BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028N15

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB42342.1|  hypothetical protein B456_007G150200                    305   1e-101   Gossypium raimondii
gb|KJB42341.1|  hypothetical protein B456_007G150200                    307   5e-101   Gossypium raimondii
gb|KJB42337.1|  hypothetical protein B456_007G150200                    308   7e-101   Gossypium raimondii
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             309   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    308   1e-100   Populus euphratica
gb|KJB42340.1|  hypothetical protein B456_007G150200                    308   2e-100   Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                    307   3e-100   Gossypium raimondii
gb|KJB42335.1|  hypothetical protein B456_007G150200                    307   5e-100   Gossypium raimondii
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    307   7e-100   Vitis vinifera
ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    306   2e-99    Sesamum indicum [beniseed]
gb|ABK94679.1|  unknown                                                 306   2e-99    Populus trichocarpa [western balsam poplar]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                303   2e-98    Erythranthe guttata [common monkey flower]
emb|CDP03802.1|  unnamed protein product                                301   2e-97    Coffea canephora [robusta coffee]
ref|XP_010091822.1|  hypothetical protein L484_015891                   299   6e-97    Morus notabilis
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    297   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    296   9e-96    Prunus mume [ume]
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             296   2e-95    
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    296   2e-95    
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    295   4e-95    Glycine max [soybeans]
gb|ACU23211.1|  unknown                                                 295   4e-95    Glycine max [soybeans]
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         294   6e-95    Jatropha curcas
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             293   1e-94    Phaseolus vulgaris [French bean]
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    293   2e-94    
gb|AFK48198.1|  unknown                                                 293   2e-94    Lotus japonicus
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    293   2e-94    Phoenix dactylifera
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    290   2e-93    Elaeis guineensis
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    289   7e-93    Pyrus x bretschneideri [bai li]
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             288   7e-93    
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    285   1e-92    Nicotiana sylvestris
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    288   2e-92    Nicotiana tomentosiformis
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    289   2e-92    Pyrus x bretschneideri [bai li]
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    287   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    286   7e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    286   1e-91    Fragaria vesca subsp. vesca
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    287   1e-91    
gb|ACJ84721.1|  unknown                                                 286   1e-91    Medicago truncatula
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    285   2e-91    Pyrus x bretschneideri [bai li]
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    283   2e-90    
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    283   2e-90    Solanum tuberosum [potatoes]
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    282   4e-90    
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    281   6e-90    Malus domestica [apple tree]
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    279   6e-89    Eucalyptus grandis [rose gum]
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             279   6e-89    
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          279   7e-89    Amborella trichopoda
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    278   1e-88    
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    275   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    273   2e-86    Tarenaya hassleriana [spider flower]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    271   5e-86    Cucumis melo [Oriental melon]
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       271   9e-86    Cucumis sativus [cucumbers]
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    270   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    267   3e-84    Brassica rapa
emb|CDX81965.1|  BnaC08g36360D                                          267   3e-84    
emb|CDY31970.1|  BnaA07g00250D                                          267   4e-84    Brassica napus [oilseed rape]
emb|CDY05746.1|  BnaC07g00570D                                          267   4e-84    
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    265   4e-84    
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    266   8e-84    Brassica rapa
emb|CDY13877.1|  BnaA09g43790D                                          266   8e-84    Brassica napus [oilseed rape]
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             265   2e-83    Eutrema salsugineum [saltwater cress]
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             262   3e-83    
ref|NP_001048516.1|  Os02g0816800                                       264   5e-83    
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    263   1e-82    Brassica rapa
emb|CDY03308.1|  BnaC09g10400D                                          263   2e-82    
emb|CDY39772.1|  BnaA09g10240D                                          263   2e-82    Brassica napus [oilseed rape]
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    263   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    262   3e-82    Camelina sativa [gold-of-pleasure]
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    262   3e-82    Arabis alpina [alpine rockcress]
gb|EEC74241.1|  hypothetical protein OsI_09443                          262   4e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          261   6e-82    Sorghum bicolor [broomcorn]
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    261   8e-82    Cicer arietinum [garbanzo]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                259   3e-81    Arabidopsis lyrata subsp. lyrata
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    257   3e-80    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69627.1|  hypothetical protein M569_05135                         255   3e-80    Genlisea aurea
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    253   7e-79    Setaria italica
ref|NP_001149069.1|  LOC100282690                                       253   7e-79    
gb|ACF85773.1|  unknown                                                 253   9e-79    Zea mays [maize]
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  254   1e-78    
dbj|BAJ86608.1|  predicted protein                                      252   2e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24353.1|  unknown                                                 250   9e-78    Picea sitchensis
gb|KHG08643.1|  hypothetical protein F383_12346                         243   4e-75    Gossypium arboreum [tree cotton]
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    241   5e-74    
gb|KJB42336.1|  hypothetical protein B456_007G150200                    223   6e-68    Gossypium raimondii
dbj|BAH20309.1|  AT2G20360                                              214   1e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   205   4e-61    Citrus sinensis [apfelsine]
ref|XP_001765756.1|  predicted protein                                  199   5e-58    
gb|EEE58042.1|  hypothetical protein OsJ_08874                          186   6e-54    Oryza sativa Japonica Group [Japonica rice]
dbj|BAG95473.1|  unnamed protein product                                182   2e-52    Oryza sativa Japonica Group [Japonica rice]
gb|KJB42339.1|  hypothetical protein B456_007G150200                    181   2e-51    Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    174   3e-49    
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    172   2e-48    
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    171   3e-48    Triticum urartu
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             168   1e-46    
ref|XP_001757609.1|  predicted protein                                  169   1e-46    
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              167   5e-46    
ref|XP_004339653.1|  NADH dehydrogenase, putative                       150   9e-40    Acanthamoeba castellanii str. Neff
dbj|GAA99675.1|  hypothetical protein E5Q_06378                         147   1e-38    Mixia osmundae IAM 14324
gb|KIJ17694.1|  hypothetical protein PAXINDRAFT_167681                  146   4e-38    Paxillus involutus ATCC 200175
ref|XP_001626712.1|  predicted protein                                  145   7e-38    Nematostella vectensis
ref|XP_007510295.1|  predicted protein                                  146   7e-38    Bathycoccus prasinos
gb|KIK91888.1|  hypothetical protein PAXRUDRAFT_830459                  145   9e-38    Paxillus rubicundulus Ve08.2h10
ref|XP_001835685.1|  NADH dehydrogenase                                 145   9e-38    Coprinopsis cinerea okayama7#130
gb|KIO18953.1|  hypothetical protein M407DRAFT_153532                   145   1e-37    Tulasnella calospora MUT 4182
ref|XP_007872120.1|  hypothetical protein PNEG_00249                    142   6e-37    Pneumocystis murina B123
ref|XP_008574858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    143   7e-37    Galeopterus variegatus [Malayan flying lemur]
ref|XP_003126608.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   8e-37    Sus scrofa [pigs]
ref|XP_005334075.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   2e-36    
ref|XP_002712902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004006995.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    
ref|XP_005681037.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    142   2e-36    Capra hircus [domestic goat]
ref|XP_001420142.1|  predicted protein                                  141   2e-36    Ostreococcus lucimarinus CCE9901
ref|XP_007469502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   2e-36    Lipotes vexillifer [baiji]
ref|XP_006987942.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   3e-36    
ref|XP_009546417.1|  hypothetical protein HETIRDRAFT_475334             140   3e-36    Heterobasidion irregulare TC 32-1
ref|XP_003390219.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   3e-36    Amphimedon queenslandica
ref|XP_010963120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   3e-36    Camelus bactrianus [camel]
ref|XP_002504449.1|  predicted protein                                  141   3e-36    Micromonas commoda
gb|KDN41067.1|  putative NADH2 dehydrogenase 40K chain                  141   3e-36    Tilletiaria anomala UBC 951
gb|ESA03096.1|  hypothetical protein GLOINDRAFT_336975                  141   3e-36    
ref|XP_006210904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   3e-36    
gb|EXX58721.1|  hypothetical protein RirG_195270                        141   4e-36    Rhizophagus irregularis DAOM 197198w
ref|XP_003796469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    141   4e-36    Otolemur garnettii
ref|NP_001094222.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    141   4e-36    Rattus norvegicus [brown rat]
ref|XP_006175621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-36    
ref|XP_005365321.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-36    Microtus ochrogaster [prairie voles]
dbj|BAK63310.1|  NADH dehydrogenase                                     139   4e-36    Pan troglodytes
gb|AAH91192.1|  Ndufa9 protein                                          140   4e-36    Rattus norvegicus [brown rat]
ref|XP_005365322.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   4e-36    
ref|XP_003988339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   5e-36    Felis catus [cat]
ref|XP_003331391.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    140   6e-36    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007170262.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    Balaenoptera acutorostrata scammoni
ref|XP_006237562.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   6e-36    Rattus norvegicus [brown rat]
gb|EAW88839.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    137   6e-36    Homo sapiens [man]
gb|ABH12231.1|  mitochondrial complex I subunit NDUFA9                  140   8e-36    Pongo pygmaeus [orang utan]
ref|NP_001127602.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    140   9e-36    Pongo abelii [orang utan]
ref|XP_006053611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   9e-36    Bubalus bubalis [domestic water buffalo]
ref|XP_005957904.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   9e-36    
ref|XP_010843290.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Bison bison bison
ref|NP_001073383.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    140   1e-35    Pan troglodytes
ref|XP_004279068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   1e-35    Orcinus orca [Orca]
ref|NP_001266630.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    139   1e-35    Gorilla gorilla [gorilla]
sp|Q0MQB3.2|NDUA9_GORGO  RecName: Full=NADH dehydrogenase [ubiqui...    139   2e-35    Gorilla gorilla gorilla [lowland gorilla]
gb|AAH03351.1|  Similar to NADH dehydrogenase (ubiquinone) 1 alph...    138   2e-35    Homo sapiens [man]
ref|XP_534915.3|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    139   2e-35    Canis lupus familiaris [dogs]
ref|XP_007089756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    140   2e-35    
gb|KIK69637.1|  hypothetical protein GYMLUDRAFT_992204                  139   2e-35    Gymnopus luxurians FD-317 M1
gb|KDQ20806.1|  hypothetical protein BOTBODRAFT_26820                   139   2e-35    Botryobasidium botryosum FD-172 SS1
ref|XP_007935381.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   2e-35    Orycteropus afer afer
ref|XP_004778323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   2e-35    Mustela putorius furo [black ferret]
ref|XP_004381326.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    
emb|CBQ67793.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    139   3e-35    Sporisorium reilianum SRZ2
ref|XP_010357461.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   3e-35    Rhinopithecus roxellana
gb|AIC62000.1|  NDUFA9                                                  138   3e-35    synthetic construct
gb|AAA36350.1|  NADH dehydrogenase (ubiquinone)                         138   3e-35    Homo sapiens [man]
ref|NP_004993.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    138   4e-35    Homo sapiens [man]
ref|XP_008528773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   4e-35    Equus przewalskii [Przewalski horse]
ref|XP_001494651.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   4e-35    Equus caballus [domestic horse]
gb|ABF57357.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    138   4e-35    Bos taurus [bovine]
gb|EFB28697.1|  hypothetical protein PANDA_009221                       138   4e-35    Ailuropoda melanoleuca
ref|NP_991386.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    138   4e-35    Bos taurus [bovine]
gb|KIJ64483.1|  hypothetical protein HYDPIDRAFT_28424                   137   5e-35    Hydnomerulius pinastri MD-312
ref|XP_004210520.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   5e-35    
gb|EAW88838.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    138   6e-35    Homo sapiens [man]
ref|XP_002920485.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   6e-35    Ailuropoda melanoleuca
ref|XP_008141973.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   6e-35    Eptesicus fuscus
ref|XP_005084120.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   6e-35    Mesocricetus auratus [Syrian golden hamster]
gb|AAH05760.1|  Ndufa9 protein                                          137   7e-35    Mus musculus [mouse]
ref|NP_001279619.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    137   7e-35    Callorhinchus milii [Australian ghost shark]
ref|NP_001013477.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    136   8e-35    
ref|XP_002920484.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    138   8e-35    
ref|XP_008823675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   8e-35    Nannospalax galili
ref|XP_007902354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   8e-35    Callorhinchus milii [Australian ghost shark]
ref|XP_003496081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   9e-35    Cricetulus griseus [Chinese hamsters]
emb|CCF54116.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    137   9e-35    Ustilago hordei
ref|XP_006862735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   1e-34    Chrysochloris asiatica
ref|NP_079634.2|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    137   1e-34    Mus musculus [mouse]
gb|ETN62206.1|  NADH-ubiquinone oxidoreductase 39 kda subunit           137   1e-34    Anopheles darlingi [American malaria mosquito]
gb|KIM65954.1|  hypothetical protein SCLCIDRAFT_1211966                 137   1e-34    Scleroderma citrinum Foug A
ref|XP_004692611.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    139   1e-34    
ref|XP_006754928.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    137   1e-34    Myotis davidii
ref|XP_003059930.1|  predicted protein                                  136   1e-34    Micromonas pusilla CCMP1545
gb|AAI53423.1|  Ndufa9 protein                                          136   2e-34    Danio rerio [leopard danio]
ref|XP_007503809.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   2e-34    Monodelphis domestica
gb|AAH68378.1|  Ndufa9 protein                                          136   2e-34    Danio rerio [leopard danio]
ref|XP_004459092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   2e-34    Dasypus novemcinctus
dbj|BAF83756.1|  unnamed protein product                                136   2e-34    Homo sapiens [man]
ref|XP_002736180.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   2e-34    Saccoglossus kowalevskii
gb|EST09999.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit    136   2e-34    Kalmanozyma brasiliensis GHG001
ref|XP_003771339.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   2e-34    Sarcophilus harrisii
ref|XP_005174380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   2e-34    
ref|XP_006957558.1|  NAD(P)-binding protein                             136   2e-34    Wallemia mellicola CBS 633.66
dbj|GAC73597.1|  NADH:ubiquinone oxidoreductase, NDUFA9/39kDa sub...    136   2e-34    Moesziomyces antarcticus T-34
ref|XP_009178280.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   2e-34    
gb|ELR54825.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    135   2e-34    Bos mutus
gb|ETS63618.1|  hypothetical protein PaG_01917                          136   3e-34    Moesziomyces aphidis DSM 70725
dbj|GAK62286.1|  NAD(P)-binding protein                                 136   3e-34    Moesziomyces antarcticus
ref|XP_001372251.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    Monodelphis domestica
ref|XP_009178281.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    
ref|XP_007270771.1|  NADH dehydrogenase                                 135   3e-34    Fomitiporia mediterranea MF3/22
ref|XP_007527887.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    Erinaceus europaeus [common hedgehog]
ref|XP_008703115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   3e-34    Ursus maritimus [white bear]
gb|KDR23820.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    136   3e-34    Zootermopsis nevadensis
ref|XP_005897993.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-34    Bos mutus
gb|AAI52140.1|  Ndufa9 protein                                          135   3e-34    Danio rerio [leopard danio]
ref|XP_006739694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   3e-34    Leptonychotes weddellii
gb|KDQ62587.1|  hypothetical protein JAAARDRAFT_30488                   135   3e-34    Jaapia argillacea MUCL 33604
ref|XP_007882091.1|  hypothetical protein PFL1_06359                    135   4e-34    Anthracocystis flocculosa PF-1
ref|XP_001515711.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   4e-34    
ref|XP_003410681.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34    Loxodonta africana [African bush elephant]
ref|XP_006795902.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   4e-34    Neolamprologus brichardi [lyretail cichlid]
emb|CDI51333.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    135   4e-34    Melanopsichium pennsylvanicum 4
ref|XP_005492469.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34    Zonotrichia albicollis
ref|XP_011386267.1|  putative NADH2 dehydrogenase (ubiquinone) 40...    135   4e-34    Ustilago maydis 521
ref|XP_007965492.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   4e-34    Chlorocebus sabaeus
ref|XP_008703114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    136   5e-34    Ursus maritimus [white bear]
ref|XP_005533361.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   5e-34    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005877078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   5e-34    Myotis brandtii
ref|XP_008274666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   5e-34    Stegastes partitus
ref|XP_007008648.1|  hypothetical protein TREMEDRAFT_72592              135   5e-34    Tremella mesenterica DSM 1558
gb|KFB35184.1|  AGAP010792-PA-like protein                              135   6e-34    Anopheles sinensis
ref|XP_318516.3|  AGAP010792-PA                                         135   7e-34    Anopheles gambiae str. PEST
ref|XP_002188497.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   7e-34    
ref|XP_003447104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   7e-34    Oreochromis niloticus
ref|XP_007353556.1|  NAD(P)-binding protein                             135   7e-34    
ref|XP_006633741.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   7e-34    Lepisosteus oculatus
ref|XP_005950396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   8e-34    Haplochromis burtoni
ref|XP_005734821.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   8e-34    Pundamilia nyererei
ref|XP_005950395.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   8e-34    Haplochromis burtoni
ref|XP_005734820.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    135   8e-34    Pundamilia nyererei
dbj|GAC95510.1|  hypothetical protein PHSY_003086                       135   8e-34    Pseudozyma hubeiensis SY62
ref|XP_005569923.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   8e-34    Macaca fascicularis [crab eating macaque]
ref|XP_007304718.1|  NADH dehydrogenase                                 134   1e-33    Stereum hirsutum FP-91666 SS1
ref|XP_009989270.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    Tauraco erythrolophus
dbj|BAB22596.1|  unnamed protein product                                134   1e-33    Mus musculus [mouse]
ref|XP_006923900.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    Pteropus alecto
gb|KFV03415.1|  hypothetical protein N340_03010                         134   1e-33    Tauraco erythrolophus
ref|XP_004416912.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    Odobenus rosmarus divergens
ref|XP_004438802.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   1e-33    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_001187320.1|  mitochondrial NADH dehydrogenase (ubiquinone...    134   2e-33    Ictalurus punctatus
ref|XP_570308.1|  NADH dehydrogenase (ubiquinone)                       134   2e-33    Cryptococcus neoformans var. neoformans JEC21
emb|CEF99374.1|  NAD(P)-binding domain                                  133   2e-33    Ostreococcus tauri
ref|XP_009092324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   2e-33    Serinus canaria [canary]
gb|EHH20407.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit           133   2e-33    Macaca mulatta [rhesus macaque]
ref|XP_005426929.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    134   2e-33    
gb|KIK24507.1|  hypothetical protein PISMIDRAFT_401487                  133   3e-33    Pisolithus microcarpus 441
ref|XP_007399771.1|  hypothetical protein PHACADRAFT_199484             133   3e-33    Phanerochaete carnosa HHB-10118-sp
ref|XP_005569922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   3e-33    Macaca fascicularis [crab eating macaque]
ref|XP_001876312.1|  predicted protein                                  132   3e-33    Laccaria bicolor S238N-H82
gb|KDE07008.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    133   3e-33    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004610502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    133   3e-33    Sorex araneus [Eurasian shrew]
emb|CCA67799.1|  probable NADH2 dehydrogenase (ubiquinone) 40K chain    133   3e-33    Serendipita indica DSM 11827
gb|ERE67037.1|  putative polypeptide N-acetylgalactosaminyltransf...    137   4e-33    Cricetulus griseus [Chinese hamsters]
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...    133   4e-33    Cyanidioschyzon merolae strain 10D
gb|KFO62876.1|  hypothetical protein N302_08675                         132   4e-33    Corvus brachyrhynchos
ref|XP_009266962.1|  hypothetical protein J056_003464                   132   4e-33    Wallemia ichthyophaga EXF-994
dbj|GAM27735.1|  hypothetical protein SAMD00019534_109110               132   4e-33    Acytostelium subglobosum LB1
ref|XP_001865472.1|  NADH-ubiquinone oxidoreductase 39 kda subunit      133   4e-33    Culex quinquefasciatus
ref|XP_004347048.1|  Ndufa9 protein                                     132   4e-33    Capsaspora owczarzaki ATCC 30864
dbj|GAN07940.1|  NAD(P)-binding protein                                 132   5e-33    Mucor ambiguus
ref|XP_010148325.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   5e-33    Eurypyga helias
gb|KFV92623.1|  hypothetical protein N326_00630                         129   5e-33    Eurypyga helias
ref|XP_010408555.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   5e-33    Corvus cornix cornix
gb|KFP29723.1|  hypothetical protein N325_09765                         132   5e-33    Colius striatus
gb|KFV11223.1|  hypothetical protein N339_08758                         130   6e-33    Pterocles gutturalis
ref|XP_010195242.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   6e-33    Colius striatus
emb|CEI86940.1|  Putative Genomic scaffold, msy_sf_1                    131   6e-33    Rhizopus microsporus
ref|XP_008636784.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   6e-33    
gb|KIR68354.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    132   6e-33    Cryptococcus gattii CA1873
gb|KIM89048.1|  hypothetical protein PILCRDRAFT_812944                  132   6e-33    Piloderma croceum F 1598
ref|XP_003273859.2|  PREDICTED: probable polypeptide N-acetylgala...    135   7e-33    
ref|XP_645194.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomp...    132   7e-33    Dictyostelium discoideum AX4
ref|XP_007845659.1|  nadh dehydrogenase                                 132   7e-33    
ref|XP_006123105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   7e-33    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010609901.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   8e-33    Fukomys damarensis [Damara mole rat]
ref|XP_001118102.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   9e-33    
ref|XP_003221407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   9e-33    Anolis carolinensis [Carolina anole]
emb|CCM05932.1|  predicted protein                                      132   9e-33    Fibroporia radiculosa
gb|KDQ25989.1|  39kDa subunit of NDUFA9, NADH ubiquinone oxidored...    131   1e-32    Pleurotus ostreatus PC15
ref|XP_008037591.1|  NADH dehydrogenase                                 131   1e-32    Trametes versicolor FP-101664 SS1
ref|XP_010076803.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   1e-32    Pterocles gutturalis
gb|KIR57388.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    132   1e-32    Cryptococcus gattii Ru294
gb|KGB74721.1|  NADH dehydrogenase                                      132   1e-32    
gb|KIR80601.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    132   1e-32    
gb|KFP08708.1|  hypothetical protein N300_02598                         131   1e-32    
ref|XP_003193480.1|  NADH dehydrogenase (ubiquinone)                    132   1e-32    
gb|KIK47221.1|  hypothetical protein CY34DRAFT_21544                    131   1e-32    
emb|CCJ28978.1|  unnamed protein product                                131   1e-32    
gb|KIR89560.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    132   1e-32    
emb|CEJ03407.1|  Putative Genomic scaffold, msy_sf_1                    131   1e-32    
ref|XP_004643624.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   1e-32    
gb|ADO28252.1|  mitochondrial NADH dehydrogenase 1 alpha subcompl...    131   1e-32    
ref|XP_005040230.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    132   1e-32    
ref|XP_001660001.1|  AAEL009414-PA                                      132   1e-32    
gb|EPB89825.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    131   1e-32    
ref|XP_007870444.1|  NAD P-binding protein                              131   2e-32    
emb|CEG64935.1|  Putative Genomic scaffold, msy_sf_1                    131   2e-32    
ref|XP_008486857.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   2e-32    
gb|EFA77105.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9         131   2e-32    
gb|KIR50051.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    131   2e-32    
ref|XP_010171650.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    131   2e-32    
ref|XP_008502666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   2e-32    
gb|KFZ63522.1|  hypothetical protein N321_03654                         130   2e-32    
gb|EMD40072.1|  hypothetical protein CERSUDRAFT_112285                  130   2e-32    
emb|CEP08222.1|  hypothetical protein                                   131   2e-32    
gb|KFV62438.1|  hypothetical protein N307_14752                         130   2e-32    
emb|CEG82390.1|  Putative Genomic scaffold, msy_sf_1                    130   2e-32    
gb|KIY67124.1|  NAD(P)-binding protein                                  130   3e-32    
ref|XP_005378797.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
ref|XP_005148026.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
gb|KIP02896.1|  hypothetical protein PHLGIDRAFT_130473                  130   3e-32    
ref|XP_003463318.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
ref|XP_004992628.1|  hypothetical protein PTSG_07208                    130   3e-32    
ref|XP_008071131.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    131   3e-32    
ref|XP_009076582.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
gb|KFP83910.1|  hypothetical protein N310_12825                         130   3e-32    
ref|XP_009001694.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   3e-32    
gb|KFQ14782.1|  hypothetical protein N330_12470                         130   4e-32    
ref|XP_009908154.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   4e-32    
ref|XP_009954998.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   4e-32    
gb|KIJ54415.1|  hypothetical protein M422DRAFT_775527                   130   4e-32    
ref|XP_005188922.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   4e-32    
ref|XP_002108719.1|  expressed hypothetical protein                     129   4e-32    
gb|KFV38950.1|  hypothetical protein N341_11120                         127   4e-32    
gb|EMS25072.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    130   5e-32    
gb|KFP45254.1|  hypothetical protein N324_11766                         128   5e-32    
ref|XP_009973803.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   6e-32    
gb|AFR95169.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9    130   6e-32    
gb|KFO82303.1|  hypothetical protein N303_06049                         129   6e-32    
ref|XP_010310531.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    130   6e-32    
ref|XP_006891427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   6e-32    
ref|XP_010125588.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    128   6e-32    
gb|KFQ73922.1|  hypothetical protein N337_04487                         129   7e-32    
ref|XP_007768401.1|  NAD(P)-binding protein                             129   7e-32    
ref|XP_009015040.1|  hypothetical protein HELRODRAFT_98836              129   7e-32    
ref|XP_009567541.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    129   8e-32    
ref|XP_007435737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   8e-32    
ref|XP_011188849.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   1e-31    
ref|XP_004568347.1|  PREDICTED: probable polypeptide N-acetylgala...    132   1e-31    
ref|XP_010133323.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   1e-31    
gb|KFO89045.1|  hypothetical protein N320_01399                         127   1e-31    
ref|XP_010021537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   1e-31    
gb|EMP38439.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    127   1e-31    
gb|KFQ44899.1|  hypothetical protein N333_02601                         128   1e-31    
ref|XP_003932646.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   2e-31    
ref|XP_009582483.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    128   2e-31    
ref|XP_006172086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   2e-31    
ref|XP_010005482.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    128   2e-31    
gb|ERL95049.1|  hypothetical protein D910_12319                         129   2e-31    
gb|AEE61636.1|  unknown                                                 129   2e-31    
gb|KFV95211.1|  hypothetical protein N327_03132                         128   2e-31    
gb|ENN72465.1|  hypothetical protein YQE_10807                          129   2e-31    
gb|KFQ30066.1|  hypothetical protein N332_01289                         128   2e-31    
ref|XP_003034456.1|  hypothetical protein SCHCODRAFT_14900              128   2e-31    
gb|KFU84818.1|  hypothetical protein M959_04911                         128   2e-31    
ref|XP_011304899.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    129   2e-31    
ref|XP_006681739.1|  hypothetical protein BATDEDRAFT_37370              128   2e-31    
gb|KFO07725.1|  hypothetical protein N312_01006                         128   2e-31    
gb|KFV57640.1|  hypothetical protein N328_11892                         127   2e-31    
gb|KFP53101.1|  hypothetical protein N323_09262                         127   3e-31    
ref|XP_009815144.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   3e-31    
gb|EPS94725.1|  hypothetical protein FOMPIDRAFT_1133771                 127   3e-31    
gb|KFW86271.1|  hypothetical protein N305_07548                         127   3e-31    
gb|KJA24071.1|  hypothetical protein HYPSUDRAFT_39211                   127   3e-31    
gb|EIE86946.1|  hypothetical protein RO3G_11657                         127   3e-31    
gb|KFP80801.1|  hypothetical protein N311_08372                         127   4e-31    
ref|XP_008928534.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   4e-31    
gb|KFQ91966.1|  hypothetical protein Y956_15987                         127   4e-31    
ref|XP_009863298.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   4e-31    
ref|XP_010714872.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   4e-31    
gb|KFR13833.1|  hypothetical protein N306_14448                         127   4e-31    
ref|NP_001082699.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    127   4e-31    
gb|KFQ75039.1|  hypothetical protein N335_03526                         127   4e-31    
ref|XP_009936776.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   5e-31    
ref|XP_009473697.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    127   5e-31    
ref|XP_006273618.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   5e-31    
gb|AAH45076.1|  MGC64316 protein                                        127   5e-31    
ref|XP_009917119.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   5e-31    
ref|XP_010573635.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   5e-31    
gb|KIK07979.1|  hypothetical protein K443DRAFT_128758                   127   6e-31    
ref|XP_010285464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   6e-31    
ref|XP_004354956.1|  Transcription regulatory protein SNF5              131   6e-31    
ref|NP_001165787.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    127   6e-31    
emb|CDO68262.1|  hypothetical protein BN946_scf184842.g25               126   6e-31    
gb|KFQ03890.1|  hypothetical protein N329_07841                         126   6e-31    
gb|KFW94971.1|  hypothetical protein N336_08738                         126   6e-31    
ref|XP_786784.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    127   6e-31    
gb|KFM13739.1|  hypothetical protein AS27_14184                         126   7e-31    
ref|XP_006027877.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   7e-31    
ref|XP_007379939.1|  NAD(P)-binding protein                             126   7e-31    
ref|XP_007056976.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   8e-31    
ref|XP_005234795.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    126   8e-31    
ref|XP_009510411.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   9e-31    
ref|XP_010176933.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   9e-31    
ref|XP_004879593.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   9e-31    
gb|KIM28918.1|  hypothetical protein M408DRAFT_328984                   126   9e-31    
ref|XP_001730360.1|  hypothetical protein MGL_2742                      125   9e-31    
ref|XP_010573634.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   9e-31    
ref|XP_011208110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    127   9e-31    
emb|CDS05157.1|  Putative NADH dehydrogenase (Ubiquinone) 1FT alp...    126   1e-30    
ref|XP_005503104.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-30    
emb|CDH57814.1|  nadh-ubiquinone oxidoreductase 40 kdamitochondrial     126   1e-30    
gb|KFP63610.1|  hypothetical protein N322_12220                         126   1e-30    
ref|XP_001985349.1|  GH14554                                            126   1e-30    
ref|NP_001006281.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    126   1e-30    
ref|XP_009673696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-30    
gb|KFW67319.1|  hypothetical protein AS28_12998                         125   1e-30    
ref|XP_004869427.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-30    
ref|XP_009695607.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-30    
gb|KFV81563.1|  hypothetical protein N308_11418                         125   1e-30    
gb|KDR82718.1|  hypothetical protein GALMADRAFT_238218                  125   1e-30    
ref|NP_001011432.1|  NADH dehydrogenase (ubiquinone) 1 alpha subc...    125   1e-30    
ref|XP_005097061.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    126   1e-30    
ref|XP_009634820.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    125   2e-30    
gb|KFP14044.1|  hypothetical protein Z169_06947                         125   2e-30    
gb|EOB06411.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    125   2e-30    
gb|KGL85955.1|  hypothetical protein N301_03034                         125   2e-30    
ref|XP_009673695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   2e-30    
ref|XP_005012705.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   2e-30    
gb|KGL84591.1|  hypothetical protein N309_12483                         125   2e-30    
ref|XP_009483609.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   2e-30    
ref|XP_001352990.1|  GA19302                                            125   3e-30    
ref|XP_009892508.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    125   3e-30    
gb|KFQ62461.1|  hypothetical protein N334_13818                         125   3e-30    
ref|XP_009322637.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   3e-30    
ref|XP_002026863.1|  GL12793                                            125   3e-30    
ref|XP_008309204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   3e-30    
ref|XP_010223608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   3e-30    
ref|XP_002048107.1|  GJ11526                                            125   3e-30    
ref|XP_006462703.1|  NdufA9 NADH ubiquinone oxidoreductase subunit      124   4e-30    
ref|XP_002008276.1|  GI13402                                            125   4e-30    
gb|KIY44806.1|  NAD(P)-binding protein                                  124   4e-30    
ref|XP_010881814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   4e-30    
ref|XP_008118146.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   4e-30    
ref|XP_003286992.1|  hypothetical protein DICPUDRAFT_97564              124   4e-30    
gb|KII87009.1|  hypothetical protein PLICRDRAFT_700259                  124   4e-30    
ref|XP_001948072.2|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   5e-30    
ref|XP_007319751.1|  39kDa subunit of NDUFA9, NADH:ubiquinone oxi...    124   5e-30    
ref|XP_002040681.1|  GM22299                                            124   5e-30    
ref|XP_002086632.1|  GE23238                                            124   6e-30    
gb|EJT98653.1|  NADP-binding protein                                    124   6e-30    
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    124   6e-30    
ref|XP_005307068.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   6e-30    
ref|XP_007370168.1|  NADH dehydrogenase                                 124   7e-30    
gb|KFH67974.1|  hypothetical protein MVEG_06705                         124   7e-30    
ref|XP_007330075.1|  39kDa subunit of NdufA9, NADH ubiquinone oxi...    124   7e-30    
gb|EHJ77228.1|  hypothetical protein KGM_02785                          124   8e-30    
ref|XP_011256589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    124   1e-29    
gb|KDN34620.1|  hypothetical protein RSAG8_12282                        123   1e-29    
ref|XP_009286807.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    125   1e-29    
gb|AHZ64223.1|  FI24283p1                                               123   1e-29    
gb|KIL67845.1|  hypothetical protein M378DRAFT_185427                   123   1e-29    
ref|XP_005712083.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    123   1e-29    
ref|XP_975235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1 al...    123   1e-29    
ref|XP_001973503.1|  GG16121                                            123   1e-29    
ref|XP_004522227.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   1e-29    
ref|XP_001957289.1|  GF10349                                            123   1e-29    
gb|KIM43379.1|  hypothetical protein M413DRAFT_403196                   123   2e-29    
ref|XP_001702653.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      123   2e-29    
ref|XP_008549223.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    123   2e-29    
ref|XP_011164362.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    122   2e-29    
gb|EFZ15204.1|  hypothetical protein SINV_03405                         122   3e-29    
gb|ELU16423.1|  hypothetical protein CAPTEDRAFT_138749                  122   3e-29    
gb|KDN34621.1|  hypothetical protein RSAG8_12283                        117   6e-29    
gb|ACO11138.1|  NADH dehydrogenase 1 alpha subcomplex subunit 9, ...    121   7e-29    
ref|NP_649234.1|  CG6020, isoform A                                     121   9e-29    
gb|KFM58002.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    121   9e-29    
ref|XP_011067114.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    121   1e-28    
ref|XP_002069018.1|  GK12296                                            121   1e-28    
emb|CCG80684.1|  putative NADH-ubiquinone oxidoreductase 39 kDa s...    120   1e-28    
ref|XP_002839474.1|  hypothetical protein                               120   1e-28    
ref|XP_010760174.1|  NADH-ubiquinone oxidoreductase 40 kDa subuni...    120   1e-28    
emb|CAX69804.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    119   1e-28    
gb|EEH22277.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit, mi...    120   1e-28    
emb|CEL51784.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    120   1e-28    
gb|EJT47332.1|  NADH dehydrogenase (ubiquinone)                         120   2e-28    
ref|XP_007409682.1|  hypothetical protein MELLADRAFT_77647              120   2e-28    
ref|XP_002954591.1|  NADH:ubiquinone oxidoreductase 39 kDa subunit      120   2e-28    
gb|EEH33982.2|  NADH-ubiquinone oxidoreductase 40 kDa subunit           120   2e-28    
gb|EUC62263.1|  NADH-ubiquinone oxidoreductase 39 kDa protein, pu...    119   2e-28    
gb|EJW71823.1|  hypothetical protein WUBG_17270                         115   2e-28    
gb|KEP53453.1|  putative NADH-ubiquinone oxidoreductase 39 kDa pr...    119   2e-28    
ref|XP_010731332.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    120   2e-28    
ref|XP_002423386.1|  NADH-ubiquinone oxidoreductase 40 kDa subuni...    120   3e-28    
ref|XP_009162600.1|  hypothetical protein T265_00532                    119   3e-28    
ref|XP_005651289.1|  NAD(P)-binding protein                             119   3e-28    
ref|XP_001545366.1|  NADH-ubiquinone oxidoreductase 40 kDa subunit      117   4e-28    
ref|XP_005840852.1|  hypothetical protein GUITHDRAFT_160957             119   4e-28    
emb|CCO27961.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    119   5e-28    
ref|XP_003145987.1|  hypothetical protein LOAG_10415                    117   5e-28    
ref|XP_001893752.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    119   6e-28    
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039              119   6e-28    
ref|XP_004927924.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    119   6e-28    
gb|AAW26486.1|  SJCHGC05906 protein                                     118   7e-28    
ref|XP_002481461.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    118   7e-28    
emb|CAX73863.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    118   8e-28    
dbj|BAM18246.1|  NADH-ubiquinone oxidoreductase 39 kda subunit          118   9e-28    
dbj|GAA31353.2|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    118   9e-28    
ref|XP_002147321.1|  NADH-ubiquinone oxidoreductase 39 kDa subuni...    117   1e-27    
gb|EMR82952.1|  putative nadh-ubiquinone oxidoreductase 39 kda pr...    117   1e-27    
gb|KIN00985.1|  hypothetical protein OIDMADRAFT_145126                  117   2e-27    
ref|XP_005814600.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   2e-27    
ref|XP_011339337.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    117   2e-27    



