BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028M24

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794575.1|  PREDICTED: threonine--tRNA ligase, mitochond...    301   5e-94   Nicotiana sylvestris
ref|XP_009622103.1|  PREDICTED: threonine--tRNA ligase, mitochond...    295   1e-91   Nicotiana tomentosiformis
ref|XP_006355966.1|  PREDICTED: threonine--tRNA ligase, mitochond...    284   3e-87   Solanum tuberosum [potatoes]
ref|XP_004238685.1|  PREDICTED: threonine--tRNA ligase, mitochond...    282   1e-86   Solanum lycopersicum
ref|XP_011076219.1|  PREDICTED: threonine--tRNA ligase, mitochond...    280   9e-86   Sesamum indicum [beniseed]
ref|XP_004246064.1|  PREDICTED: threonine--tRNA ligase, mitochond...    276   8e-85   Solanum lycopersicum
gb|EPS72288.1|  hypothetical protein M569_02470                         276   8e-85   Genlisea aurea
ref|XP_010644571.1|  PREDICTED: threonine--tRNA ligase, mitochond...    276   9e-85   Vitis vinifera
ref|XP_006355233.1|  PREDICTED: threonine--tRNA ligase, mitochond...    276   1e-84   Solanum tuberosum [potatoes]
ref|XP_002265302.1|  PREDICTED: threonine--tRNA ligase, mitochond...    273   1e-83   Vitis vinifera
ref|XP_010274328.1|  PREDICTED: threonine--tRNA ligase, mitochond...    270   4e-83   
emb|CDP00192.1|  unnamed protein product                                271   1e-82   Coffea canephora [robusta coffee]
ref|XP_007157476.1|  hypothetical protein PHAVU_002G072800g             271   2e-82   Phaseolus vulgaris [French bean]
ref|XP_010274327.1|  PREDICTED: threonine--tRNA ligase, mitochond...    271   2e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006438442.1|  hypothetical protein CICLE_v100308252mg            261   8e-82   
gb|KDO82530.1|  hypothetical protein CISIN_1g0066802mg                  258   1e-81   Citrus sinensis [apfelsine]
ref|XP_004167577.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    260   2e-81   
ref|XP_010272819.1|  PREDICTED: threonine--tRNA ligase, mitochond...    266   9e-81   Nelumbo nucifera [Indian lotus]
ref|XP_003613276.1|  Threonyl-tRNA synthetase                           265   2e-80   Medicago truncatula
ref|XP_008460557.1|  PREDICTED: threonine--tRNA ligase, mitochond...    265   2e-80   Cucumis melo [Oriental melon]
ref|XP_010100498.1|  Threonine--tRNA ligase                             263   3e-80   
ref|XP_010044651.1|  PREDICTED: threonine--tRNA ligase, mitochond...    264   1e-79   Eucalyptus grandis [rose gum]
gb|EYU25062.1|  hypothetical protein MIMGU_mgv1a002240mg                262   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_003519592.1|  PREDICTED: threonine--tRNA ligase, mitochond...    262   3e-79   Glycine max [soybeans]
ref|XP_004142299.1|  PREDICTED: threonine--tRNA ligase, mitochond...    262   4e-79   Cucumis sativus [cucumbers]
ref|XP_006483810.1|  PREDICTED: threonine--tRNA ligase, mitochond...    262   5e-79   Citrus sinensis [apfelsine]
ref|XP_002521030.1|  threonyl-tRNA synthetase, putative                 261   9e-79   
ref|XP_004489863.1|  PREDICTED: threonine--tRNA ligase, mitochond...    261   1e-78   Cicer arietinum [garbanzo]
gb|KDP21323.1|  hypothetical protein JCGZ_21794                         259   2e-78   Jatropha curcas
ref|XP_003517788.1|  PREDICTED: threonine--tRNA ligase, mitochond...    259   5e-78   Glycine max [soybeans]
gb|KHN00337.1|  Threonine--tRNA ligase, mitochondrial                   259   6e-78   Glycine soja [wild soybean]
ref|XP_010533069.1|  PREDICTED: threonine--tRNA ligase, mitochond...    258   2e-77   Tarenaya hassleriana [spider flower]
gb|KJB48102.1|  hypothetical protein B456_008G053600                    257   4e-77   Gossypium raimondii
