   DQGRTLLGIKKAFRDVDNVLYEWTDSPSLDYCVWRGVTC  73



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW    +  +C WRGVSC
Sbjct  29   EDGATLLEIKKSFKDVNNVLYDWTSSPSSDYCVWRGVSC  67



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G+TL+ IK++F  V NVL +W D  +  +C WRGV+C
Sbjct  35   DQGRTLLEIKKAFRDVDNVLYEWTDQPSLDYCVWRGVTC  73



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 28/46 (61%), Gaps = 3/46 (7%)
 Frame = +1

Query  418  SCI---XDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            SC+     EG TL+ IK+SF  V NVL DW D  +   CSWRGV C
Sbjct  18   SCVCGDTSEGATLVEIKKSFRNVDNVLYDWADDPSSDHCSWRGVIC  63



>ref|XP_007161048.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33042.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=744

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G TL+ +K+ F  V NVL DW D  +  +C+WRG++C
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITC  62



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWD-DVHNEXFCSWRGVSC  546
            D+G+TL+ IK+SF  V NVL DW  D   + +CSWRGV C
Sbjct  35   DDGRTLLEIKKSFRNVDNVLYDWSGDGAPQRYCSWRGVLC  74



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  412  LTSCIXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + S   D+G TL+ +K+ F  V NVL DW D  +  +C+WRG++C
Sbjct  18   VNSVESDDGATLLEMKKLFRDVDNVLYDWTDSPSSDYCAWRGITC  62



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+ F  V NVL DW D  +  +C WRGV+C
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTC  65



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+ F  V NVL DW D  +  +C WRGV+C
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTC  65



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+ F  V NVL DW D  +  +C WRGV+C
Sbjct  27   EDGATLLEIKKFFRDVDNVLYDWSDTPSSDYCVWRGVTC  65



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V N L DW D  +  +C WRGV+C
Sbjct  41   DDGVTLLEIKKSFRDVDNDLYDWADSPSSDYCGWRGVTC  79



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 3/41 (7%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + D+G TL+ IK+SF  V NVL DW     + +CSWRGV C
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLC  62



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 3/41 (7%)
 Frame = +1

Query  424  IXDEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            + D+G TL+ IK+SF  V NVL DW     + +CSWRGV C
Sbjct  25   VGDDGSTLLEIKKSFRNVENVLYDWS---GDDYCSWRGVLC  62



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            D+G TL+ IK+SF  V NVL DW D  +   C WRGV C
Sbjct  24   DDGATLLEIKKSFRDVDNVLYDWTDSPSSDCCVWRGVIC  62



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW D  +  +C WRGV C
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVIC  70



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +1

Query  430  DEGKTLMSIKESFSXVANVLLDWDDVHNEXFCSWRGVSC  546
            ++G TL+ IK+SF  V NVL DW D  +  +C WRGV C
Sbjct  32   EDGTTLLEIKKSFRDVDNVLYDWTDAPSLDYCVWRGVIC  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940