>gb|KJB42342.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=234

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSRM  628
            VSCLG+S +SPSR 
Sbjct  181  VSCLGSSLSSPSRF  194



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   307 bits (786),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSRM  628
            VSCLG+S +SPSR 
Sbjct  181  VSCLGSSLSSPSRF  194



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   308 bits (789),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSR  625
            VSCLG+S +SPSR
Sbjct  181  VSCLGSSLSSPSR  193



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA++RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A+KGVGHL+RKGTGG
Sbjct  1    MQAISRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSL-AAKGVGHLIRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  180  VSCLGASASSPSRM  193



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV+RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A KGVGHL+RKGTGG
Sbjct  1    MQAVSRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSLPA-KGVGHLIRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  180  VSCLGASASSPSRM  193



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSR  625
            VSCLG+S +SPSR
Sbjct  181  VSCLGSSLSSPSR  193



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSRM  628
            VSCLG+S +SPSR 
Sbjct  181  VSCLGSSLSSPSRF  194



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   307 bits (787),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSIYPLSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQ  180

Query  587  VSCLGASPTSPSR  625
            VSCLG+S +SPSR
Sbjct  181  VSCLGSSLSSPSR  193



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA++RRLGHQ    S ++S+ KS   LSDHY G D PR  STL A KGVGHLVRKGTGG
Sbjct  1    MQALSRRLGHQSFNQSPAISSLKSIYPLSDHYYGADHPRLGSTL-APKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAVVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH+MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHHMAEQLAMISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  180  VSCLGASPSSPSRM  193



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 3/195 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHS-VSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTG  223
            MQAV RRLG+QY K S + +S FKS  LL D  YG ++ R+AS+L A+KGVGHLVRKGTG
Sbjct  1    MQAVCRRLGNQYTKQSTAPISCFKSIYLLPDQCYGAESTRFASSL-ATKGVGHLVRKGTG  59

Query  224  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  403
            GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  119

Query  404  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  583
            KYNPRDE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMR+I
Sbjct  120  KYNPRDENSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEQLALIAKEHGGIMRYI  179

Query  584  QVSCLGASPTSPSRM  628
            QVSCLGASP+S SRM
Sbjct  180  QVSCLGASPSSSSRM  194



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA++RRLGHQ LKP+ S+S+FKS   LSDH YG D PR+AS+L A+KGV HL+RKGTGG
Sbjct  1    MQAISRRLGHQSLKPAASLSSFKSIYPLSDHHYGADHPRHASSL-AAKGVCHLIRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVVINLIGR++ETRNYSFEE+NH M EQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVINLIGRDHETRNYSFEELNHGMTEQLAMISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  180  VSCLGASASSPSRM  193



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 180/195 (92%), Gaps = 3/195 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHS-VSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTG  223
            MQ+V RRLG+QY++ S + +S+FKS + L   +YG D PR+ASTL A+KGVGHLVRKGTG
Sbjct  1    MQSVGRRLGYQYIRHSAAPISSFKSAYSLPDQYYGADNPRWASTL-ATKGVGHLVRKGTG  59

Query  224  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  403
            GRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPM  119

Query  404  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  583
            KY+PRDE S+KAV+AKANVVINLIGR+YETRNYSFEEVNH+MAEQLA I+KEHGGIMR+I
Sbjct  120  KYDPRDEDSIKAVMAKANVVINLIGRDYETRNYSFEEVNHHMAEQLAVIAKEHGGIMRYI  179

Query  584  QVSCLGASPTSPSRM  628
            QVSCLGASP+SPS++
Sbjct  180  QVSCLGASPSSPSKL  194



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 177/197 (90%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHS--VSAFKS-FDLLSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQA+ RRLGH  LKPS +  +S+F S F+    HY G D PRYAS LTA +G GH+VRKG
Sbjct  1    MQAIARRLGHHSLKPSATAAISSFDSSFNPYFHHYNGADNPRYASNLTA-RGTGHIVRKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PM+YNPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAE+LA I+KEHGGIMR
Sbjct  120  PMQYNPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEELAMIAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGASP+SPSRM
Sbjct  180  FIQVSCLGASPSSPSRM  196