ref|XP_008361801.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    257   5e-77   
ref|XP_009360487.1|  PREDICTED: threonine--tRNA ligase, mitochond...    256   5e-77   Pyrus x bretschneideri [bai li]
ref|XP_004296467.2|  PREDICTED: threonine--tRNA ligase, mitochond...    257   5e-77   Fragaria vesca subsp. vesca
ref|XP_006394912.1|  hypothetical protein EUTSA_v10003725mg             256   5e-77   Eutrema salsugineum [saltwater cress]
ref|XP_007044584.1|  Threonyl-tRNA synthetase isoform 3                 255   8e-77   
ref|XP_007044582.1|  Threonyl-tRNA synthetase isoform 1                 256   1e-76   
ref|XP_007225203.1|  hypothetical protein PRUPE_ppa002055mg             255   2e-76   Prunus persica
ref|XP_008221771.1|  PREDICTED: threonine--tRNA ligase, mitochond...    255   2e-76   Prunus mume [ume]
ref|XP_007044585.1|  Threonyl-tRNA synthetase isoform 4                 252   4e-76   
ref|XP_007044583.1|  Threonyl-tRNA synthetase isoform 2                 252   7e-76   
ref|XP_010551550.1|  PREDICTED: threonine--tRNA ligase, mitochond...    253   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_008340003.1|  PREDICTED: threonine--tRNA ligase, mitochond...    251   2e-75   
ref|XP_006289423.1|  hypothetical protein CARUB_v10002922mg             251   8e-75   Capsella rubella
ref|XP_011021655.1|  PREDICTED: threonine--tRNA ligase, mitochond...    250   9e-75   Populus euphratica
ref|XP_010455043.1|  PREDICTED: threonine--tRNA ligase, mitochond...    250   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010493938.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010688668.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   3e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002872240.1|  AT5g26830/F2P16_90                                 249   4e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010913364.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   4e-74   Elaeis guineensis
ref|XP_011025470.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   4e-74   Populus euphratica
ref|XP_009111770.1|  PREDICTED: threonine--tRNA ligase, mitochond...    249   4e-74   Brassica rapa
ref|XP_002311580.2|  Threonyl-tRNA synthetase family protein            249   5e-74   Populus trichocarpa [western balsam poplar]
gb|KFK26446.1|  hypothetical protein AALP_AA8G249500                    248   7e-74   Arabis alpina [alpine rockcress]
ref|XP_006836673.1|  hypothetical protein AMTR_s00088p00069780          248   8e-74   
emb|CDX87030.1|  BnaC09g03450D                                          247   2e-73   
emb|CAA74705.1|  threonyl-tRNA synthetase                               246   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198035.2|  threonyl-tRNA synthetase                              246   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802022.1|  PREDICTED: threonine--tRNA ligase, mitochond...    245   1e-72   Phoenix dactylifera
gb|AAK82468.1|  AT5g26830/F2P16_90                                      244   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80596.1|  BnaC07g28480D                                          240   8e-71   
dbj|BAC41894.1|  unknown protein                                        224   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151164.1|  PREDICTED: threonine--tRNA ligase, mitochond...    236   2e-69   Brassica rapa
ref|XP_009412586.1|  PREDICTED: threonine--tRNA ligase, mitochond...    234   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_173238.1|  threonyl-tRNA synthetase                              224   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|EEE68426.1|  hypothetical protein OsJ_26793                          226   7e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83307.1|  hypothetical protein OsI_28676                          226   8e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001061475.1|  Os08g0295300                                       226   1e-65   