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD-HYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV RRLGHQ L PS S+SA KS   L D +YG D PR  STL A+KG+GHLVRKGTGG
Sbjct  1    MQAVARRLGHQSLSPSPSISALKSIHPLFDSYYGADHPRCGSTL-ATKGLGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFE  NH+MAEQLA I+KEHGGI+R+IQ
Sbjct  120  YNPRDEASIKAVMAKANVVVNLIGREYETRNYSFEVANHFMAEQLATIAKEHGGIIRYIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  180  VSCLGASASSPSRM  193



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 172/193 (89%), Gaps = 2/193 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQA +RRLG Q+LK S ++S+  S   +SD Y  D PRY STL A KGVGHLVRKGTGGR
Sbjct  2    MQAYSRRLGQQFLKSSPAISSLNSIHPISD-YVTDHPRYGSTL-APKGVGHLVRKGTGGR  59

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY
Sbjct  60   SSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKY  119

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            NPRDESS+KAV+AKANVV+NLIGREYETRN+SFEEVNH MAEQLA I+KEHGGIMRFIQV
Sbjct  120  NPRDESSIKAVMAKANVVLNLIGREYETRNFSFEEVNHSMAEQLAMIAKEHGGIMRFIQV  179

Query  590  SCLGASPTSPSRM  628
            SCLGAS +SPSRM
Sbjct  180  SCLGASTSSPSRM  192



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   296 bits (758),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+++R+GHQYL PS S+S+ KS   +SDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAISKRVGHQYLTPSSSISSLKSIYPVSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR 
Sbjct  180  VSCLGASSSSPSRF  193



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+++R+GHQYL PS S+S  KS   +SDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAISKRVGHQYLTPSSSISLLKSIYPVSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAEQLATISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR 
Sbjct  180  VSCLGASSSSPSRF  193



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLG Q L+P+ S+ + +  + L   +YG D PRY STL A KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGQQSLRPTPSIYSIECIYPLFHHYYGCDHPRYGSTLAAHKGLGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQ
Sbjct  121  YDPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQ  180

Query  587  VSCLGASPTSPSRM  628
            VSCLG+SP+S SR 
Sbjct  181  VSCLGSSPSSASRF  194



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 175/194 (90%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQ + RRLG Q L+PS   ++ KS   +SDH YG+D  RY STL A+KGVGHLVRKGTGG
Sbjct  1    MQTIARRLGQQSLRPS---TSLKSIYPISDHHYGMDHERYVSTL-ATKGVGHLVRKGTGG  56

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  116

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEV+++MAEQLA ISKEHGGI+RFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQ  176

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  177  VSCLGASPSSPSRM  190



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 175/194 (90%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQ + RRLG Q L+PS S+   KS   +SDH YG+D  RY STL A+KGVGHLVRKGTGG
Sbjct  1    MQTIARRLGQQSLRPSTSL---KSIYPISDHHYGMDHERYVSTL-ATKGVGHLVRKGTGG  56

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  116

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEV+++MAEQLA ISKEHGGI+RFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVHYHMAEQLAKISKEHGGILRFIQ  176

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  177  VSCLGASPSSPSRM  190



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 172/193 (89%), Gaps = 3/193 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQA++RRLG Q   P+ S+++ KS   L  +YG D PRY STLT  KGVGHLVRKGTGGR
Sbjct  1    MQAISRRLGQQAHNPAASIASLKSIYPL--YYGTDHPRYGSTLT-PKGVGHLVRKGTGGR  57

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGI+ATVFGATGFLGRY+VQQLAKMG+QVLVPFRGSED HRHLKLMGDLGQIVPM Y
Sbjct  58   SSVSGIIATVFGATGFLGRYVVQQLAKMGTQVLVPFRGSEDSHRHLKLMGDLGQIVPMLY  117

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            NPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMR+IQV
Sbjct  118  NPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMIAKEHGGIMRYIQV  177

Query  590  SCLGASPTSPSRM  628
            SCLGAS +SPSRM
Sbjct  178  SCLGASASSPSRM  190



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 171/193 (89%), Gaps = 3/193 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQ + RRLGHQ LK S S+ A   + +   HY  D  R+ ST+ A+KGVGHLVRKGTGGR
Sbjct  1    MQTIARRLGHQSLKSSTSLRAI--YPISDHHYVADHERFVSTI-ANKGVGHLVRKGTGGR  57

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSEDC RHLKLMGDLGQIVPMKY
Sbjct  58   SSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDCPRHLKLMGDLGQIVPMKY  117

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            NPRDESSVKAV+AKANVVINLIGR+YETRNYSFEEVN++MAE LA ISKEHGGI+RFIQV
Sbjct  118  NPRDESSVKAVMAKANVVINLIGRDYETRNYSFEEVNYHMAENLAKISKEHGGILRFIQV  177

Query  590  SCLGASPTSPSRM  628
            SCLGASP+SPSRM
Sbjct  178  SCLGASPSSPSRM  190



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 7/193 (4%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQA+TRRLG Q L+P+ S+ +        ++YG D PRY STL A KG+GHLVRKGTGGR
Sbjct  1    MQAITRRLGQQSLRPTPSIYSI-------EYYGCDHPRYGSTLAAHKGLGHLVRKGTGGR  53

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGI+ATVFGATGF GRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY
Sbjct  54   SSVSGIIATVFGATGFFGRYVVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKY  113

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            +PRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQV
Sbjct  114  DPRDENSIKAVMAKANVVINLIGREYETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQV  173

Query  590  SCLGASPTSPSRM  628
            SCLG+SP+S SR 
Sbjct  174  SCLGSSPSSASRF  186



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 176/194 (91%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+ RR+ HQ LKPS   ++ KS   +SDH YG D  R+ ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAMARRVVHQSLKPS---TSLKSIYPISDHHYGADHERFVSTI-ATKGVGHLVRKGTGG  56

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQ LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ+VPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQHLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQVVPMK  116

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDESSVKAV+AKANVVINLIGR++ETRNYS+E+V+++MA+QLA ISKEHGGIMRFIQ
Sbjct  117  YNPRDESSVKAVMAKANVVINLIGRDFETRNYSYEQVHYHMADQLARISKEHGGIMRFIQ  176

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  177  VSCLGASPSSPSRM  190



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA  RR G + L  S ++  FKS + L SD YGID PR+ ST++  KG GH++RKGTGG
Sbjct  1    MQACWRRSGQRLLDRSPALFPFKSIYPLSSDGYGIDHPRHVSTISV-KGGGHIIRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  180  VSCLGASPSSPSRM  193



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 170/194 (88%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQ   RR G + L    ++S FKS + L SD YGID PRY ST++  KG GH+VRKGTGG
Sbjct  1    MQVCWRRSGQRLLDHYPALSPFKSIYPLSSDGYGIDHPRYVSTISI-KGAGHVVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIIATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  180  VSCLGASSSSPSRM  193



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   289 bits (740),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR 
Sbjct  180  VSCLGASSSSPSRF  193



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   288 bits (738),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 173/194 (89%), Gaps = 7/194 (4%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDH-YGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA++RRLGH+       +S+FKS   LSDH YG D PRY STL A++GVGHL+RKGTGG
Sbjct  1    MQAISRRLGHR-----SPISSFKSIYPLSDHLYGADHPRYGSTL-ATRGVGHLIRKGTGG  54

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGS+D  RHLKLMGDLGQIVPMK
Sbjct  55   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSDDDPRHLKLMGDLGQIVPMK  114

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVVINLIGR+YETRNYSFEE+NH MA QLA ISKEHGGIMRFIQ
Sbjct  115  YNPRDENSIKAVMAKANVVINLIGRDYETRNYSFEELNHAMAGQLAMISKEHGGIMRFIQ  174

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR+
Sbjct  175  VSCLGASASSPSRL  188



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 171/193 (89%), Gaps = 2/193 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQA+TR+LGHQ LK S ++S+FKS    SD +   + R+AS +  S G GHL RKGTGGR
Sbjct  1    MQAITRKLGHQSLKHSPAISSFKSLYPPSDDHYCGS-RFASNVATSGG-GHLARKGTGGR  58

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGIVATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPMKY
Sbjct  59   SSVSGIVATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPMKY  118

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            NPRDE+SVKAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I+KEHGGI+RFIQV
Sbjct  119  NPRDENSVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIIRFIQV  178

Query  590  SCLGASPTSPSRM  628
            SCLG SPTSPSRM
Sbjct  179  SCLGVSPTSPSRM  191



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 172/195 (88%), Gaps = 6/195 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGTG  223
            MQA+TR+LGHQ LK S ++S+FKS    SD  +YG    R+AS +  S G GHL RKGTG
Sbjct  1    MQAITRKLGHQSLKHSPAISSFKSLYPPSDDQYYG---SRFASNVATSGG-GHLARKGTG  56

Query  224  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  403
            GRSSVSGIVATVFGATGFLGRY+VQ+LAKMG+QVLVPFRGSED  RHLKLMGDLGQIVPM
Sbjct  57   GRSSVSGIVATVFGATGFLGRYVVQELAKMGTQVLVPFRGSEDSPRHLKLMGDLGQIVPM  116

Query  404  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  583
            KYNPRDE+SVKAV+AKANVVINLIGREYETRNYSFEEVNH+MAEQLA I+KEHGGIMRFI
Sbjct  117  KYNPRDENSVKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEQLAMIAKEHGGIMRFI  176

Query  584  QVSCLGASPTSPSRM  628
            QVSCLG SPTSPSRM
Sbjct  177  QVSCLGVSPTSPSRM  191



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR 
Sbjct  180  VSCLGASSSSPSRF  193



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 169/194 (87%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA  RR G ++L+ S ++S  KS + L S   G+D PRY ST+ A KG GHL+RKGTGG
Sbjct  2    MQAGWRRSGRRFLEQSPALSTLKSIYPLSSSECGVDRPRYGSTV-AVKGTGHLIRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+V QLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIVATVFGATGFLGRYVVSQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AK+NVV NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRF+Q
Sbjct  121  YNPRDENSIKAVMAKSNVVFNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFVQ  180

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSRM
Sbjct  181  VSCLGASSSSPSRM  194



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   286 bits (733),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 169/194 (87%), Gaps = 6/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSD-HYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQ+++RRL HQ    S + S+ KS   LSD  YG+D  RY STL A+KGV HL RKGTGG
Sbjct  1    MQSISRRLSHQ----SFNFSSLKSLYALSDPRYGVDHSRYGSTL-ATKGVAHLARKGTGG  55

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  56   RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMK  115

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH+MAE LA I+KEHGGIMRFIQ
Sbjct  116  YDPRDECSIKAVMAKANVVINLIGREYETRNYSFEEVNHHMAEHLAMIAKEHGGIMRFIQ  175

Query  587  VSCLGASPTSPSRM  628
            VSCLGASPTS SRM
Sbjct  176  VSCLGASPTSASRM  189



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 4/193 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRR GH+YL  S S S+ KS    SDHY G + P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRAGHRYL--SPSSSSLKSIYPTSDHYYGAERPKYGSTL-ATKGVGHLVRKGTGG  57

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  58   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  117

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDESS+KAV+AKANVVINLIGREYETRN+SFEEVNH MAEQLA ISKEHGGIMRFIQ
Sbjct  118  YNPRDESSIKAVMAKANVVINLIGREYETRNFSFEEVNHSMAEQLAMISKEHGGIMRFIQ  177

Query  587  VSCLGASPTSPSR  625
            VSCLGASP+S SR
Sbjct  178  VSCLGASPSSESR  190



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 173/195 (89%), Gaps = 2/195 (1%)
 Frame = +2

Query  47   TMQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTG  223
             MQA ++R+G QYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTG
Sbjct  38   AMQAASKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTG  96

Query  224  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  403
            GRSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM
Sbjct  97   GRSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPM  156

Query  404  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  583
            KYNPRDE S+KAV++KANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFI
Sbjct  157  KYNPRDEDSIKAVMSKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFI  216

Query  584  QVSCLGASPTSPSRM  628
            QVSCLGAS +SPSR 
Sbjct  217  QVSCLGASSSSPSRF  231



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 175/194 (90%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGH+ LK S   +  KS   +SDHY G++  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRLGHESLKSS---TLLKSSYPISDHYYGVNHERYVSTI-ATKGVGHLVRKGTGG  56

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVPMK  116

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            +NPRDESSVKAV+A+ANVVINLIGR+YETRN+S+EEV+++MAE+LA ISKEHGGIMRFIQ
Sbjct  117  FNPRDESSVKAVMARANVVINLIGRDYETRNFSYEEVHYHMAEKLAKISKEHGGIMRFIQ  176

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+S SRM
Sbjct  177  VSCLGASPSSSSRM  190



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV++R+G QYL  S S+S+ KS   LSDHY G D P+  STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGRQYLTQSSSISSLKSIYPLSDHYYGADRPKCGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPSR 
Sbjct  180  VSCLGASSSSPSRF  193



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKS-FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA  RR G +    S +   FKS + L SD YG+D  R+ ST++  KG GHLVRKGTGG
Sbjct  1    MQACWRRSGQRLHDHSPAPFLFKSIYPLSSDGYGLDHLRHVSTISV-KGTGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM 
Sbjct  60   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMN  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE+S+KAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMRFIQ
Sbjct  120  YNPRDENSIKAVMAKANVVLNLIGREYETRNYSFEEVNHAMAEQLAVIAKEHGGIMRFIQ  179

Query  587  VSCLGASPTSPSRM  628
            VSCLGASP+SPSRM
Sbjct  180  VSCLGASPSSPSRM  193



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKP-SHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGT  220
            M A+TR+LGHQ LK  S ++S+FKS   LSD  +YG  TPRYAS L A+ GVG L+RKGT
Sbjct  1    MHAITRKLGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNL-ATGGVGPLIRKGT  59

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVP  119

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            MKYNPRDE+SVKAV+AKANVVINLIGR+YETRNYSF+EVN +MAEQLA I+KEHGGIMRF
Sbjct  120  MKYNPRDENSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHMAEQLAMIAKEHGGIMRF  179

Query  581  IQVSCLGASPTSPSRM  628
            IQVS LGASP S SR+
Sbjct  180  IQVSSLGASPASSSRL  195



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKP-SHSVSAFKSFDLLSD--HYGIDTPRYASTLTASKGVGHLVRKGT  220
            MQA+TR+LGHQ LK  S ++S+FKS   LSD  +YG  TPRYAS L A+ G G L+RKGT
Sbjct  1    MQAITRKLGHQSLKHHSPAISSFKSLYPLSDDHYYGYLTPRYASNL-ATGGAGPLIRKGT  59

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQIVP  119

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            MKYNPRDE+SVKAV+AKANVVINLIGR+YETRNYSF+EVN ++AEQLA I+KEHGGIMRF
Sbjct  120  MKYNPRDENSVKAVMAKANVVINLIGRDYETRNYSFDEVNLHIAEQLAMIAKEHGGIMRF  179

Query  581  IQVSCLGASPTSPSRM  628
            IQVS LGASP S SR+
Sbjct  180  IQVSSLGASPASSSRL  195



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQAV++R+GHQYL  S S+S+ KS   LSDHY G D P+Y STL A+KGVGHLVRKGTGG
Sbjct  1    MQAVSKRVGHQYLTQSSSISSLKSIYPLSDHYYGADRPKYGSTL-ATKGVGHLVRKGTGG  59

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVA VFG+TGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPMK
Sbjct  60   RSSVSGIVAAVFGSTGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPMK  119

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDE S+KAV+AKANVVINLIGR++ETRN+SFEEVNH MA+QLA ISKEHGGIMRFIQ
Sbjct  120  YNPRDEDSIKAVMAKANVVINLIGRDFETRNFSFEEVNHSMAQQLATISKEHGGIMRFIQ  179

Query  587  VSCLGA  604
            VSCLGA
Sbjct  180  VSCLGA  185



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 168/194 (87%), Gaps = 7/194 (4%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA++RRLGHQ      SV + KS   L +HY G D  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAISRRLGHQ-----SSVHSLKSVYPLCNHYYGADDGRYVSTV-ATKGVGHLVRKGTGG  54

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFR SED HRHLKLMGDLGQIVPM+
Sbjct  55   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRCSEDSHRHLKLMGDLGQIVPMQ  114

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            +NPRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAE LA I+KEHGGIMR+IQ
Sbjct  115  FNPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNHSMAEVLANIAKEHGGIMRYIQ  174

Query  587  VSCLGASPTSPSRM  628
            VSCLGAS +SPS+ 
Sbjct  175  VSCLGASSSSPSKF  188



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSD+Y G D  R+ +T  A+ G GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLQPATSISSLKSVYPLSDYYNGADHRRFGTTSIATPGTGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            +NPRD++++KA +AKANVVINLIGREYETRNYSFE+VNH+MAE++A I+KEHGGIMRFIQ
Sbjct  121  FNPRDDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQ  180

Query  587  VSCLGA  604
            +SCLGA
Sbjct  181  ISCLGA  186



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 3/193 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGR  229
            MQ  +RRLGH  ++PS+ +S+ +S  L  DH  +D  RY S++ A KG G+LVRKGTGGR
Sbjct  2    MQVSSRRLGH-IIRPSNGLSSLQSLYLHPDHR-VDHARYGSSV-ALKGSGYLVRKGTGGR  58

Query  230  SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKY  409
            SSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED HRHLKLMGDLGQIVPMKY
Sbjct  59   SSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMKY  118

Query  410  NPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
            +PRDE S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQL+ I+KEHGGIMRFIQV
Sbjct  119  DPRDEGSIKAVMAKANVVINLIGREYETRNYSFEEVNHVMAEQLSMIAKEHGGIMRFIQV  178

Query  590  SCLGASPTSPSRM  628
            SCLGAS +SPSRM
Sbjct  179  SCLGASSSSPSRM  191



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY--GIDTPRYASTLTASKGVGHLVRKGTG  223
            MQ+++RRLGH+ +    S++  KS   LS HY  G D  RY STLT  KGV HLVRKGTG
Sbjct  1    MQSISRRLGHKVVNSDGSIACLKSIYPLSHHYNGGGDQSRYVSTLT-PKGVAHLVRKGTG  59

Query  224  GRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPM  403
            GRSSVSGIVATVFGATGFLGRY+VQ+LAKMGSQVLVPFRGSED HRHLKLMGDLGQIVPM
Sbjct  60   GRSSVSGIVATVFGATGFLGRYVVQRLAKMGSQVLVPFRGSEDSHRHLKLMGDLGQIVPM  119

Query  404  KYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFI  583
            KYNPRDE+S+KAV+AKANVVINLIGREYETRNYSFEEVNH MAEQLA I+KEHGGIMR+I
Sbjct  120  KYNPRDEASIKAVMAKANVVINLIGREYETRNYSFEEVNHGMAEQLAMIAKEHGGIMRYI  179

Query  584  QVSCLGASPTSPSRM  628
            QVSCLG+S +SPSRM
Sbjct  180  QVSCLGSSSSSPSRM  194



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 168/197 (85%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL H+       +       LL    DHY GID  RY+S+L A+KG+GHL RKG
Sbjct  1    MQAVSRRLAHRPFAGGAQIYPSSYLKLLYEVPDHYHGIDDRRYSSSL-ATKGMGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGDLGQIV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK+NPRDE S+KAV+AKANVVINLIGR+YETRN+SFEEVNH+M+E+LA ++KEHGGIMR
Sbjct  120  PMKFNPRDEDSIKAVMAKANVVINLIGRDYETRNFSFEEVNHHMSEKLAMLAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGA+ TSPSRM
Sbjct  180  FIQVSCLGAAATSPSRM  196



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 170/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLK---PSHSVSAFKSF-DLLSDHYGIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL ++ L    P +S S   S  +  S H+G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLAYRPLAGGAPIYSSSYLNSICEGSSHHHGKDNRRYSSSL-AAKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIV
Sbjct  60   TGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGDLGQIV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK+NPRDE S+KAV+AKANVVINL GREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFNPRDEDSIKAVMAKANVVINLTGREYETRNFSFEEVNHHMAEKLALLAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPS+M
Sbjct  180  FIQVSCLGASASSPSKM  196



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 155/167 (93%), Gaps = 2/167 (1%)
 Frame = +2

Query  131  LSDHY-GIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLA  307
            LS HY G D PRY STL A++GVGHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLA
Sbjct  31   LSHHYCGADRPRYDSTL-ATRGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLA  89

Query  308  KMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREY  487
            KMGSQVLVPFRGSED  RHLK+MGDLGQIVPMKYNPRDESSVKAV+AKANVV+NLIGREY
Sbjct  90   KMGSQVLVPFRGSEDSPRHLKIMGDLGQIVPMKYNPRDESSVKAVMAKANVVLNLIGREY  149

Query  488  ETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            ETRNYSFEEVNH MAEQLA I+KEHGGI+RFIQVSCLGAS +SPSR 
Sbjct  150  ETRNYSFEEVNHSMAEQLATIAKEHGGILRFIQVSCLGASSSSPSRF  196



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 171/196 (87%), Gaps = 4/196 (2%)
 Frame = +2

Query  50   MQAVTRRL--GHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGT  220
            MQA++RRL    Q L  S S+S+ K    LS HY G D PRY STL A++GVGHLVRKGT
Sbjct  1    MQALSRRLVQQQQSLSSSSSISSIKFIYPLSHHYCGADRPRYDSTL-ATRGVGHLVRKGT  59

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQVLVPFRGSED  RHLK+MGDLGQIVP
Sbjct  60   GGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQVLVPFRGSEDSPRHLKIMGDLGQIVP  119

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            MKYNPRDE+SVKAV+AKANVV+NLIGREYETRNYSFEEVNH MAEQLA I+KEHGGI+RF
Sbjct  120  MKYNPRDENSVKAVMAKANVVLNLIGREYETRNYSFEEVNHSMAEQLATIAKEHGGILRF  179

Query  581  IQVSCLGASPTSPSRM  628
            IQVSCLGAS +SPSR 
Sbjct  180  IQVSCLGASSSSPSRF  195



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 4/197 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ ++ S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSYSSLRSLYGVSNHLNGTDNRRYASSLAKKGGVGHLARKG  60

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  181  YIQVSCLGASMSSPSRM  197



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 169/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S   L   SDH  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLSGGASIYSSSSPRSLHGVSDHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  180  FIQVSCLGASVSSPSRM  196



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 170/198 (86%), Gaps = 6/198 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY--GIDTPRYASTLTASKGVGHLVRK  214
            MQAV+RRL  + L    S+ +  S   L   SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSIRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQVSCLGAS +SPSRM
Sbjct  180  RFIQVSCLGASLSSPSRM  197



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 169/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S   L   SDH  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLSGGASIYSSSSPRSLHGVSDHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  180  FIQVSCLGASVSSPSRM  196



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 170/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S   L   SDH+ G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLIQRPLAGGASIYSSSSLRSLHGVSDHFNGNDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SF+EVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFKEVNHHMAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  180  FIQVSCLGASVSSPSRM  196



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +2

Query  182  ASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHR  361
            A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMG+QVLVPFRGSEDCHR
Sbjct  7    AVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGTQVLVPFRGSEDCHR  66

Query  362  HLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQL  541
            HLKLMGDLGQIVPMKYNPRD +S+KAV+AK+NVVINLIGREYETRNY FEEVNH+MAEQL
Sbjct  67   HLKLMGDLGQIVPMKYNPRDVNSIKAVMAKSNVVINLIGREYETRNYGFEEVNHHMAEQL  126

Query  542  AAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            A ISKEHGGIMRFIQVSCLGAS +SPSRM
Sbjct  127  AMISKEHGGIMRFIQVSCLGASASSPSRM  155



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 172/198 (87%), Gaps = 6/198 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYL---KPSHSVSAFKSFDLLSDHY--GIDTPRYASTLTASKGVGHLVRK  214
            MQAV+RRL  + L      +S S+ +S   +SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSLRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQVSCLGAS +SPSRM
Sbjct  180  RFIQVSCLGASLSSPSRM  197



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 172/198 (87%), Gaps = 6/198 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYL---KPSHSVSAFKSFDLLSDHY--GIDTPRYASTLTASKGVGHLVRK  214
            MQAV+RRL  + L      +S S+ +S   +SDH+  G D  RY+S+L A+KGVGHL RK
Sbjct  1    MQAVSRRLVQRPLGGGASIYSSSSLRSLYGVSDHHLNGADNRRYSSSL-ATKGVGHLARK  59

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+
Sbjct  60   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQV  119

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIM
Sbjct  120  VPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIM  179

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQVSCLGAS +SPSRM
Sbjct  180  RFIQVSCLGASLSSPSRM  197



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 169/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQA++R+L  + L    S+ +  S   L   SDH  G D+ RY+S+L A+KGVGHL RKG
Sbjct  1    MQALSRKLVQRPLAGGASIYSSSSIRSLYGVSDHLNGTDSRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEE NH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEANHHMAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  180  FIQVSCLGASVSSPSRM  196



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 169/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S      +S+H  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAEGASIYSSSSLRSLYGVSNHLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH++AE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHIAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  180  YIQVSCLGASMSSPSRM  196



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 146/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  322
            G D  RY S    A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQ
Sbjct  42   GADGARYMSARAPAVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQ  101

Query  323  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  502
            VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNY  161

Query  503  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM
Sbjct  162  GFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRM  203



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = +2

Query  146  GIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  325
            G D  RY+S+L A+KGVGHL RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV
Sbjct  38   GSDNRRYSSSL-ATKGVGHLARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQV  96

Query  326  LVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYS  505
            LVPFRGSED  RHLKLMGDLGQ+VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+S
Sbjct  97   LVPFRGSEDNPRHLKLMGDLGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFS  156

Query  506  FEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            FEEVNH+MAE+LA ++KEHGGIMRFIQVSCLGAS TSPSRM
Sbjct  157  FEEVNHHMAEKLALVAKEHGGIMRFIQVSCLGASVTSPSRM  197



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 168/197 (85%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S      + D+  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGETSIYSSSSLRSLYGVPDYLNGSDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  180  FIQVSCLGASVSSPSRM  196



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 168/197 (85%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQA +RRL  + L    S+ +  S      +SD+  G D  RY+S+L A+KGVGHL RKG
Sbjct  2    MQAASRRLVQRPLAGETSIYSSSSLRSLYGVSDYLNGSDNRRYSSSL-ATKGVGHLARKG  60

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQVV  120

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHHMAEKLALVAKEHGGIMR  180

Query  578  FIQVSCLGASPTSPSRM  628
            FIQVSCLGAS +SPSRM
Sbjct  181  FIQVSCLGASVSSPSRM  197



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 166/197 (84%), Gaps = 4/197 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSSSSLRSLYGVSNHLNGTDNRRYASSLANKWGVGHLARKG  60

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  181  YIQVSCLGASMSSPSRM  197



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 166/197 (84%), Gaps = 4/197 (2%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLL---SDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQAV+RRL  + L    S+ +  S   L   S+H  G D  RYAS+L    GVGHL RKG
Sbjct  1    MQAVSRRLVQRPLAGGASICSSSSLRSLYGFSNHLNGTDNRRYASSLANKGGVGHLARKG  60

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  61   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  120

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH++AE+LA ++KEHGGIMR
Sbjct  121  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHIAEKLALVAKEHGGIMR  180

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  181  YIQVSCLGASMSSPSRM  197



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 13/202 (6%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDL--------LSDHY-GIDTPRYASTLTASKGVGH  202
            MQAV+RRL     +PS +  A              +SDH  G D  RY+S+L A+KGVGH
Sbjct  1    MQAVSRRLLQ---RPSLNGGASIYSSSSLRSPLYGVSDHLNGTDNRRYSSSL-ATKGVGH  56

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGD
Sbjct  57   LARKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDDPRHLKLMGD  116

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ+VPMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+VNH+MAE+LA ++KEH
Sbjct  117  LGQVVPMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDVNHHMAEKLALVAKEH  176

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
            GGIMR+IQVSCLGAS +SPSRM
Sbjct  177  GGIMRYIQVSCLGASVSSPSRM  198



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 145/162 (90%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  322
            G D  RY S    A KG GHLVRKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQ
Sbjct  42   GADGARYMSARAPAVKGTGHLVRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKMGSQ  101

Query  323  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  502
            VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYETRNY  161

Query  503  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             F+EVNH+MAEQLA ISKEHGGIMRFI VS LGAS +SPSRM
Sbjct  162  GFDEVNHHMAEQLAMISKEHGGIMRFIHVSSLGASASSPSRM  203



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 165/203 (81%), Gaps = 10/203 (5%)
 Frame = +2

Query  50   MQAVT--RRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYASTLTAS--KGVG  199
            MQA    R L   +L PS S  ++AF+S     L+     G D  RY S+  A   KG G
Sbjct  1    MQAAAWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLCGADGARYMSSARAPAVKGSG  60

Query  200  HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  379
            HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED HRHLK+MG
Sbjct  61   HLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSHRHLKIMG  120

Query  380  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  559
            DLGQIVPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+MAEQLA I+KE
Sbjct  121  DLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMAEQLATIAKE  180

Query  560  HGGIMRFIQVSCLGASPTSPSRM  628
            HGGIMRFIQVSCLGASP+S SR+
Sbjct  181  HGGIMRFIQVSCLGASPSSESRL  203



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 5/194 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ LK S S+ +      +SDHY G+D  RY ST+ A+KGVGHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLKSSTSLKSIYP---ISDHYYGVDHERYVSTV-ATKGVGHLVRKGTGG  56

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ+LVPFRGSEDC RHLKLMGDLGQ+VPMK
Sbjct  57   RSSVSGIVATVFGATGFLGRYVVQQLAKMGSQILVPFRGSEDCPRHLKLMGDLGQVVPMK  116

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            YNPRDESSVKAV+A+ANVVINL+GR+YETRNYSFEEV+++MAE+ A I+KEHGGIMRFIQ
Sbjct  117  YNPRDESSVKAVMARANVVINLLGRDYETRNYSFEEVHYHMAEKFAKIAKEHGGIMRFIQ  176

Query  587  VSCLGASPTSPSRM  628
            VS LGASP+S SRM
Sbjct  177  VSSLGASPSSSSRM  190



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 168/197 (85%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDL---LSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQA++RRL  + L    S+ +  S      +S+H  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQALSRRLVQRPLTGEASIYSSSSLRSLYGVSNHLNGTDNRRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+ NH++AE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  180  YIQVSCLGASASSPSRM  196



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 169/197 (86%), Gaps = 5/197 (3%)
 Frame = +2

Query  50   MQAVTRRLGHQYL---KPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKG  217
            MQ V+RRL  + L      +S S+ +S   +S+H  G D  RY+S+L A+KGVGHL RKG
Sbjct  1    MQVVSRRLVQRPLVGGASIYSSSSLRSLYGVSNHLNGTDNCRYSSSL-ATKGVGHLARKG  59

Query  218  TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIV  397
            TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+V
Sbjct  60   TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVV  119

Query  398  PMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMR  577
            PMK++PRDE S+KAV+AKANVVINLIGREYETRN+SFE+ NH++AE+LA ++KEHGGIMR
Sbjct  120  PMKFDPRDEDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMR  179

Query  578  FIQVSCLGASPTSPSRM  628
            +IQVSCLGAS +SPSRM
Sbjct  180  YIQVSCLGASVSSPSRM  196



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  170  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  349
            S+  A+KGVGHL+RKGTGGRSSVSGI+ATVFGATGFLGRYLVQQLAK GSQVLVPFRGSE
Sbjct  2    SSNLATKGVGHLIRKGTGGRSSVSGIIATVFGATGFLGRYLVQQLAKNGSQVLVPFRGSE  61

Query  350  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  529
            D  RHLKLMGDLGQIVPMKYNPRDE S+KAV+AKANVVINLIGREYETRN+SFEEVNH M
Sbjct  62   DSSRHLKLMGDLGQIVPMKYNPRDEDSIKAVMAKANVVINLIGREYETRNFSFEEVNHRM  121

Query  530  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            AEQLAAI++EHGGIMRFIQVSCLGAS  S SRM
Sbjct  122  AEQLAAIAREHGGIMRFIQVSCLGASLASQSRM  154



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 162/199 (81%), Gaps = 8/199 (4%)
 Frame = +2

Query  56   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYASTLTAS--KGVGHLVR  211
            A  R L   +L PS S  ++AF+S     L+     G D  R  S+  A   +G G+LVR
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLTPQGLCGADGARCMSSARAPAVEGSGYLVR  64

Query  212  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  391
            KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED HRHLK+MGDLGQ
Sbjct  65   KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSHRHLKIMGDLGQ  124

Query  392  IVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGI  571
            IVPMKYNPRD  S+KAV+AK+NVV+NLIGREYETRNYSFEEVNH+MA QLA I+KEHGGI
Sbjct  125  IVPMKYNPRDVDSIKAVMAKSNVVVNLIGREYETRNYSFEEVNHHMAGQLAMIAKEHGGI  184

Query  572  MRFIQVSCLGASPTSPSRM  628
            MRFIQVSCLGASP+S S+M
Sbjct  185  MRFIQVSCLGASPSSESKM  203



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 160/198 (81%), Gaps = 7/198 (4%)
 Frame = +2

Query  56   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGVGHLVRK  214
            A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG GHLVRK
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGSGHLVRK  64

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+MGDLGQI
Sbjct  65   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIMGDLGQI  124

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+KEHGGI+
Sbjct  125  VPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAKEHGGII  184

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQVSCLGASP+S SRM
Sbjct  185  RFIQVSCLGASPSSESRM  202



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 160/198 (81%), Gaps = 7/198 (4%)
 Frame = +2

Query  56   AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGVGHLVRK  214
            A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG GHLVRK
Sbjct  5    AWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGSGHLVRK  64

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+MGDLGQI
Sbjct  65   GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIMGDLGQI  124

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+KEHGGI+
Sbjct  125  VPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAKEHGGII  184

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQVSCLGASP+S SRM
Sbjct  185  RFIQVSCLGASPSSESRM  202



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 163/204 (80%), Gaps = 9/204 (4%)
 Frame = +2

Query  44   GTMQ--AVTRRLGHQYLKPSHS--VSAFKSFDL--LSDH--YGIDTPRYAST-LTASKGV  196
             TMQ  A  R L   +L PS S  ++AF+S     L+    +G D  R  S    A KG 
Sbjct  52   ATMQSAAWRRHLLDHHLSPSTSAAIAAFRSASQPGLAPQGLFGADGARCMSARAPAVKGS  111

Query  197  GHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  376
            GHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG ED  RHLK+M
Sbjct  112  GHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGCEDSPRHLKIM  171

Query  377  GDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISK  556
            GDLGQIVPMKY+PRD  S+KAV+AK+NVVINLIGREYETRNYSFEEVNH+M EQLA I+K
Sbjct  172  GDLGQIVPMKYHPRDVDSIKAVMAKSNVVINLIGREYETRNYSFEEVNHHMPEQLATIAK  231

Query  557  EHGGIMRFIQVSCLGASPTSPSRM  628
            EHGGI+RFIQVSCLGASP+S SRM
Sbjct  232  EHGGIIRFIQVSCLGASPSSESRM  255



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  GIDTPRYAST-LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  322
            G D  RY S    A KG GHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  43   GADGARYMSARAPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  102

Query  323  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  502
            VLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYETRNY
Sbjct  103  VLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYETRNY  162

Query  503  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+
Sbjct  163  GFEEVNHQMAEQLAMISKEHGGIVRFIQVSALGASASSPSRL  204



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  134  SDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKM  313
            S  Y  D  R AS+LT  KG+GHL+RKGTGGRSSVSGI+ATVFGATGFLGRY+VQQLAK 
Sbjct  33   SSEYKFDHSRSASSLT-DKGIGHLIRKGTGGRSSVSGIIATVFGATGFLGRYVVQQLAKT  91

Query  314  GSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYET  493
            GSQVLVPFRGSED  RHLKLMGDLGQIVPMKYNPRDESS+KAV+AK+NVVINLIGREYET
Sbjct  92   GSQVLVPFRGSEDSPRHLKLMGDLGQIVPMKYNPRDESSIKAVMAKSNVVINLIGREYET  151

Query  494  RNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            RN+SFEEVN  ++E LA I+KEHGGI+RFIQ+SCLGAS +SPS+M
Sbjct  152  RNFSFEEVNVDISEHLAKIAKEHGGIVRFIQLSCLGASSSSPSKM  196



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 144/193 (75%), Gaps = 31/193 (16%)
 Frame = +2

Query  50   MQAVTRRLGHQYLKPSHSVSAFKSFDLLSDHY-GIDTPRYASTLTASKGVGHLVRKGTGG  226
            MQA+TRRLGHQ L+P+ S+S+ KS   LSDHY G D PRY STL + KG+GHLVRKGTGG
Sbjct  1    MQAITRRLGHQSLRPTASISSIKSICALSDHYYGGDHPRYGSTLASHKGMGHLVRKGTGG  60

Query  227  RSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMK  406
            RSSVSGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMK
Sbjct  61   RSSVSGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMK  120

Query  407  YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQ  586
            Y+PRDE+S                            +   MA+  A I+KEHGGIMRFIQ
Sbjct  121  YDPRDENS----------------------------IKAVMAK--ANIAKEHGGIMRFIQ  150

Query  587  VSCLGASPTSPSR  625
            VSCLG+S TSPSR
Sbjct  151  VSCLGSSLTSPSR  163



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  146  GIDTPRYASTLT-ASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  322
            G+D  RY S  T A KG GHLVRKGTGGRSSVSGIVATVFGATGFLGRY+VQQLAKMGSQ
Sbjct  42   GVDGARYMSARTPAVKGAGHLVRKGTGGRSSVSGIVATVFGATGFLGRYVVQQLAKMGSQ  101

Query  323  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  502
            VLVPFRG ED HRHLKLMGDLGQIVPMKYNPRD  S+K  VAK+NVVINLIGREYETRNY
Sbjct  102  VLVPFRGCEDSHRHLKLMGDLGQIVPMKYNPRDVDSIKTAVAKSNVVINLIGREYETRNY  161

Query  503  SFEEVNHYMAEQLAAISKEHGGIMRFIQV  589
             FEEVNH+MAEQLA ISKEHGGI+RFIQV
Sbjct  162  GFEEVNHHMAEQLAMISKEHGGIVRFIQV  190



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  239  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  418
            SGI+ATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PR
Sbjct  10   SGIIATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPR  69

Query  419  DESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCL  598
            DE+S+KAV+AKANVVINLIGREYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQVSCL
Sbjct  70   DENSIKAVMAKANVVINLIGREYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCL  129

Query  599  GASPTSPSR  625
            G+S +SPSR
Sbjct  130  GSSLSSPSR  138



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  242  GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  421
            GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  RHLKLMGDLGQ+VPMK++PRD
Sbjct  1    GIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRD  60

Query  422  ESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLG  601
            E S+KAV+AKANVVINLIGREYETRN+SFE+ NH++AE+LA ++KEHGGIMR+IQVSCLG
Sbjct  61   EDSIKAVMAKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLG  120

Query  602  ASPTSPSRM  628
            AS +SPSRM
Sbjct  121  ASVSSPSRM  129



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  239  SGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPR  418
            SGI+ATVFG TGFLGRY+VQQLAKMGSQVLVPFRG ED  RHLKLMGDLGQIVPMK+NPR
Sbjct  6    SGIIATVFGTTGFLGRYVVQQLAKMGSQVLVPFRGCEDDPRHLKLMGDLGQIVPMKFNPR  65

Query  419  DESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCL  598
            D++++KA +AKANVVINLIGREYETRNYSFE+VNH+MAE++A I+KEHGGIMRFIQ+SCL
Sbjct  66   DDNTIKATMAKANVVINLIGREYETRNYSFEDVNHFMAERIAGIAKEHGGIMRFIQISCL  125

Query  599  GA  604
            GA
Sbjct  126  GA  127



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = +2

Query  122  FDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQ  301
            FDL    +G    R +S+L  S G    V++GTGGRSSVSG+VATVFGATGFLGRY+VQQ
Sbjct  37   FDL---GFGSGRVRESSSLAVS-GSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVVQQ  92

Query  302  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGR  481
            LA+MGSQV+VP+RG ++  RHLKLMGDLGQIVP+KY+ RDE S+KA +A +NV++N IG+
Sbjct  93   LARMGSQVMVPYRGLDEEWRHLKLMGDLGQIVPIKYDARDEDSIKAAIANSNVIVNCIGK  152

Query  482  EYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            EYETRN+SF++VN+ ++ +++ ++KEHGGI++++Q+SCL A P SPSR+
Sbjct  153  EYETRNFSFDDVNYGISNRISKLAKEHGGILKYVQMSCLAADPHSPSRL  201



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   186 bits (472),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = +2

Query  305  AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGRE  484
            AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGRE
Sbjct  39   AKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGRE  98

Query  485  YETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            YETRNY F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM
Sbjct  99   YETRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRM  146



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  490
            MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRD  S+KAV+AK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYE  60

Query  491  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            TRNY F+EVNH+MAEQLA ISKEHGGIMRFIQVS LGAS +SPSRM
Sbjct  61   TRNYGFDEVNHHMAEQLAMISKEHGGIMRFIQVSSLGASASSPSRM  106



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +2

Query  302  LAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGR  481
            ++KMGSQVLVPFRGSED  RHLKLMGDLGQIVPMKY+PRDE+S+KAV+AKANVVINLIGR
Sbjct  42   MSKMGSQVLVPFRGSEDNPRHLKLMGDLGQIVPMKYDPRDENSIKAVMAKANVVINLIGR  101