dbj|BAI39857.1|  putative threonyl-tRNA synthetase                      226   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_008664856.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    224   5e-65   Zea mays [maize]
ref|XP_004973168.1|  PREDICTED: threonine--tRNA ligase, mitochond...    224   1e-64   Setaria italica
ref|XP_008644625.1|  PREDICTED: threonine--tRNA ligase, mitochond...    223   2e-64   
ref|XP_003573669.1|  PREDICTED: threonine--tRNA ligase, mitochond...    223   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_002892976.1|  hypothetical protein ARALYDRAFT_472010             217   3e-64   
ref|XP_002464119.1|  hypothetical protein SORBIDRAFT_01g012680          223   4e-64   Sorghum bicolor [broomcorn]
dbj|BAJ93554.1|  predicted protein                                      222   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659275.1|  PREDICTED: threonine--tRNA ligase, mitochond...    220   2e-63   Oryza brachyantha
ref|XP_007199721.1|  hypothetical protein PRUPE_ppa002288mg             219   3e-63   Prunus persica
ref|XP_004968434.1|  PREDICTED: threonine--tRNA ligase, mitochond...    219   4e-63   Setaria italica
gb|EMT11254.1|  Threonyl-tRNA synthetase, mitochondrial                 220   3e-62   
ref|XP_001784310.1|  predicted protein                                  216   4e-62   
emb|CDM81189.1|  unnamed protein product                                215   1e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006303165.1|  hypothetical protein CARUB_v10008521mg             214   2e-61   Capsella rubella
ref|XP_010476961.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    208   7e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006378416.1|  Threonyl-tRNA synthetase family protein            211   3e-60   
ref|XP_009117622.1|  PREDICTED: threonine--tRNA ligase, mitochond...    208   2e-59   Brassica rapa
gb|EMS59266.1|  Threonyl-tRNA synthetase, mitochondrial                 211   4e-59   Triticum urartu
emb|CDY21715.1|  BnaA09g44660D                                          205   2e-58   Brassica napus [oilseed rape]
ref|XP_007200687.1|  hypothetical protein PRUPE_ppa017189mg             205   5e-58   Prunus persica
ref|XP_010480524.1|  PREDICTED: probable threonine--tRNA ligase, ...    202   7e-57   
gb|AAB61048.1|  Similar to threonyl-tRNA synthetase; coded for by...    196   9e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304268.2|  PREDICTED: threonine--tRNA ligase, mitochond...    196   1e-54   Fragaria vesca subsp. vesca
ref|XP_008237148.1|  PREDICTED: threonine--tRNA ligase, mitochond...    189   2e-52   
ref|XP_007204844.1|  hypothetical protein PRUPE_ppa026578mg             167   2e-48   
emb|CDY19754.1|  BnaA09g04070D                                          176   7e-48   Brassica napus [oilseed rape]
ref|XP_002991732.1|  hypothetical protein SELMODRAFT_134156             169   3e-45   
ref|XP_002989765.1|  hypothetical protein SELMODRAFT_130418             169   3e-45   
ref|XP_005837214.1|  hypothetical protein GUITHDRAFT_93029              156   1e-40   Guillardia theta CCMP2712
gb|KHN12091.1|  Threonine--tRNA ligase, mitochondrial                   154   4e-40   Glycine soja [wild soybean]
gb|EST08708.1|  threonyl-tRNA synthetase                                155   7e-40   Kalmanozyma brasiliensis GHG001
dbj|GAC98443.1|  threonyl-tRNA synthetase                               154   1e-39   Pseudozyma hubeiensis SY62