Query  482  EYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            EYETRN+SFEEVNH+MAEQLA I+KEHGGIMRFIQVSCLG+S +SPSR
Sbjct  102  EYETRNFSFEEVNHFMAEQLAVIAKEHGGIMRFIQVSCLGSSLSSPSR  149



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/106 (87%), Positives = 101/106 (95%), Gaps = 1/106 (1%)
 Frame = +2

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQ-IVPMKYNPRDESSvkavvakanvvINLIGREY  487
            MGSQVLVPFRGSED  RHLKLMGDLGQ IVPMKY+PRDE+S+KAV+AKANVVINLIGREY
Sbjct  1    MGSQVLVPFRGSEDNPRHLKLMGDLGQQIVPMKYDPRDENSIKAVMAKANVVINLIGREY  60

Query  488  ETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            ETRNYSFEEVNH+MAEQLA I++EHGGIMRFIQVSCLG+SP+S SR
Sbjct  61   ETRNYSFEEVNHFMAEQLAVIAREHGGIMRFIQVSCLGSSPSSASR  106



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  490
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  491  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            TRNY FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSALGASASSPSRL  106



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  490
            MGSQVLVPFRG ED HRHLKLMGDLGQIVPM YNPRD +S+K  VAK+NVVINLIGREYE
Sbjct  1    MGSQVLVPFRGCEDSHRHLKLMGDLGQIVPMNYNPRDVNSIKTAVAKSNVVINLIGREYE  60

Query  491  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            TRNY FEEVNH MAEQLA ISKEHGGI+RFIQVS LGAS +SPSR+
Sbjct  61   TRNYGFEEVNHQMAEQLAMISKEHGGIVRFIQVSSLGASASSPSRL  106



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +2

Query  161  RYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFR  340
            R+A  L A++G   LV K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+R
Sbjct  1    RHAFNL-ATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYR  59

Query  341  GSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVN  520
            G ED  RHLK+MGDLGQIVP   N RDE +++A +AK+NVVINLIG+EYETRNY FEEVN
Sbjct  60   GLEDKPRHLKVMGDLGQIVPFVCNIRDEDAIRAAIAKSNVVINLIGQEYETRNYGFEEVN  119

Query  521  HYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
              +A+++A ISKEHGGI+R+I  SC+GA   SPS+
Sbjct  120  IDIAQRIARISKEHGGIVRYIHTSCVGADENSPSK  154



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 125/162 (77%), Gaps = 12/162 (7%)
 Frame = +2

Query  143  YGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQ  322
            +G    R++S+L  S G    V++GTGGRSSVSG+VATVFGATGFLGRY++QQLA+MGSQ
Sbjct  40   FGNAAVRHSSSLAVS-GSHRPVKRGTGGRSSVSGVVATVFGATGFLGRYVIQQLARMGSQ  98

Query  323  VLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNY  502
            V+             +  G LGQIVP+KY+ RDE S+K V+A +NV++N IG+EYETRN+
Sbjct  99   VMA-----------FEAHGRLGQIVPIKYDARDEGSIKPVIANSNVIVNCIGKEYETRNF  147

Query  503  SFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            SFE+VNH ++ +++ +++EHGGI++++Q+SCL A+P SPSR+
Sbjct  148  SFEDVNHGISNRISKLAREHGGILKYVQMSCLAAAPDSPSRL  189



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +2

Query  161  RYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFR  340
            R+A  L A++G   LV K  GG S+ +G + T+FG+TG LGR +V  LAK+G+Q ++P+R
Sbjct  10   RHAFNL-ATRGGTPLVVKTAGGLSAATGFIVTIFGSTGMLGRAVVNNLAKIGAQCMIPYR  68

Query  341  GSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVN  520
            G ED  RHLK+MGDLGQIVP   N RD+ +++A +AK+NVVINLIG+EYETRNY FEEVN
Sbjct  69   GLEDKPRHLKVMGDLGQIVPFVCNIRDDDAIRAAIAKSNVVINLIGQEYETRNYGFEEVN  128

Query  521  HYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
              +A+++A ISKEHGGI+R+I  SC+GA   SPS+
Sbjct  129  IDIAQRIARISKEHGGIVRYIHTSCVGADENSPSK  163



>ref|XP_004339653.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR17640.1| NADH dehydrogenase, putative [Acanthamoeba castellanii str. Neff]
Length=376

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +2

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSG+VATVFG TGFLGR++V +L K+GSQV+VP+RG E   RHLK+MGDLGQI P
Sbjct  37   GGRSSVSGVVATVFGCTGFLGRFVVNRLGKIGSQVIVPYRGEESAFRHLKVMGDLGQIAP  96

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            + ++ RD+ +V+  V  +NVVINL+G+ +ETRN+SF++V+      +A  +KE  G+ RF
Sbjct  97   VWFDLRDKETVRRAVQYSNVVINLLGKRWETRNFSFDDVHPEATRTIAEAAKE-AGVERF  155

Query  581  IQVSCLGASPTSPS  622
            IQVS  GA   SPS
Sbjct  156  IQVSAAGADVNSPS  169



>dbj|GAA99675.1| hypothetical protein E5Q_06378 [Mixia osmundae IAM 14324]
 gb|KEI40362.1| hypothetical protein L969DRAFT_94166 [Mixia osmundae IAM 14324]
Length=386

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  337
            RY   LT  +  G  ++R G GGR S +G VATVFG TGFLGRYLV +LAK G+QV++P+
Sbjct  32   RYQHDLTIKQKDGRPILRSGPGGRHSFTGHVATVFGCTGFLGRYLVHKLAKKGTQVIIPY  91

Query  338  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  517
            R  ED  RHLK+MGDLGQIVPM+++ R++S ++  V  ++VV NL+GR+YET+N+ F EV
Sbjct  92   R-DEDEKRHLKVMGDLGQIVPMEWDIRNDSQIEEAVRHSDVVYNLVGRDYETKNFKFHEV  150

Query  518  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +   A ++A+I+ +  G+ R I VS L A P SPS
Sbjct  151  HIDGARRIASIA-QLAGVSRLIHVSHLNADPDSPS  184



>gb|KIJ17694.1| hypothetical protein PAXINDRAFT_167681 [Paxillus involutus ATCC 
200175]
Length=359

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +2

Query  170  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  349
            +TL   K V   V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  26   ATLPGRKAV---VSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  81

Query  350  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  529
            D  RHLKLMGDLGQIVPM+++ R+E+ +   +  +++V NL+GR+YET+N+ + +V+   
Sbjct  82   DEKRHLKLMGDLGQIVPMEWDIRNENQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTG  141

Query  530  AEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            AE++A ++ E  G+ RF+Q+S L ASP S S
Sbjct  142  AERIAKLASE-TGVQRFVQLSHLNASPDSTS  171



>ref|XP_001626712.1| predicted protein [Nematostella vectensis]
 gb|EDO34612.1| predicted protein [Nematostella vectensis]
Length=372

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 1/157 (1%)
 Frame = +2

Query  158  PRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  337
            P   + + +++ + +L +KGTGGRSS +G+ ATVFGATGFLGRY++ +L ++G+Q+ VP+
Sbjct  17   PLIGTAVVSTRKISYLPKKGTGGRSSFNGVSATVFGATGFLGRYVINRLGRVGTQLTVPY  76

Query  338  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  517
            RG E   RHL+LMGDLGQI    ++ +DE S+  +V  +NVV+NLIGR +ETRN++FEEV
Sbjct  77   RGDEHDIRHLRLMGDLGQIDFFDFHLKDEESIAKMVKHSNVVVNLIGRGFETRNFNFEEV  136

Query  518  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            +   A  +A  +KE  G+ R I VS L A+  SPS+ 
Sbjct  137  HVDGARTIAKAAKE-AGVERLIHVSALNAAVDSPSKF  172



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  209  RKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLG  388
            +KGTGGRSS SGI A VFG+TGFLGRY+V  LAK GS+VLVP R SE+  +HLK MGDLG
Sbjct  82   KKGTGGRSSYSGITAAVFGSTGFLGRYVVNHLAKNGSRVLVPTRCSENHRQHLKPMGDLG  141

Query  389  QIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGG  568
            QIV   Y+ RD+ ++K  V +ANVVIN++GRE+ETRN+SFE+V+     +LA   KE   
Sbjct  142  QIVQFDYSMRDDEAIKYAVERANVVINMVGREWETRNFSFEDVHRDFPRRLAEACKESSS  201

Query  569  IMRFIQVSCLGASPTSPSR  625
            + R I VS LGA   + S+
Sbjct  202  VKRLIHVSALGADVNAKSK  220



>gb|KIK91888.1| hypothetical protein PAXRUDRAFT_830459 [Paxillus rubicundulus 
Ve08.2h10]
Length=359

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 5/151 (3%)
 Frame = +2

Query  170  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  349
            +TL   K V   V +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  26   ATLPGRKAV---VSQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  81

Query  350  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  529
            D  RHLKLMGDLGQIVPM+++ R+E  +   +  +++V NL+GR+YET+N+ + +V+   
Sbjct  82   DEKRHLKLMGDLGQIVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKYADVHVTG  141

Query  530  AEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            AE++A ++ E  G+ RF+Q+S L ASP S S
Sbjct  142  AERIAKLASEL-GVQRFVQLSHLNASPDSTS  171



>ref|XP_001835685.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
 gb|EAU86256.1| NADH dehydrogenase [Coprinopsis cinerea okayama7#130]
Length=366

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 107/152 (70%), Gaps = 5/152 (3%)
 Frame = +2

Query  173  TLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  352
            TL + K V   V  G  G S+VSG   TVFG TGFLGRYLV +L K+G+QV+ P+R  ED
Sbjct  27   TLPSKKPV---VSYGPPGYSAVSGHTVTVFGCTGFLGRYLVSKLGKIGTQVVAPYR-DED  82

Query  353  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  532
              RHLKLMGDLGQIV M+++ RDE S+   +  ++ VINL+GR+Y T+N+ F++VN   A
Sbjct  83   ESRHLKLMGDLGQIVRMEWDLRDEKSIAECLRHSDTVINLVGRDYTTKNFDFKQVNALGA  142

Query  533  EQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            E++A I+ E+ G+ RFIQVS L AS  SPS+ 
Sbjct  143  ERIAKIAAEN-GVSRFIQVSHLNASENSPSKF  173



>gb|KIO18953.1| hypothetical protein M407DRAFT_153532 [Tulasnella calospora MUT 
4182]
Length=374

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  167  ASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            A  LT       ++  G  GRSSVSG VATVFG TGFLGRYLV +LAK G+QV+VPFR  
Sbjct  19   AQQLTVPPRSNPVISYGPAGRSSVSGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPFR-D  77

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            ED  RHLK+MGDLGQ++P+ ++ RD  ++   V  ++VV NL GREYET+N++FE+VN  
Sbjct  78   EDEKRHLKVMGDLGQVIPLMWDMRDPDTIAECVRHSDVVYNLAGREYETKNFTFEDVNVT  137

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             A+ +A +S  +  +  FI VS L A+  SPSR 
Sbjct  138  GAQLIAEVSMAN-SVSNFIHVSHLNANANSPSRF  170



>ref|XP_007872120.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
 gb|EMR11825.1| hypothetical protein PNEG_00249 [Pneumocystis murina B123]
Length=361

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L++KGT GRSS+SG +AT+FGATGFLGRYLV  LAK G+ +++P+R  +D  RHLK++GD
Sbjct  43   LIKKGTEGRSSISGHIATIFGATGFLGRYLVNNLAKQGTTIIIPWR-DQDSKRHLKVLGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQIV M+++ RDE S+K  V  +N+V NLIGR+YET+N+S+E+V+ + A ++A    E+
Sbjct  102  LGQIVMMEFDLRDEISIKESVRHSNIVYNLIGRDYETKNFSYEDVHIHGAAKIAKACVEY  161

Query  563  GGIMRFIQVSCLGASPTSPS  622
              I R I +S L A+  SPS
Sbjct  162  -NIDRLIHISTLNANIKSPS  180



>ref|XP_008574858.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Galeopterus variegatus]
Length=377

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++PFR       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPFRCERYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ +++N RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWNGRDKDSIQRAVQHSNVVINLIGREWETRNFYFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_003126608.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sus scrofa]
Length=377

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M++N +D+ S++ VV  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFMEWNGKDKDSIRKVVEHSNVVINLVGREWETKNFDFEDVFVKIPHAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I +S L A   SPSR
Sbjct  159  AGVEKLIHISHLNADIKSPSR  179



>ref|XP_005334075.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ictidomys tridecemlineatus]
Length=354

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDVMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GR++ETRN+ FE+V   + + +A ISKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGRDWETRNFDFEDVFVKIPQTIAQISKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIRSSSR  179



>ref|XP_002712902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Oryctolagus cuniculus]
Length=377

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVQHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_004006995.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ovis aries]
Length=380

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|XP_005681037.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Capra hircus]
Length=380

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRYLV  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYLVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSS SGI  TVFG+TGFLGRY+V  +AK GS++++P R SE+  +HLK+MGDLGQI
Sbjct  22   GTGGRSSFSGITCTVFGSTGFLGRYVVHHVAKSGSRMILPTRCSENDRQHLKVMGDLGQI  81

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            V + Y  RDE +++  V ++NVVIN++GRE+ETRN+SFE+VN    ++LA I  +  G+ 
Sbjct  82   VQLDYGIRDEETIRYAVERSNVVINMVGREWETRNFSFEDVNVTFPKKLAEICAD-VGVR  140

Query  575  RFIQVSCLGASPTSPS  622
            R + VS LGA    PS
Sbjct  141  RLVHVSALGAEEDHPS  156



>ref|XP_007469502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Lipotes vexillifer]
Length=377

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S S+
Sbjct  159  AGVEKFIHVSHLNADIKSSSK  179



>ref|XP_006987942.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Peromyscus maniculatus bairdii]
Length=377

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDTMHLRPMGDLGQI  103

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  IFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQVIAQLSKE-AGVE  162

Query  575  RFIQVSCLGASPTSPSR  625
            RFI VS L AS  S SR
Sbjct  163  RFIHVSHLNASMKSSSR  179



>ref|XP_009546417.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW81816.1| hypothetical protein HETIRDRAFT_475334 [Heterobasidion irregulare 
TC 32-1]
Length=347

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G  GRS+V+G VATVFG TGFLGRYLV +LAK G+QV++P+R  ED  RHLK+MGDLGQI
Sbjct  24   GPAGRSAVTGHVATVFGCTGFLGRYLVSKLAKTGTQVIIPYR-DEDEKRHLKVMGDLGQI  82

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPM+++ R+++  +  V  +++V NL+GREYET+N+S+ + N     ++A IS +  G+ 
Sbjct  83   VPMEWDLRNDNQTEECVRHSDIVYNLVGREYETKNFSYRDANALGPARIADISAK-SGVS  141

Query  575  RFIQVSCLGASPTSPSRM  628
            RF+ VS L A+  SPS+ 
Sbjct  142  RFVHVSHLNAAADSPSKF  159



>ref|XP_003390219.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Amphimedon queenslandica]
Length=367

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = +2

Query  158  PRYASTLTASK-GVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVP  334
            PR +  +  +K  +   V++GTGGRSS SG VATVFG TGF GRY+V +L ++GSQ++ P
Sbjct  15   PRTSCIIELTKKSISSDVKRGTGGRSSFSGTVATVFGCTGFCGRYIVNRLGQVGSQIVAP  74

Query  335  FRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEE  514
            +RG E  +RHL+ MGDLGQI+   +N RD  SV   +  +NVV+N IGR+YETRN+ F++
Sbjct  75   YRGDEHDYRHLRPMGDLGQILFRSFNLRDPESVTKTLEYSNVVVNAIGRDYETRNFKFDD  134

Query  515  VNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            V H    ++ A + +  G+ R I  S LGAS  SPS+ 
Sbjct  135  V-HVQGSRVIAEAAKKAGVKRLIHFSALGASKDSPSKF  171



>ref|XP_010963120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus bactrianus]
Length=377

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYIVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  575  RFIQVSCLGASPTSPSR  625
            R I VS L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  212  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  391
            +GTGGRSS+SGI +TVFG++GFLGRY+V  + K GS++++P R +E+  +HLK+MGDLGQ
Sbjct  48   RGTGGRSSISGITSTVFGSSGFLGRYVVNHIGKSGSKMILPNRCNENARQHLKVMGDLGQ  107

Query  392  IVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGI  571
            IV + ++ RD  ++K  V ++NVV+N++GRE+ETRN+SFE+V+     +LA I KE  G+
Sbjct  108  IVHLDFSIRDADAIKYAVERSNVVVNMVGREWETRNFSFEDVHVEFPAKLAEICKE-VGV  166

Query  572  MRFIQVSCLGASPTSPSR  625
             R + VS LGAS T+PS+
Sbjct  167  ERLVHVSALGASHTNPSK  184



>gb|KDN41067.1| putative NADH2 dehydrogenase 40K chain [Tilletiaria anomala UBC 
951]
Length=398

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 107/161 (66%), Gaps = 5/161 (3%)
 Frame = +2

Query  149  IDTPRYASTLTASKGVGHLVRKGT---GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGS  319
            I   R+   LT  +  G  V +     GGR+SVSG VATVFG TGFLGRYLV +LA+ G+
Sbjct  37   IQQRRFGHDLTIKRKTGKPVIEAGPYGGGRNSVSGHVATVFGCTGFLGRYLVSRLAQKGT  96

Query  320  QVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRN  499
            QV+VPFR  ED  RHLK+MGDLGQ+VPM+++ RDE  ++  +  ++ V NL GR YET+N
Sbjct  97   QVIVPFR-DEDEKRHLKIMGDLGQVVPMEWDIRDEGMIEECLRHSDTVYNLTGRAYETKN  155

Query  500  YSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +SF +VN   A ++A ++ E  G+ RFI VS L A   S S
Sbjct  156  FSFADVNRDGARRIAEVA-EASGVSRFIHVSHLNADANSES  195



>gb|ESA03096.1| hypothetical protein GLOINDRAFT_336975 [Rhizophagus irregularis 
DAOM 181602]
Length=384

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  337
            R+A  L   K  G  +++ G GGRSSVSG +ATVFG+TGFLGRYLV +LAK G+QV++P+
Sbjct  28   RFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLVSKLAKHGTQVVLPY  87

Query  338  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  517
            R  ED  RHLK+ GDLGQ+V ++++ R+E ++   V  +++V NLIGR+YET+N+++E+V
Sbjct  88   R-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLIGRDYETKNFTYEKV  146

Query  518  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            +   AE++A + K+   + R + VS L A   SPSR 
Sbjct  147  HIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRF  182



>ref|XP_006210904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vicugna pacos]
Length=376

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  103

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  104  LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  162

Query  575  RFIQVSCLGASPTSPSR  625
            R I VS L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>gb|EXX58721.1| hypothetical protein RirG_195270 [Rhizophagus irregularis DAOM 
197198w]
Length=386

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  337
            R+A  L   K  G  +++ G GGRSSVSG +ATVFG+TGFLGRYLV +LAK G+QV++P+
Sbjct  30   RFAHDLVVRKTTGKPIIKYGPGGRSSVSGHIATVFGSTGFLGRYLVSKLAKHGTQVVLPY  89

Query  338  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  517
            R  ED  RHLK+ GDLGQ+V ++++ R+E ++   V  +++V NLIGR+YET+N+++E+V
Sbjct  90   R-DEDAKRHLKVTGDLGQVVFLEFDLRNEQNIIEAVRHSDIVYNLIGRDYETKNFTYEKV  148

Query  518  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            +   AE++A + K+   + R + VS L A   SPSR 
Sbjct  149  HIEGAERIAKLCKKF-DVSRLVHVSALNADINSPSRF  184



>ref|XP_003796469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Otolemur garnettii]
Length=377

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDFMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ +++N RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWNGRDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|NP_001094222.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Rattus norvegicus]
 sp|Q5BK63.2|NDUA9_RAT RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; AltName: Full=Sperm flagella protein 3; Flags: 
Precursor [Rattus norvegicus]
 gb|EDM01826.1| rCG30092 [Rattus norvegicus]
 gb|AAI68777.1| Ndufa9 protein [Rattus norvegicus]
Length=377

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ RFI VS L AS  S ++
Sbjct  159  AGVERFIHVSHLNASMKSSAK  179



>ref|XP_006175621.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus ferus]
 ref|XP_010981110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelus dromedarius]
Length=363

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSGIVATVFGATG+LGRY+V  L +MGSQV+VP+R       HL+ MGDLGQI
Sbjct  30   GKGGRSSVSGIVATVFGATGYLGRYVVNHLGRMGSQVVVPYRCEPYDTMHLRPMGDLGQI  89

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + ++++ RD+ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + +A +SKE  G+ 
Sbjct  90   LFLEWDGRDKDSIRRAVEHSNVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-AGVE  148

Query  575  RFIQVSCLGASPTSPSR  625
            R I VS L A   SPSR
Sbjct  149  RLIHVSHLNADIKSPSR  165



>ref|XP_005365321.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Microtus ochrogaster]
Length=377

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVIIPYRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQTIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ RFI VS L A+  S SR
Sbjct  159  AGVERFIHVSHLNANMKSSSR  179



>dbj|BAK63310.1| NADH dehydrogenase [Pan troglodytes]
Length=284

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGDLGQ+
Sbjct  4    GKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCGKYDIMHLRPMGDLGQL  63

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + ++++ RD+ S++ VV  +NVVINLIGR++ET+NY FE+V   + + +A +SKE  G+ 
Sbjct  64   LFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-AGVE  122

Query  575  RFIQVSCLGASPTSPSR  625
            +FI VS L A+  S SR
Sbjct  123  KFIHVSHLNANIKSSSR  139



>gb|AAH91192.1| Ndufa9 protein, partial [Rattus norvegicus]
Length=370

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  33   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  92

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  93   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  151

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ RFI VS L AS  S ++
Sbjct  152  AGVERFIHVSHLNASMKSSAK  172



>ref|XP_005365322.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Microtus ochrogaster]
Length=377

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGQGGRSSVSGVVATVFGATGFLGRYVVNALGRMGSQVIIPYRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDVFVKIPQTIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ RFI VS L A+  S SR
Sbjct  159  AGVERFIHVSHLNANMKSSSR  179



>ref|XP_003988339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Felis catus]
Length=377

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N +D+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_003331391.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP86972.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
Length=386

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +2

Query  152  DTPRYASTLTASKGVGHLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVL  328
            +T R+   L    G G +++  G  GR S +G+VATVFGATGFLGRYLV +LAK G+QV+
Sbjct  27   ETKRWRHDLIKQSGTGKVIQSSGPSGRHSNTGLVATVFGATGFLGRYLVHKLAKQGTQVI  86

Query  329  VPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSF  508
            VP+R  ED  RHL++MGDLGQIVP++++  +E  +   V  ++VV NL+GRE+ET+NYSF
Sbjct  87   VPYR-DEDSKRHLRVMGDLGQIVPLEFDLENEGFINECVRHSHVVYNLLGREHETKNYSF  145

Query  509  EEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            + +    A ++  I+KE+ G+ R I VS L AS  SPS++
Sbjct  146  DRLFIEGASKITRIAKEN-GVGRLIHVSHLNASLDSPSKL  184



>ref|XP_007170262.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Balaenoptera acutorostrata scammoni]
Length=377

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++ RD+ S++  V  +NVV+NL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMEWSGRDKDSIRRAVEHSNVVVNLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A   SPS+
Sbjct  159  AGVEKLIHVSHLNADIKSPSK  179



>ref|XP_006237562.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Rattus norvegicus]
Length=373

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  36   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMHLRLMGD  95

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  96   LGQLIFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  154

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ RFI VS L AS  S ++
Sbjct  155  AGVERFIHVSHLNASMKSSAK  175



>gb|EAW88839.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_c [Homo sapiens]
Length=254

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  19   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  78

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  79   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  137

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  138  AGVEKFIHVSHLNANIKSSSR  158



>gb|ABH12231.1| mitochondrial complex I subunit NDUFA9 [Pongo pygmaeus]
Length=381

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  103

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  162

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  163  AGVEKFIHVSHLNANIKSSSR  183



>ref|NP_001127602.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pongo abelii]
 sp|P0CB81.1|NDUA9_PONAB RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo abelii]
 sp|P0CB82.1|NDUA9_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pongo pygmaeus]
 emb|CAH92896.1| hypothetical protein [Pongo abelii]
Length=377

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ETRN+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETRNFDFEDVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_006053611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bubalus bubalis]
Length=380

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|XP_005957904.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pantholops hodgsonii]
Length=380

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQVIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>ref|XP_010843290.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bison bison bison]
Length=376

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  36   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  95

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ETRN+ FE+V   + + +A +SKE 
Sbjct  96   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETRNFDFEDVFVKIPQAIAQVSKE-  154

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  155  AGVEKFIHISHLNADIKSSSK  175



>ref|NP_001073383.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Pan troglodytes]
 ref|XP_008972004.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pan paniscus]
 sp|Q0MQB4.1|NDUA9_PANTR RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Pan troglodytes]
 gb|ABH12229.1| mitochondrial complex I subunit NDUFA9 [Pan troglodytes]
Length=377

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+NY FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNYDFEDVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_004279068.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orcinus orca]
Length=377

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L   G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LTPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFGFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S S+
Sbjct  159  AGVEKFIHVSHLNADIKSSSK  179



>ref|NP_001266630.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Gorilla gorilla]
 gb|ABH12230.1| mitochondrial complex I subunit NDUFA9 [Gorilla gorilla]
Length=381

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  44   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  103

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  104  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  162

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  163  AGVEKFIHVSHLNANIKSSSR  183



>sp|Q0MQB3.2|NDUA9_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Gorilla gorilla gorilla]
Length=377

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|AAH03351.1| Similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 
9 (39kD), partial [Homo sapiens]
Length=338

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  1    LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  60

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  61   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  119

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  120  AGVEKFIHVSHLNANIKSSSR  140



>ref|XP_534915.3| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform 1 [Canis lupus familiaris]
Length=377

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINLIGRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIQRAVKHSNVVINLIGREWETKNFDFEDVFVKIPQAIAKVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_007089756.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Panthera tigris altaica]
Length=462

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       HL+ MGD
Sbjct  125  LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGD  184

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N +D+ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  185  LGQIIFLEWNGKDKDSIRRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  243

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  244  AGVEKFIHVSHLNADIKSSSR  264



>gb|KIK69637.1| hypothetical protein GYMLUDRAFT_992204 [Gymnopus luxurians FD-317 
M1]
Length=369

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 114/175 (65%), Gaps = 2/175 (1%)
 Frame = +2

Query  104  VSAFKSFDLLSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLG  283
            +SA  SF  L     ++  R    LT       +V +G  G S+VSG V TVFG TGFLG
Sbjct  1    MSASSSFLRLQRAANLNGKRAYHDLTTLPSKKPIVAQGPPGYSAVSGHVVTVFGCTGFLG  60

Query  284  RYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvv  463
            RYLV +LA+MG+QV+VP+R  ED  RHLK MGDLGQIVPM+++ R+E+ +   V  +++V
Sbjct  61   RYLVSKLARMGTQVIVPYR-DEDEKRHLKPMGDLGQIVPMEWDLRNENQIAECVRHSDIV  119

Query  464  INLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             NL+GR+Y T+++ F  V    AE++A I+ +  G+ R + VS L AS TSPS++
Sbjct  120  FNLVGRDYATKSFDFASVQVDGAERIAQIAAQ-SGVPRLVHVSHLNASATSPSKL  173



>gb|KDQ20806.1| hypothetical protein BOTBODRAFT_26820 [Botryobasidium botryosum 
FD-172 SS1]
Length=366

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 4/150 (3%)
 Frame = +2

Query  173  TLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSED  352
            T+  SK V   +  G  GRS+VSG VATVFGATGFLGRYL+ +LAK G+QV+VPFR  ED
Sbjct  25   TVLPSKPV---ISYGPAGRSAVSGHVATVFGATGFLGRYLIAKLAKGGTQVIVPFR-EED  80

Query  353  CHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMA  532
              RHL++ GDLGQIVP++++ R+E  ++  V  +++V NL+GR+YET+N+ ++ V+   A
Sbjct  81   EARHLRVTGDLGQIVPLEWDLRNEEQIRECVRHSDIVYNLVGRDYETKNFDYQSVHVKGA  140

Query  533  EQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            E +A I  E   + RF+ VS L AS  SPS
Sbjct  141  ELIAQICAESPSVSRFVHVSHLNASVDSPS  170



>ref|XP_007935381.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Orycteropus afer afer]
Length=377

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A+  S SR
Sbjct  159  AGVEKLIHVSHLNANIKSSSR  179



>ref|XP_004778323.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
 ref|XP_004823819.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mustela putorius furo]
Length=377

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R+  S+   V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNRDSIHRAVKHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_004381326.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Trichechus manatus latirostris]
Length=359

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYIVNHLGRMGSQVIIPYRCDAYELMYLRPMGDLGQI  103

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + +++N RD+ S++  V  +NVVINL+GRE+ETRN+ +++V   + + +A +SKE  G+ 
Sbjct  104  IFLEWNGRDKDSIRRAVEHSNVVINLVGREWETRNFDYDDVFVKIPQAIAQVSKE-AGVE  162

Query  575  RFIQVSCLGASPTSPSR  625
            R I VS L A   SPSR
Sbjct  163  RLIHVSHLNADIKSPSR  179



>emb|CBQ67793.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Sporisorium 
reilianum SRZ2]
Length=392

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT ++  G  + K     GGRSSVSG V TVFG TGFLGRYLV +LA+ G+QV++
Sbjct  35   RNVHDLTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYLVNRLAQKGTQVII  94

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQIVPM+++ R +  ++  V  ++VV NL+GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQIVPMEWDLRHDEQIEECVRHSDVVYNLVGRHYETKNFTFN  153

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A+++A I+ E  G+ RFI VS L A   SPS
Sbjct  154  DVHVTGAQRIAQIA-ESAGVGRFIHVSHLNADANSPS  189



>ref|XP_010357461.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Rhinopithecus roxellana]
Length=377

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|AIC62000.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|AAA36350.1| NADH dehydrogenase (ubiquinone), partial [Homo sapiens]
Length=375

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  38   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  97

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  98   LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  156

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  157  AGVEKFIHVSHLNANIKSSSR  177



>ref|NP_004993.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Homo sapiens]
 sp|Q16795.2|NDUA9_HUMAN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Homo sapiens]
 gb|AAD42055.1|AF050641_1 NADH-ubiquinone oxidoreductase 39kDa subunit [Homo sapiens]
 gb|AAH09311.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAH15837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|AAI11547.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Homo sapiens]
 gb|EAW88837.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_a [Homo sapiens]
 gb|ADQ31784.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[synthetic construct]
 gb|AIC49261.1| NDUFA9, partial [synthetic construct]
Length=377

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_008528773.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus przewalskii]
Length=377

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_001494651.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Equus caballus]
Length=377

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVMVPYRCDTYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>gb|ABF57357.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
Length=369

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  29   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  88

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  89   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  147

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  148  AGVEKFIHISHLNADIKSSSK  168



>gb|EFB28697.1| hypothetical protein PANDA_009221 [Ailuropoda melanoleuca]
Length=360

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  82

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  83   LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  141

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  142  AGVEKFIHVSHLNADIKSSSR  162



>ref|NP_991386.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Bos taurus]
 sp|P34943.1|NDUA9_BOVIN RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Bos taurus]
 emb|CAA42053.1| NADH dehydrogenase (ubiquinone) 42 kDa subunit [Bos taurus]
 gb|AAI02360.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Bos taurus]
 tpg|DAA29189.1| TPA: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 
9, mitochondrial precursor [Bos taurus]
Length=380

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI +S L A   S S+
Sbjct  159  AGVEKFIHISHLNADIKSSSK  179



>gb|KIJ64483.1| hypothetical protein HYDPIDRAFT_28424 [Hydnomerulius pinastri 
MD-312]
Length=359

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = +2

Query  176  LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  355
            L    G   ++ +GT G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+VP+R  ED 
Sbjct  25   LVTLPGRKPIISQGTPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVIVPYR-EEDE  83

Query  356  HRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAE  535
             RHLK MGDLGQIVPM+++ R+E  +   +  +++V NL+GR+YET+N+   +V+   AE
Sbjct  84   KRHLKPMGDLGQIVPMEWDIRNEEQIAECLRHSDIVYNLVGRDYETKNFKSADVHVAGAE  143

Query  536  QLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            ++A ++ E  G+ RF+ +S L ASP S S
Sbjct  144  RVAKVAAE-SGVQRFVHLSHLNASPDSRS  171



>ref|XP_004210520.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like, partial [Hydra vulgaris]
Length=163

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 101/155 (65%), Gaps = 1/155 (1%)
 Frame = +2

Query  158  PRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPF  337
            PR       S    H ++ G GGR+S +G + TVFGATGFLGRY+V +LA+ G+Q+++P+
Sbjct  4    PRSTLKRRNSTSYEHGLKYGDGGRNSFNGSIVTVFGATGFLGRYVVNRLARRGTQLIIPY  63

Query  338  RGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEV  517
            RG +D  R+++LMGDLGQI    YN RD  S+   +  ++ VINL+G+ ++TRN++  + 
Sbjct  64   RGVDDEVRNIRLMGDLGQIKFFNYNLRDYESLLKTMTHSSTVINLVGKNFDTRNFTMSDC  123

Query  518  NHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
                A  LA  +KE  G+ RFI VS LGA  +SPS
Sbjct  124  IVTGAADLAKAAKE-SGVKRFIHVSALGAEGSSPS  157



>gb|EAW88838.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, 
isoform CRA_b [Homo sapiens]
Length=399

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  62   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  121

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  122  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKE-  180

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  181  AGVEKFIHVSHLNANIKSSSR  201



>ref|XP_002920485.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ailuropoda melanoleuca]
Length=377

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  159  AGVEKFIHVSHLNADIKSSSR  179



>ref|XP_008141973.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eptesicus fuscus]
Length=377

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNVRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   S SR
Sbjct  159  AGIEKFIHISHLNADIKSTSR  179



>ref|XP_005084120.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Mesocricetus auratus]
Length=377

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ RD+ S+K  V  +NVVINL+GR++ETRN+ FE+V   +   +A  SKE 
Sbjct  100  LGQIIFLEWDARDKDSIKRAVQHSNVVINLVGRDWETRNFDFEDVFVKIPHAIAQASKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ R I VS L AS  S SR
Sbjct  159  AGVERLIHVSHLNASIKSSSR  179



>gb|AAH05760.1| Ndufa9 protein, partial [Mus musculus]
Length=348

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  11   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  70

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ+  ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  71   LGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  129

Query  563  GGIMRFIQVSCLGA  604
             G+ RFI VS L A
Sbjct  130  AGVERFIHVSHLNA  143



>ref|NP_001279619.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa 
[Callorhinchus milii]
 gb|AFK11425.1| Ndufa9 protein [Callorhinchus milii]
Length=380

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  42   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI  + ++ RD+ S++  V  +NVVINL+GRE+ET NY FE+VN  +  Q+A  ++E 
Sbjct  102  LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  160

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
             G+ +FI +S L A+  S S++
Sbjct  161  AGVEKFIHISHLNANIKSISKL  182



>ref|NP_001013477.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Danio rerio]
 gb|AAH91545.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Danio 
rerio]
 gb|AAI64086.1| Ndufa9 protein [Danio rerio]
Length=309

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   SPS+
Sbjct  161  AGIKKFIHMSHLNADIRSPSK  181



>ref|XP_002920484.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ailuropoda melanoleuca]
Length=401

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  64   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  123

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  124  LGQIIFLEWDGRNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  182

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  183  AGVEKFIHVSHLNADIKSSSR  203



>ref|XP_008823675.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nannospalax galili]
Length=377

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ RD +S++  V  +NVVINL+GRE+ETRN+ FE V   + + +A +SKE 
Sbjct  100  LGQIIFLEWDARDRASIRRAVEYSNVVINLVGREWETRNFDFENVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ R I VS L A+  S S+
Sbjct  159  AGVERLIHVSHLNANIRSSSK  179



>ref|XP_007902354.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Callorhinchus milii]
Length=370

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++ +G GGRSS SGIVATVFGATGFLGRY+V +L ++GSQ+++P+R       HLK MGD
Sbjct  32   IIPRGKGGRSSFSGIVATVFGATGFLGRYVVNRLGRIGSQIVIPYRCDPYDTMHLKPMGD  91

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI  + ++ RD+ S++  V  +NVVINL+GRE+ET NY FE+VN  +  Q+A  ++E 
Sbjct  92   LGQITLLHWDARDKDSIRRAVENSNVVINLVGREWETWNYKFEDVNINIPRQIALAARE-  150

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
             G+ +FI +S L A+  S S++
Sbjct  151  AGVEKFIHISHLNANIKSISKL  172



>ref|XP_003496081.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 ref|XP_007637435.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Cricetulus griseus]
 gb|EGV98504.1| hypothetical protein I79_001369 [Cricetulus griseus]
Length=377

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE++   + + +A  SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDIFVKIPQAIAQASKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ R I VS L AS  S SR
Sbjct  159  AGVERLIHVSHLNASMKSSSR  179



>emb|CCF54116.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
hordei]
Length=392

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  ED  RHLK+MGDLGQ+VP
Sbjct  58   GGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DEDEKRHLKVMGDLGQVVP  116

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            M+++ R++  ++  V  ++VV NL GR YET+N++F +V+   A+++A I+ E  G+ RF
Sbjct  117  MEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHATGAQRIAQIA-EAAGVGRF  175

Query  581  IQVSCLGASPTSPS  622
            I VS L A   SPS
Sbjct  176  IHVSHLNADANSPS  189



>ref|XP_006862735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chrysochloris asiatica]
Length=377

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDTYDLMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V  +NVVINL+GRE+ET+N+ +E+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGREWETKNFDYEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A+  S SR
Sbjct  159  AGVEKLIHVSHLNANMKSSSR  179



>ref|NP_079634.2| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial precursor [Mus musculus]
 sp|Q9DC69.2|NDUA9_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; AltName: Full=Complex I-39kD; 
Short=CI-39kD; AltName: Full=NADH-ubiquinone oxidoreductase 
39 kDa subunit; Flags: Precursor [Mus musculus]
 gb|AAH58378.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
 gb|EDK99844.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 [Mus musculus]
Length=377

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ+  ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  100  LGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  563  GGIMRFIQVSCLGA  604
             G+ RFI VS L A
Sbjct  159  AGVERFIHVSHLNA  172



>gb|ETN62206.1| NADH-ubiquinone oxidoreductase 39 kda subunit [Anopheles darlingi]
Length=401

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 110/158 (70%), Gaps = 6/158 (4%)
 Frame = +2

Query  140  HYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGS  319
            +Y  D P    T   +      +++GTGGRSS +GIVATVFG+TGFLGRY+  +L K+GS
Sbjct  28   NYSTDAPHKLKTTNLAA-----IKRGTGGRSSFNGIVATVFGSTGFLGRYVCNKLGKIGS  82

Query  320  QVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRN  499
            QV++P+R        LKL+GDLGQ++   Y+ RDE +++  V  +NVVINL+GR++ET+N
Sbjct  83   QVIIPYRADHYEALRLKLVGDLGQVLFHPYDLRDEDAIRKAVKYSNVVINLVGRDWETKN  142

Query  500  YSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPT  613
            +SF++V+   A +LA I++E  G+ +F+ VS L A+PT
Sbjct  143  FSFKDVHVEGARRLARIARE-AGVEKFVHVSSLNATPT  179



>gb|KIM65954.1| hypothetical protein SCLCIDRAFT_1211966 [Scleroderma citrinum 
Foug A]
Length=356

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 107/152 (70%), Gaps = 5/152 (3%)
 Frame = +2

Query  170  STLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSE  349
            STL   K V   +  G  G S+VSG VATVFG TGFLGRYLV +LA+MG+QV+VP+R  E
Sbjct  23   STLPGRKPV---ISHGPPGYSAVSGHVATVFGCTGFLGRYLVSKLARMGTQVIVPYR-EE  78

Query  350  DCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYM  529
            D  RHLK MGDLGQIV M+++ R+E  +   +  +++V NL+GR+YET+N+ F +V+   
Sbjct  79   DEKRHLKPMGDLGQIVSMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNFKFADVHVAG  138

Query  530  AEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            AE++A ++ +  G+ R + VS L AS TSPS+
Sbjct  139  AERIAKVAAQ-VGVQRMVHVSHLNASATSPSQ  169



>ref|XP_004692611.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Condylura cristata]
Length=569

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +2

Query  182  ASKGVGHLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCH  358
            A + + H V   G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R      
Sbjct  32   AQRQIHHAVMPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCEPYDV  91

Query  359  RHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQ  538
             HL+ MGDLGQI+ ++++ R++ S++  V  +NVVINL+GRE+ETRN+ FE+V   + + 
Sbjct  92   MHLRPMGDLGQIIFLEWDARNKDSIRRAVEHSNVVINLVGREWETRNFDFEDVYVKIPQA  151

Query  539  LAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            +A +SKE  GI +FI VS L A   S SR
Sbjct  152  IAQVSKE-AGIEKFIHVSHLNADIKSSSR  179



>ref|XP_006754928.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis davidii]
Length=377

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I +S L A   S SR
Sbjct  159  AGVEKLIHISHLNADIKSTSR  179