ref|XP_004296468.1|  PREDICTED: probable threonine--tRNA ligase, ...    142   3e-39   Fragaria vesca subsp. vesca
emb|CCF49315.1|  probable THS1-threonyl tRNA synthetase, cytosolic      153   3e-39   Ustilago hordei
ref|XP_007880033.1|  hypothetical protein PFL1_04316                    152   8e-39   Anthracocystis flocculosa PF-1
emb|CBQ69805.1|  probable THS1-threonyl tRNA synthetase, cytosolic      152   9e-39   Sporisorium reilianum SRZ2
dbj|GAK66757.1|  threonyl-tRNA synthetase                               151   1e-38   Moesziomyces antarcticus
ref|XP_011391697.1|  putative threonine--tRNA ligase THS1               151   1e-38   Ustilago maydis 521
dbj|GAC77380.1|  threonyl-trna synthetase                               150   3e-38   Moesziomyces antarcticus T-34
gb|ETS60492.1|  hypothetical protein PaG_05336                          150   4e-38   Moesziomyces aphidis DSM 70725
gb|EPB83961.1|  threonyl-tRNA synthetase                                150   4e-38   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN09335.1|  threonyl-tRNA synthetase                               149   5e-38   Mucor ambiguus
ref|XP_003080220.1|  putative threonyl-tRNA synthetase (ISS)            149   7e-38   
emb|CCV00396.1|  unnamed protein product                                149   7e-38   Malassezia sympodialis ATCC 42132
emb|CEG83597.1|  Putative Threonyl-tRNA synthetase                      140   7e-38   Rhizopus microsporus
emb|CEF98631.1|  Anticodon-binding                                      149   9e-38   Ostreococcus tauri
ref|XP_002771785.1|  threonyl-tRNA synthetase, putative                 149   2e-37   Perkinsus marinus ATCC 50983
emb|CEP09308.1|  hypothetical protein                                   149   2e-37   Parasitella parasitica
gb|KIY63302.1|  threonyl-tRNA synthetase                                147   2e-37   Cylindrobasidium torrendii FP15055 ss-10
gb|KDN39007.1|  threonyl-tRNA synthetase                                148   2e-37   Tilletiaria anomala UBC 951
ref|XP_636821.1|  threonyl-tRNA synthetase                              147   3e-37   Dictyostelium discoideum AX4
gb|ESW99362.1|  Threonine--tRNA ligase, cytoplasmic                     147   3e-37   Ogataea parapolymorpha DL-1
gb|KIZ00239.1|  threonyl-tRNA synthetase                                147   3e-37   Monoraphidium neglectum
ref|NP_001022034.1|  Protein TARS-1, isoform b                          147   3e-37   Caenorhabditis elegans [roundworm]
ref|NP_001022033.1|  Protein TARS-1, isoform a                          147   4e-37   Caenorhabditis elegans [roundworm]
ref|XP_002432585.1|  Threonyl-tRNA synthetase, cytoplasmic, putative    147   4e-37   Pediculus humanus corporis [human body lice]
ref|XP_009919139.1|  PREDICTED: probable threonine--tRNA ligase 2...    142   5e-37   Haliaeetus albicilla
emb|CDI55881.1|  probable THS1-threonyl tRNA synthetase, cytosolic      147   6e-37   Melanopsichium pennsylvanicum 4
gb|KIJ16340.1|  hypothetical protein PAXINDRAFT_168488                  146   6e-37   Paxillus involutus ATCC 200175
gb|ENN74529.1|  hypothetical protein YQE_08853                          146   8e-37   Dendroctonus ponderosae
gb|EMD37085.1|  hypothetical protein CERSUDRAFT_84103                   146   9e-37   Gelatoporia subvermispora B
gb|KIK95681.1|  hypothetical protein PAXRUDRAFT_140136                  146   1e-36   Paxillus rubicundulus Ve08.2h10
gb|EFA05822.1|  hypothetical protein TcasGA2_TC008604                   145   1e-36   
ref|XP_008198247.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    145   1e-36   Tribolium castaneum [rust-red flour beetle]
ref|XP_967345.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic ...    145   1e-36   Tribolium castaneum [rust-red flour beetle]