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +2

Query  212  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  391
            +GTGGRSS+SGI +TVFGATG+LGRY+V  L K GS++++P R  ++  +HLK+MGDLGQ
Sbjct  13   RGTGGRSSISGITSTVFGATGYLGRYVVNHLGKSGSRMILPTRCGDNAKQHLKVMGDLGQ  72

Query  392  IVPMK-YNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGG  568
            IV +     RD+S++K  V ++NVV+NL+GRE+ETRN+SF++V+    E+LA I KE  G
Sbjct  73   IVDLAGLKIRDDSAIKYAVERSNVVVNLLGREWETRNFSFDDVHRDFPERLARICKEL-G  131

Query  569  IMRFIQVSCLGASPTSPSR  625
            + R + VS LGA+   PS+
Sbjct  132  VERLVHVSALGATLDHPSK  150



>gb|AAI53423.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   IVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   SPS+
Sbjct  161  AGIKKFIHMSHLNADIRSPSK  181



>ref|XP_007503809.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Monodelphis domestica]
Length=345

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ETRN+ F +V   + E +A ++KE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+  FI VS L A   S S+
Sbjct  159  AGVETFIHVSHLNADIKSTSK  179



>gb|AAH68378.1| Ndufa9 protein, partial [Danio rerio]
Length=374

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 110/154 (71%), Gaps = 2/154 (1%)
 Frame = +2

Query  167  ASTLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  343
            A      + + H +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R 
Sbjct  23   APVTVQQRKIHHAVVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRC  82

Query  344  SEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNH  523
             +    +L+ MGDLGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V  
Sbjct  83   DQYDLMYLRPMGDLGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFV  142

Query  524  YMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
             +  Q+A  ++E  GI +FI +S L A   SPS+
Sbjct  143  SIPLQIARATRE-AGIKKFIHMSHLNADIRSPSK  175



>ref|XP_004459092.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Dasypus novemcinctus]
Length=384

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+S+E+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFSYEDVFVKIPQGIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI VS L A   S SR
Sbjct  159  VGIEKFIHVSHLNADIKSSSR  179



>dbj|BAF83756.1| unnamed protein product [Homo sapiens]
Length=377

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R  +    HL+ MGD
Sbjct  40   LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++ VV  +NVVINLIGR++ET+N+ FE V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEGVFVKIPQAIAQLSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_002736180.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Saccoglossus kowalevskii]
Length=253

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFG-ATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMG  379
            +V +G GGRSS SG++ATVFG +TGF+GRY++ +L + GSQ++VP+R   D  RHLK+MG
Sbjct  47   MVPRGRGGRSSFSGVIATVFGGSTGFVGRYVINRLGREGSQIIVPYRCDPDDIRHLKVMG  106

Query  380  DLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKE  559
            DLGQI+P+ ++   + S++ ++  +NVVINL+G++YETRNY FE+++  +A ++A+I+ E
Sbjct  107  DLGQIIPLTFDVNSDDSLREMMQHSNVVINLMGKDYETRNYRFEDIHIDIAGRVASIASE  166

Query  560  HGGIMRFIQVSCLGASPTSPSRM  628
               I R I +S LG+   SPS+ 
Sbjct  167  L-KIPRLIHLSALGSDWKSPSKF  188



>gb|EST09999.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
brasiliensis GHG001]
Length=392

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 110/157 (70%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+V
Sbjct  35   RSVHDLTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIV  94

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQ+VPM+++ R +  ++  V  ++VV NL GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFN  153

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A+++A I+ E  G+ RFI VS L A+  SPS
Sbjct  154  DVHVTGAQRIAQIA-EAAGVGRFIHVSHLNAAADSPS  189



>ref|XP_003771339.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sarcophilus harrisii]
Length=377

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ET+N+ F +V   + E +A ++K +
Sbjct  100  LGQIIFLEWNAKDKSSIQRALEHSNVVINLVGRDWETKNFDFSDVFAVIPETIAQLAK-N  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+  FI VS L A   S SR
Sbjct  159  AGVETFIHVSHLNADIKSTSR  179



>ref|XP_005174380.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Danio rerio]
Length=380

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARATRE-  160

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   SPS+
Sbjct  161  AGIKKFIHMSHLNADIRSPSK  181



>ref|XP_006957558.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
 gb|EIM22301.1| NAD(P)-binding protein [Wallemia sebi CBS 633.66]
Length=378

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 104/145 (72%), Gaps = 2/145 (1%)
 Frame = +2

Query  188  KGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHL  367
            K    ++R G GGRSS +G VATVFG TGFLGRYLVQ++A+ G+QV+VP+R  E   RHL
Sbjct  32   KSKSPVLRLGPGGRSSTTGHVATVFGCTGFLGRYLVQKIARTGAQVVVPYR-DEMEKRHL  90

Query  368  KLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAA  547
            K+MGDLGQIVPM+++ R    +   +  ++VV NL+GR++ET+N+S+E+V+  +A  +A+
Sbjct  91   KVMGDLGQIVPMEWDARRPDQIAECLRHSDVVYNLVGRDHETKNFSYEDVHTKVASDIAS  150

Query  548  ISKEHGGIMRFIQVSCLGASPTSPS  622
            I+ +  GI R I VS   A+  SPS
Sbjct  151  IATQE-GIERLIHVSHFNAAHDSPS  174



>dbj|GAC73597.1| NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Pseudozyma 
antarctica T-34]
Length=385

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++
Sbjct  28   RAIHDLTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVII  87

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF 
Sbjct  88   PYR-DEDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFN  146

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A+++A I+ E  G+ R I VS L A   SPS
Sbjct  147  DVHVAGAQRIAQIA-ESAGVGRLIHVSHLNADADSPS  182



>ref|XP_009178280.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Papio anubis]
Length=377

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>gb|ELR54825.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial, partial [Bos mutus]
Length=363

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  23   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  82

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  83   LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  141

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I +S L A   S S+
Sbjct  142  AGVEKLIHISHLNADIKSSSK  162



>gb|ETS63618.1| hypothetical protein PaG_01917 [Pseudozyma aphidis DSM 70725]
Length=385

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 5/152 (3%)
 Frame = +2

Query  176  LTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  
Sbjct  33   LTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-D  91

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF +V+  
Sbjct  92   EDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFNDVHVA  151

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
             A+++A I+ E  G+ R I VS L A   SPS
Sbjct  152  GAQRIAQIA-ESAGVGRLIHVSHLNADADSPS  182



>dbj|GAK62286.1| NAD(P)-binding protein [Pseudozyma antarctica]
Length=386

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGHLVRKG---TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT ++  G  + K     GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++
Sbjct  29   RAIHDLTINRKTGKPIIKSGPYAGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVII  88

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQIVPM+++ R++  ++  V  ++VV NL GR YET+N+SF 
Sbjct  89   PYR-DEDEKRHLKVMGDLGQIVPMEWDLRNDEQIEECVRHSDVVYNLTGRHYETKNFSFN  147

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A+++A I+ E  G+ R I VS L A   SPS
Sbjct  148  DVHVAGAQRIAQIA-ESAGVGRLIHVSHLNADADSPS  183



>ref|XP_001372251.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Monodelphis domestica]
Length=377

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCEPYDFTYLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N +D+SS++  +  +NVVINL+GR++ETRN+ F +V   + E +A ++KE 
Sbjct  100  LGQIIFLEWNSKDKSSIQRALEHSNVVINLVGRDWETRNFDFTDVFADIPESIAQLAKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+  FI VS L A   S S+
Sbjct  159  AGVETFIHVSHLNADIKSTSK  179



>ref|XP_009178281.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Papio anubis]
Length=375

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P+R       HL+ MGD
Sbjct  38   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPYRCDIYDTMHLRPMGD  97

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  98   LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  156

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  157  AGVEKFIHVSHLNANIKSSSR  177



>ref|XP_007270771.1| NADH dehydrogenase [Fomitiporia mediterranea MF3/22]
 gb|EJC98873.1| NADH dehydrogenase [Fomitiporia mediterranea MF3/22]
Length=365

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  176  LTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDC  355
            LT +K    ++  G  GRS+V+G   TVFG+TGFL RYL+ ++AK G++V+VP+R  ED 
Sbjct  26   LTTTKSHKPIISYGPPGRSAVTGHTVTVFGSTGFLARYLISKIAKSGTRVIVPYR-EEDE  84

Query  356  HRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAE  535
             RHLK+MGDLGQI+P++++ R+E  +   +  ++ V NL+GR YET+N++F +V+   A 
Sbjct  85   KRHLKVMGDLGQIIPLEWDMRNEQQIAECLRHSDTVYNLVGRNYETKNFNFHDVHVNGAA  144

Query  536  QLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
             +A I+ E+ G+  FI VS L A+P SPS+ 
Sbjct  145  SIARIAAEN-GVDNFIHVSHLNAAPNSPSKF  174



>ref|XP_007527887.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Erinaceus europaeus]
Length=377

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQI
Sbjct  44   GKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGDLGQI  103

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + +++N R++ S++  V  +NVVINLIG+++ETRN+ FE++   +   +A +SKE  G+ 
Sbjct  104  IFLEWNGRNKDSIRRTVEHSNVVINLIGKDWETRNFDFEDIYVKIPHAIAQVSKE-AGVK  162

Query  575  RFIQVSCLGASPTSPSR  625
            + I +S L A   SPS+
Sbjct  163  KLIHISHLNADLKSPSK  179



>ref|XP_008703115.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Ursus maritimus]
Length=410

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  73   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  132

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  133  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  191

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  192  AGVEKFIHVSHLNADIKSSSR  212



>gb|KDR23820.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Zootermopsis nevadensis]
Length=401

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +2

Query  206  VRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDL  385
            +++GTGGRSS +GIVATVFGATGF+GRY+  +L K+G+Q+++P+RG    +  LKL+GDL
Sbjct  45   LKRGTGGRSSFNGIVATVFGATGFVGRYVCNRLGKIGTQLILPYRGDHYDNLRLKLVGDL  104

Query  386  GQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHG  565
            GQ++ + Y+ RDE S+   +  +NVVINL+GR++ETRN+SF +V+   A  LA +SKE  
Sbjct  105  GQVLFVPYDLRDEESIYKAIQYSNVVINLVGRDWETRNFSFHDVHVQGARTLARLSKE-A  163

Query  566  GIMRFIQVSCLGAS  607
            G+ +F+ VS L AS
Sbjct  164  GVEKFVHVSALNAS  177



>ref|XP_005897993.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Bos mutus]
Length=380

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPHRCEPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M +N RD+ S++  V  ++VVINL+GRE+ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFMDWNGRDKDSIRRAVEHSSVVINLVGREWETQNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I +S L A   S S+
Sbjct  159  AGVEKLIHISHLNADIKSSSK  179



>gb|AAI52140.1| Ndufa9 protein [Danio rerio]
Length=380

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            +V +G GGRSS+SG+ ATVFGATGFLGRY+V +L +MGSQV++P+R  +    +L+ MGD
Sbjct  42   VVPRGKGGRSSISGLAATVFGATGFLGRYVVNRLGRMGSQVVIPYRCDQYDLMYLRPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++PR++ S++  ++ +NVVINL+GRE+ET NY +E+V   +  Q+A  ++E 
Sbjct  102  LGQIIFMEWDPRNKESIQRAISHSNVVINLVGREWETSNYKYEDVFVSIPLQIARPTRE-  160

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   SPS+
Sbjct  161  AGIKKFIHMSHLNADIRSPSK  181



>ref|XP_006739694.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Leptonychotes weddellii]
Length=377

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   +   +A +SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPRAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A   S SR
Sbjct  159  AGVEKLIHVSHLNADIKSSSR  179



>gb|KDQ62587.1| hypothetical protein JAAARDRAFT_30488 [Jaapia argillacea MUCL 
33604]
Length=373

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G  GRS+++G VATVFG TGFLGRYLV +LAK G+QV+VP+R S+D  RHLK MGD
Sbjct  36   IISYGPPGRSALTGHVATVFGCTGFLGRYLVSKLAKAGTQVIVPYRESDDA-RHLKPMGD  94

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ+VPM+++ R+E  +   +  +++V NL+GR+YET+NYSF +VN   A ++A ++ + 
Sbjct  95   LGQVVPMEWDIRNEDQIAECLRHSDIVYNLVGRDYETKNYSFGDVNAAGAGRIAKVAAQ-  153

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
              I RF+ VS L AS  S S+ 
Sbjct  154  CNIPRFVHVSHLNASHESTSKF  175



>ref|XP_007882091.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
 gb|EPQ26151.1| hypothetical protein PFL1_06359 [Pseudozyma flocculosa PF-1]
Length=390

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT  +  G  ++R+G   GGRSSVSG VATVFG TGFLGRYLV +L++ G+QV+V
Sbjct  33   RSVHDLTIKRKTGKPIIRQGPYGGGRSSVSGHVATVFGCTGFLGRYLVNRLSQKGTQVIV  92

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQ+VP++++ R++  ++  +  ++ V NL GR+YET+N+SF 
Sbjct  93   PYR-DEDEKRHLKVMGDLGQVVPLEWDIRNDQQIQECIRHSDTVYNLTGRQYETKNFSFS  151

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A ++A ++ E  G  RFI VS L A   SPS
Sbjct  152  DVHVTGARRIAEMA-EALGASRFIHVSHLNADKDSPS  187



>ref|XP_001515711.2| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Ornithorhynchus anatinus]
Length=405

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGDLGQ+
Sbjct  72   GQGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVVIPYRCEPYDIMHLRPMGDLGQL  131

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + M++N RD+ S++  +A +NVVINLIGR++ET+N+ F++V   + + +A ++KE  G+ 
Sbjct  132  LFMEWNARDKESIRRALAHSNVVINLIGRDWETKNFDFDDVFVKIPQSIAQLAKE-AGVE  190

Query  575  RFIQVSCLGASPTSPSR  625
            +FI VS L A   S SR
Sbjct  191  KFIHVSHLNADMKSSSR  207



>ref|XP_003410681.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Loxodonta africana]
Length=380

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = +2

Query  200  HLVRK-GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLM  376
            H++R  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ M
Sbjct  41   HVLRPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMYLRPM  100

Query  377  GDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISK  556
            GDLGQI+ +++N RD+ S++  V  +NVVINL+G+++ETRN+ FE+V   + + +A +SK
Sbjct  101  GDLGQIIFLEWNGRDKDSIRRAVEHSNVVINLVGQDWETRNFDFEDVFVKIPQAIAQVSK  160

Query  557  EHGGIMRFIQVSCLGASPTSPSR  625
            E  G+ R I VS L A   S SR
Sbjct  161  E-AGVERLIHVSHLNADIKSSSR  182



>ref|XP_006795902.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Neolamprologus brichardi]
Length=303

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLQWDARNKDSIKRAMEHSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>emb|CDI51333.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Melanopsichium 
pennsylvanicum 4]
Length=388

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+VP+R  ED  RHLK+MGDLGQ+VP
Sbjct  54   GGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIVPYR-DEDEKRHLKVMGDLGQVVP  112

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            M+++ R +  ++  V  ++VV NL GR YET+N++F +V+   A+++A I+ E  G+ RF
Sbjct  113  MEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFNDVHVTGAQRIAQIA-EAAGVGRF  171

Query  581  IQVSCLGASPTSPS  622
            I VS L A   SPS
Sbjct  172  IHVSHLNADADSPS  185



>ref|XP_005492469.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Zonotrichia albicollis]
Length=373

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SALQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  84

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFMEWDCRDKESIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  144

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + + +A ISKE  G+ +FI +S L AS  SPS+
Sbjct  145  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSK  176



>ref|XP_011386267.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
 gb|KIS71955.1| putative NADH2 dehydrogenase (ubiquinone) 40K chain [Ustilago 
maydis 521]
Length=392

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = +2

Query  161  RYASTLTASKGVGH-LVRKGT--GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLV  331
            R    LT ++  G  +++ G   GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV+V
Sbjct  35   RNVHDLTINRKTGKPIIKSGPYGGGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIV  94

Query  332  PFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFE  511
            P+R  ED  RHLK+MGDLGQ+VPM+++ R +  ++  V  ++VV NL GR YET+N++F 
Sbjct  95   PYR-DEDEKRHLKVMGDLGQVVPMEWDLRHDEQIEECVRHSDVVYNLTGRHYETKNFTFN  153

Query  512  EVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
            +V+   A+++A I+ E  G+ RFI VS L A   SPS
Sbjct  154  DVHVTGAQRIAQIA-EASGVGRFIHVSHLNADANSPS  189



>ref|XP_007965492.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Chlorocebus sabaeus]
Length=377

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV++P+R       +L+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDIYDTMYLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFEDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_008703114.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Ursus maritimus]
Length=434

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ++VP+R       HL+ MGD
Sbjct  97   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQMIVPYRCDPYDTMHLRPMGD  156

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   + + +A +SKE 
Sbjct  157  LGQIIFLEWDGRNKDSIRRAVKHSNVVINLVGREWETKNFDFEDIFVKIPQAIAQVSKE-  215

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   S SR
Sbjct  216  AGVEKFIHVSHLNADIKSSSR  236



>ref|XP_005533361.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pseudopodoces humilis]
Length=376

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 118/171 (69%), Gaps = 12/171 (7%)
 Frame = +2

Query  146  GIDTPRY---ASTLTAS-------KGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYL  292
            G+  PR    AS LTA+       + V H ++  G  GRSSVSGIVATVFGATGFLGRY+
Sbjct  10   GLRLPRAGHGASVLTAAPLVLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYV  69

Query  293  VQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINL  472
            V +L ++GSQV++P+R  +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINL
Sbjct  70   VNRLGRIGSQVIIPYRCDQYDLMYLRPMGDLGQLLFMEWDCRDKDSIRRAVEHSNVVINL  129

Query  473  IGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            IG+E+ET+N+ FE+    + + +A ISKE  G+ +FI +S L AS  SPS+
Sbjct  130  IGKEWETKNFKFEDEFVNIPQNIAHISKE-AGVEKFIHISHLNASMKSPSK  179



>ref|XP_005877078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis brandtii]
 ref|XP_006096122.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Myotis lucifugus]
 gb|EPQ14420.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Myotis brandtii]
Length=377

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G  GRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R     + HL+ MGD
Sbjct  40   LIPHGRSGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDYMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+ FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNARNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I +S L A   S SR
Sbjct  159  AGVEKLIHISHLNADIKSTSR  179



>ref|XP_008274666.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Stegastes partitus]
Length=381

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++ KG GGRSS SG  ATVFGATGFLGRY+V +L +MGSQV+VP R       +++ MGD
Sbjct  43   IIPKGKGGRSSFSGFSATVFGATGFLGRYVVNRLGRMGSQVIVPHRCDRYDLMYMRPMGD  102

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++ RD+ S+K  +A +NVVINL+GRE+ETRNY FE+V   + +Q+A  ++E 
Sbjct  103  LGQIIFMEWDARDKDSIKQAMASSNVVINLVGREWETRNYRFEDVFVSIPQQIAKAARE-  161

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI + I +S L A   SPS+
Sbjct  162  AGITKLIHMSHLNADIRSPSK  182



>ref|XP_007008648.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
 gb|EIW65481.1| hypothetical protein TREMEDRAFT_72592 [Tremella mesenterica DSM 
1558]
Length=411

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 121/196 (62%), Gaps = 28/196 (14%)
 Frame = +2

Query  68   RLGHQYLKPSHSVSAFK--------SFDLLSDHYGID-TPRYASTLTASKGVGHLVRKG-  217
            RLGH+   P   V +F+        + DL+ +H     TPR             ++++G 
Sbjct  5    RLGHRLRAP---VVSFRRTATPRRGAHDLIVEHSPSSHTPR------------PIIKRGP  49

Query  218  -TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
             TGGRSSVSG V TVFG TGFLGRY V ++AK G+QV+VP+R  ED  RHL++MGDLGQI
Sbjct  50   PTGGRSSVSGNVVTVFGCTGFLGRYTVAKIAKQGAQVIVPYR-DEDEKRHLRVMGDLGQI  108

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VPM+++ R+   +   V  ++ V NL GR++ET+N++FE++N   A  +A ++ +   + 
Sbjct  109  VPMEWDARNPDQIYECVKHSDTVYNLAGRDWETKNFTFEDINVKAAGLIARVAAQ-ANVP  167

Query  575  RFIQVSCLGASPTSPS  622
            R I VS L ASP+S S
Sbjct  168  RLIHVSHLNASPSSTS  183



>gb|KFB35184.1| AGAP010792-PA-like protein [Anopheles sinensis]
Length=401

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 110/161 (68%), Gaps = 6/161 (4%)
 Frame = +2

Query  131  LSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  310
            L  +Y  D PR   T   +      +++GTGGRSS +GIVATVFG+TGFLGRY+  +L K
Sbjct  25   LKANYSTDAPRKLKTTNLAA-----MKRGTGGRSSFNGIVATVFGSTGFLGRYVCNKLGK  79

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  490
            +GSQV++P+R        LKL+GDLGQ++   Y+ RDE ++   V  +NVVINL+GR++E
Sbjct  80   IGSQVIIPYRADHYEALRLKLVGDLGQVLFHPYDLRDEEAIYKAVKHSNVVINLVGRDWE  139

Query  491  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPT  613
            T+N++F++V+   A +LA I+++  G+ +F+ VS L A+P 
Sbjct  140  TKNFTFKDVHVDGARRLARIARQ-AGVEKFVHVSSLNATPN  179



>ref|XP_318516.3| AGAP010792-PA [Anopheles gambiae str. PEST]
 gb|EAA13714.3| AGAP010792-PA [Anopheles gambiae str. PEST]
Length=385

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 110/161 (68%), Gaps = 6/161 (4%)
 Frame = +2

Query  131  LSDHYGIDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAK  310
            L  +Y  D PR   T + +      +++GTGGRSS +GIVATVFG+TGFLGRY+  +L K
Sbjct  9    LKANYSSDAPRKLKTTSLAA-----MKRGTGGRSSFNGIVATVFGSTGFLGRYVCNKLGK  63

Query  311  MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYE  490
            +GSQV++P+R        LKL+GDLGQ++   Y+ RDE ++   V  +NVVINL+GR++E
Sbjct  64   IGSQVIIPYRADHYEAMRLKLVGDLGQVLFHPYDLRDEEAIYKAVKYSNVVINLVGRDWE  123

Query  491  TRNYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPT  613
            T+N++F++V+   A +LA I++E  G+  F+ VS L A+P 
Sbjct  124  TKNFTFKDVHVDGARRLARIARE-AGVETFVHVSSLNATPN  163



>ref|XP_002188497.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Taeniopygia guttata]
Length=373

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S+L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SSLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  84

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ++ ++++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFLEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  144

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + + +A ISKE  G+ +FI VS L AS  SPS+
Sbjct  145  IPQSIARISKE-AGVEKFIHVSHLNASMKSPSK  176



>ref|XP_003447104.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oreochromis niloticus]
Length=381

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  ++VVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQIIFLEWDARNKDSIKRAMEHSDVVINLVGREWETRNFRFEDVFVTIPQQIARAARE-  161

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|XP_007353556.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD38366.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
Length=390

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G  GRS+V+G +ATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHL++MGDLGQ+
Sbjct  34   GPPGRSAVTGQIATVFGCTGFLGRYLVAKLAKAGTQVVVPYR-DEDKKRHLRVMGDLGQV  92

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            VP++++ R+E+ ++  V  +++V NL+GR+YET+N+ +  VN   A+++A +S    G+ 
Sbjct  93   VPLEFDARNEAQIEECVRHSHIVYNLVGRDYETKNFDYNAVNVAAAQRIAEVSA-RVGVP  151

Query  575  RFIQVSCLGASPTSPS  622
            RF+ VS L A+  SPS
Sbjct  152  RFVHVSHLNANFDSPS  167



>ref|XP_006633741.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Lepisosteus oculatus]
Length=380

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S +   + + H ++ +G GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  
Sbjct  30   SIVVQQRKIHHAVIPRGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRVGSQIVIPHRCD  89

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQI+ ++++ RD+ S++  +A +NVVINL+GRE+ETR++SFE+V+  
Sbjct  90   QYDIMYLRPMGDLGQIIFLEWDARDKESIRRALAHSNVVINLVGREWETRHFSFEDVHVN  149

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + +Q+A  ++E  GI +FI +S L A   SPSR
Sbjct  150  IPKQIAKAARE-AGIEKFIHMSHLNADIRSPSR  181



>ref|XP_005950396.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Haplochromis burtoni]
Length=381

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|XP_005734821.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X2 [Pundamilia nyererei]
Length=381

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  43   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  102

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  103  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  161

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  162  AGITKFVHMSHLNADIRSPSK  182



>ref|XP_005950395.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Haplochromis burtoni]
Length=382

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  163  AGITKFVHMSHLNADIRSPSK  183



>ref|XP_005734820.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Pundamilia nyererei]
Length=382

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SGI ATVFGATGFLGRY+V +L ++GSQ+++P R  +    H + MGD
Sbjct  44   LIPKGKGGRSSFSGIAATVFGATGFLGRYVVNRLGRIGSQIIIPHRCDQYDLMHFRPMGD  103

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S+K  +  +NVVINL+GRE+ETRN+ FE+V   + +Q+A  ++E 
Sbjct  104  LGQILFLEWDARNKDSIKQAMENSNVVINLVGREWETRNFRFEDVYVTIPQQIARAARE-  162

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +F+ +S L A   SPS+
Sbjct  163  AGITKFVHMSHLNADIRSPSK  183



>dbj|GAC95510.1| hypothetical protein PHSY_003086 [Pseudozyma hubeiensis SY62]
Length=392

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +2

Query  221  GGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQIVP  400
            GGRSSVSG V TVFG TGFLGRY+V +LA+ GSQV++P+R  ED  RHLK+MGDLGQ+VP
Sbjct  58   GGRSSVSGHVVTVFGCTGFLGRYVVNRLAQKGSQVIIPYR-DEDEKRHLKVMGDLGQVVP  116

Query  401  MKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIMRF  580
            M+++ R +  ++  +  ++VV NL GR YET+N++F +V+   A+++A I+ E  G+ RF
Sbjct  117  MEWDLRHDEQIEECLRHSDVVYNLTGRHYETKNFTFNDVHVAGAQRIAQIA-EAAGVGRF  175

Query  581  IQVSCLGASPTSPS  622
            I VS L A   SPS
Sbjct  176  IHVSHLNADAESPS  189



>ref|XP_005569923.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Macaca fascicularis]
Length=304

 Score =   133 bits (335),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_007304718.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
 gb|EIM85758.1| NADH dehydrogenase [Stereum hirsutum FP-91666 SS1]
Length=379

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G  GRS+ +G VATVFG TGFLGRYLV +LAK G+QV+VP+R  ED  RHLK+MGD
Sbjct  35   IIAYGPPGRSATTGHVATVFGCTGFLGRYLVSKLAKAGTQVVVPYR-DEDEKRHLKVMGD  93

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQIVP++++ R E+ ++  +  +++V NL GREY+T+ +S  +VN   A ++A+++   
Sbjct  94   LGQIVPLEWDIRSENQIEECLRHSDIVYNLTGREYDTKRFSLHDVNSTGAGRIASVAAR-  152

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
             G+ RF+ VS L AS  SPSR 
Sbjct  153  AGVPRFVHVSHLNASRDSPSRF  174



>ref|XP_009989270.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial, partial [Tauraco erythrolophus]
Length=360

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  11   SVLHQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  70

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ+V ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  71   QYDLMYLRPMGDLGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  130

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + +++A I++E  G+  FI +S L AS  SPS+
Sbjct  131  IPKRIAQITRE-AGVETFIHISHLNASMKSPSK  162



>dbj|BAB22596.1| unnamed protein product [Mus musculus]
Length=377

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+LMGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
             GQ+  ++++ RD+ S++  V  +NVVINLIGRE+ETRN+ FE+V   +   +A  SKE 
Sbjct  100  PGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKE-  158

Query  563  GGIMRFIQVSCLGA  604
             G+ RFI VS L A
Sbjct  159  AGVERFIHVSHLNA  172



>ref|XP_006923900.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Pteropus alecto]
 gb|ELK02573.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Pteropus alecto]
Length=377

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQ+++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQIIIPHRCERYDIMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+NY FE+V   + + +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNYDFEDVFVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A   S SR
Sbjct  159  AGVEKLIHVSHLNADIKSSSR  179



>gb|KFV03415.1| hypothetical protein N340_03010, partial [Tauraco erythrolophus]
Length=361

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  12   SVLHQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  71

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ+V ++++ +D+ S++  V  +NVVINL+G+E+ET+N+SFE+V   
Sbjct  72   QYDLMYLRPMGDLGQLVFLEWDCKDKDSIRRAVEHSNVVINLVGKEWETKNFSFEDVFVN  131

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + +++A I++E  G+  FI +S L AS  SPS+
Sbjct  132  IPKRIAQITRE-AGVETFIHISHLNASMKSPSK  163



>ref|XP_004416912.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Odobenus rosmarus divergens]
Length=377

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSGIVATVFGATGFLGRY+V  L +MGSQV+VP+R       HL+ MGD
Sbjct  40   LIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIVPYRCDPYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ ++++ R++ S++  V  +NVVINL+GRE+ET+N+ FE++   +   +A  SKE 
Sbjct  100  LGQIIFLEWDGRNKDSIQRAVKHSNVVINLVGREWETKNFDFEDIFVMIPHAIAQASKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A   S SR
Sbjct  159  AGVEKLIHVSHLNADIKSSSR  179



>ref|XP_004438802.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Ceratotherium simum simum]
Length=377

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G GGRSSVSG+VATVFGATGFLGRY+V +L +MGSQV++P+R       +L+ MGD
Sbjct  40   LIPHGKGGRSSVSGVVATVFGATGFLGRYVVNRLGRMGSQVIIPYRCDTYDIMYLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N R++ S++  V  +NVVINL+GR++ET+N+ FE+V   +   +A +SKE 
Sbjct  100  LGQIIFLEWNGRNKDSIRRAVEHSNVVINLVGRDWETKNFDFEDVFVKIPLAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             GI +FI +S L A   S SR
Sbjct  159  AGIEKFIHISHLNADIKSSSR  179



>ref|NP_001187320.1| mitochondrial NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 
subunit 9 [Ictalurus punctatus]
 gb|ADO28492.1| mitochondrial NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 
subunit 9 [Ictalurus punctatus]
Length=380

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+ KG GGRSS SG+ ATVFGATGFLGRY+V +L ++GSQ+++P R  +    +L+ MGD
Sbjct  42   LIPKGKGGRSSFSGVAATVFGATGFLGRYVVNRLGRIGSQIVIPHRCDQYDLMYLRPMGD  101

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ M+++ +D+ S+K  ++ +NVVINL+GRE+ET NY +E+V   + +Q+A  S+E 
Sbjct  102  LGQIIFMEWDVKDKESIKRAISHSNVVINLVGREWETSNYKYEDVFVTIPQQIAKASRE-  160

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A   SPS+
Sbjct  161  AGVSKFIHVSHLNADIRSPSK  181



>ref|XP_570308.1| NADH dehydrogenase (ubiquinone) [Cryptococcus neoformans var. 
neoformans JEC21]
 ref|XP_775794.1| hypothetical protein CNBD5230 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL21147.1| hypothetical protein CNBD5230 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW43001.1| NADH dehydrogenase (ubiquinone), putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=411

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = +2

Query  170  STLTASKGVGHLVRKG--TGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRG  343
            S    S  V   +R G  TGGRSS SG   TVFG+TGFL RYL+Q+LA+ G+QV+VP+R 
Sbjct  34   SPPNPSASVRPAIRYGPPTGGRSSDSGRTVTVFGSTGFLARYLIQKLARQGTQVIVPYR-  92

Query  344  SEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNH  523
             ED  R L+  GDLGQIVP++++ R        V  A+VV NL+GR+YETRNYS+++VN 
Sbjct  93   DEDEKRRLRPCGDLGQIVPLEWDARIPEQTAECVKHADVVYNLVGRDYETRNYSYDDVNV  152

Query  524  YMAEQLAAISKEHGGIMRFIQVSCLGASPTSPS  622
             +A+ +A IS +   I R I VS + A+P SPS
Sbjct  153  KVAQSIAEISADM-NIPRLIHVSHINANPESPS  184



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 1/136 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            GTGGRSS SGI  TVFG+TGFLGRY+   +AK GS++++P R  E+  +HLK+MGDLGQI
Sbjct  21   GTGGRSSFSGITCTVFGSTGFLGRYVTHHVAKSGSRMILPTRCGENDRQHLKVMGDLGQI  80

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            + M Y   DE +++  V ++NVVIN++GRE+ETRN+SFE+V+    ++LA I  +  G+ 
Sbjct  81   LQMDYAISDEGAIRHAVERSNVVINMVGREWETRNFSFEDVHVTFPKKLAEICAD-VGVR  139

Query  575  RFIQVSCLGASPTSPS  622
            R I VS LGA+   PS
Sbjct  140  RLIHVSALGAADDHPS  155



>ref|XP_009092324.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Serinus canaria]
Length=373

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  25   SVLQQHRQVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVVIPYRCD  84

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ++ ++++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  85   QYDLMYLRPMGDLGQLLFLEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFRFEDEFVN  144

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + + +A ISKE  G+ +FI +S L AS  SPS+
Sbjct  145  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSK  176



>gb|EHH20407.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca mulatta]
 gb|EHH66007.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Macaca fascicularis]
Length=377

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_005426929.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Geospiza fortis]
Length=454

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +2

Query  170  STLTASKGVGH-LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGS  346
            S L   + V H ++  G  GRSSVSGIVATVFGATGFLGRY+V +L ++GSQV++P+R  
Sbjct  106  SVLQQHRLVHHAVIPHGRSGRSSVSGIVATVFGATGFLGRYVVNRLGRIGSQVIIPYRCD  165

Query  347  EDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHY  526
            +    +L+ MGDLGQ++ M+++ RD+ S++  V  +NVVINLIG+E+ET+N+ FE+    
Sbjct  166  QYDLMYLRPMGDLGQLLFMEWDCRDKDSIRRAVEHSNVVINLIGKEWETKNFKFEDEFVN  225

Query  527  MAEQLAAISKEHGGIMRFIQVSCLGASPTSPSR  625
            + + +A ISKE  G+ +FI +S L AS  SPS+
Sbjct  226  IPQSIAQISKE-AGVEKFIHISHLNASMKSPSK  257



>gb|KIK24507.1| hypothetical protein PISMIDRAFT_401487 [Pisolithus microcarpus 
441]
Length=363

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 108/164 (66%), Gaps = 6/164 (4%)
 Frame = +2

Query  149  IDTPRYASTLTASKGVGHLVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVL  328
            I + R    L    G   ++  G  G S+VSG V TVFG TGFLGRYLV +LA+MG+QV+
Sbjct  16   IQSKRALHDLVTLPGRKPVISYGPPGYSAVSGHVVTVFGCTGFLGRYLVSKLARMGTQVV  75

Query  329  VPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDESSvkavvakanvvINLIGREYET----R  496
            VP+R  ED  R LK MGDLGQIV M+++ R+E  +   +  +++V NL+GR+YET    R
Sbjct  76   VPYR-DEDEKRLLKPMGDLGQIVSMEWDIRNEDQIAECLRHSDIVYNLVGRDYETNSDHR  134

Query  497  NYSFEEVNHYMAEQLAAISKEHGGIMRFIQVSCLGASPTSPSRM  628
            N+ F +V+   AE+LA ++ +H G+ RF+ VS L ASPTS S+ 
Sbjct  135  NFKFADVHVAGAERLAKVAADH-GVQRFVHVSHLNASPTSTSQF  177



>ref|XP_007399771.1| hypothetical protein PHACADRAFT_199484 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM51980.1| hypothetical protein PHACADRAFT_199484 [Phanerochaete carnosa 
HHB-10118-sp]
Length=363

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G  GRS+ +G V TVFG TGFLGRYLV +LAK GSQ++VP+R  ED  RHLK MGD
Sbjct  32   VISYGPPGRSADTGHVVTVFGCTGFLGRYLVAKLAKAGSQIIVPYR-DEDEKRHLKPMGD  90

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQIVPM++N R    ++  +  ++ V NL+GR+YET+N+ F +V+   AE++A I+ + 
Sbjct  91   LGQIVPMEWNLRRADQIEECLRHSDTVYNLVGRDYETKNFKFRDVHVDGAERIAKIAAQ-  149

Query  563  GGIMRFIQVSCLGAS  607
             G+ RFIQVS L AS
Sbjct  150  AGVPRFIQVSHLNAS  164



>ref|XP_005569922.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Macaca fascicularis]
Length=377

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSGIVATVFGATGFLGRY+V  L ++GSQV++P R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRIGSQVIIPHRCDIYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ET+N+ F++V   + + +A +SKE 
Sbjct  100  LGQLLFLEWDARDKDSIRRAVEHSNVVINLIGRDWETKNFDFDDVYVKIPQAIAQVSKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ +FI VS L A+  S SR
Sbjct  159  AGVEKFIHVSHLNANIKSSSR  179



>ref|XP_001876312.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR13814.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=314

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +2

Query  215  GTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQI  394
            G  G S+V+G   TVFG TGFLGRYLV +L KMG+QV+VP+R  ED  R LK MGDLGQI
Sbjct  7    GPPGYSAVAGRTVTVFGCTGFLGRYLVSKLGKMGTQVVVPYR-DEDEARLLKPMGDLGQI  65

Query  395  VPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGIM  574
            V M+++ RDE ++   +  ++ V NL+GR++ET+N+ ++ V  + AE++A I+ E  G+ 
Sbjct  66   VRMEWDLRDEKTIAECLRHSDTVFNLVGRDFETKNFDYKSVQVFGAERIAKIAAE-SGVS  124

Query  575  RFIQVSCLGASPTSPSRM  628
            RFIQ+S L AS  SPS+ 
Sbjct  125  RFIQLSHLNASENSPSKF  142



>gb|KDE07008.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Microbotryum 
violaceum p1A1 Lamole]
Length=378

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = +2

Query  212  KGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGDLGQ  391
            KG GGR S +G VATVFGATGFLGRYLV +LAK G+QV+VP+R  +D  RHLK+ GDLGQ
Sbjct  44   KGPGGRHSSTGHVATVFGATGFLGRYLVSKLAKAGTQVVVPYR-DQDEARHLKVCGDLGQ  102

Query  392  IVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEHGGI  571
            +VPM+++ ++++ ++  +  ++ V NL+GR+Y T+N+SF++V+   A +LA I+    G+
Sbjct  103  VVPMEWDLKNDTQIEECLRHSDTVYNLVGRDYTTKNFSFDDVHVSGARRLARIA-HISGV  161

Query  572  MRFIQVSCLGASPTSPSRM  628
             RFI +S L A+P S S+ 
Sbjct  162  SRFIHLSHLNAAPDSASQF  180



>ref|XP_004610502.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sorex araneus]
Length=378

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            +V  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  41   VVPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDLMHLRPMGD  100

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQI+ +++N RD+ S++  V ++NVVINL+GRE+ETRN+ FE+V   + + +A   KE 
Sbjct  101  LGQIIFLEWNGRDKDSIRRAVEQSNVVINLVGREWETRNFGFEDVYVKIPQTIAQTCKE-  159

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ + I VS L A   S S+
Sbjct  160  VGVEKLIHVSHLNADIKSSSK  180



>emb|CCA67799.1| probable NADH2 dehydrogenase (ubiquinone) 40K chain [Piriformospora 
indica DSM 11827]
Length=365

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            L+  G  GRS+V+G VATVFG TGFLGRYLV +LAK G+QV+VP+R  E+  RHL+ MGD
Sbjct  29   LISYGPPGRSAVTGHVATVFGCTGFLGRYLVAKLAKNGTQVIVPYR-DENTKRHLRPMGD  87

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQIVP++ + R+   ++  V  +++V NLIGR+YET+N+ F  VN   A  +A IS E 
Sbjct  88   LGQIVPLELDIRNPQQIEEAVRHSDIVYNLIGRDYETKNFDFASVNKMGAADIARISAE-  146

Query  563  GGIMRFIQVSCLGASPTSPSRM  628
             G+ R + VS + A+  SPS+ 
Sbjct  147  SGVPRLVHVSHINAAADSPSKF  168



>gb|ERE67037.1| putative polypeptide N-acetylgalactosaminyltransferase 8-like 
protein [Cricetulus griseus]
Length=958

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  203  LVRKGTGGRSSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDCHRHLKLMGD  382
            ++  G GGRSSVSG+VATVFGATGFLGRY+V  L +MGSQV++P+R       HL+ MGD
Sbjct  40   VIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDTYDTMHLRPMGD  99

Query  383  LGQIVPMKYNPRDESSvkavvakanvvINLIGREYETRNYSFEEVNHYMAEQLAAISKEH  562
            LGQ++ ++++ RD+ S++  V  +NVVINLIGR++ETRN+ FE++   + + +A  SKE 
Sbjct  100  LGQLIFLEWDARDKDSIRRAVQHSNVVINLIGRDWETRNFDFEDIFVKIPQAIAQASKE-  158

Query  563  GGIMRFIQVSCLGASPTSPSR  625
             G+ R I VS L AS  S SR
Sbjct  159  AGVERLIHVSHLNASMKSSSR  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250