emb|CEI97578.1|  Putative Threonyl-trna synthetase                      143   2e-36   Rhizopus microsporus
gb|KIP05628.1|  hypothetical protein PHLGIDRAFT_24993                   145   2e-36   Phlebiopsis gigantea 11061_1 CR5-6
gb|EIE81909.1|  hypothetical protein RO3G_06614                         144   3e-36   Rhizopus delemar RA 99-880
gb|KFV55285.1|  putative threonine--tRNA ligase 2, cytoplasmic          144   3e-36   Tyto alba [Schleiereule]
ref|XP_009968247.1|  PREDICTED: probable threonine--tRNA ligase 2...    144   4e-36   Tyto alba [Schleiereule]
gb|KFM74402.1|  Threonine--tRNA ligase, cytoplasmic                     144   4e-36   Stegodyphus mimosarum
gb|KIJ63654.1|  hypothetical protein HYDPIDRAFT_175966                  144   4e-36   Hydnomerulius pinastri MD-312
ref|XP_010160781.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   4e-36   Antrostomus carolinensis
ref|XP_006455238.1|  hypothetical protein AGABI2DRAFT_226641            144   5e-36   Agaricus bisporus var. bisporus H97
ref|XP_011158574.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    144   5e-36   
gb|EFZ18882.1|  hypothetical protein SINV_16250                         144   5e-36   
ref|XP_011158573.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    144   6e-36   
ref|XP_011397153.1|  Threonine-tRNA ligase, mitochondrial               144   7e-36   Auxenochlorella protothecoides
gb|KFH73555.1|  threonyl-tRNA synthetase                                144   7e-36   Mortierella verticillata NRRL 6337
gb|EMC81245.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        143   1e-35   
gb|KJA25358.1|  hypothetical protein HYPSUDRAFT_64939                   143   1e-35   Hypholoma sublateritium FD-334 SS-4
emb|CEG74606.1|  Putative Threonyl-tRNA synthetase                      143   1e-35   Rhizopus microsporus
gb|KFP72660.1|  putative threonine--tRNA ligase 2, cytoplasmic          142   1e-35   Apaloderma vittatum
ref|XP_002631322.1|  C. briggsae CBR-TRS-1 protein                      143   1e-35   Caenorhabditis briggsae
ref|XP_009867831.1|  PREDICTED: probable threonine--tRNA ligase 2...    142   1e-35   Apaloderma vittatum
gb|KIK27269.1|  hypothetical protein PISMIDRAFT_28163                   143   1e-35   Pisolithus microcarpus 441
emb|CAP23504.2|  Protein CBR-TARS-1                                     143   1e-35   Caenorhabditis briggsae
gb|EPE06040.1|  threonyl-trna synthetase                                143   1e-35   Ophiostoma piceae UAMH 11346
gb|KIO11143.1|  hypothetical protein M404DRAFT_13351                    142   2e-35   Pisolithus tinctorius Marx 270
ref|XP_008925398.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    142   2e-35   
ref|XP_005511265.1|  PREDICTED: probable threonine--tRNA ligase 2...    143   2e-35   
ref|XP_003288175.1|  threonyl-tRNA synthetase                           142   2e-35   Dictyostelium purpureum
gb|KFQ99509.1|  putative threonine--tRNA ligase 2, cytoplasmic          142   2e-35   Opisthocomus hoazin [hoatzin]
gb|KFP96981.1|  putative threonine--tRNA ligase 2, cytoplasmic          142   2e-35   Leptosomus discolor
ref|XP_010570569.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    143   2e-35   Haliaeetus leucocephalus
ref|XP_009944987.1|  PREDICTED: probable threonine--tRNA ligase 2...    142   2e-35   Leptosomus discolor
ref|XP_007769801.1|  threonyl-tRNA synthetase                           142   2e-35   Coniophora puteana RWD-64-598 SS2
ref|XP_003116880.1|  CRE-TARS-1 protein                                 142   2e-35   Caenorhabditis remanei
gb|KIM53290.1|  hypothetical protein SCLCIDRAFT_1222926                 142   2e-35   Scleroderma citrinum Foug A
gb|KDQ13759.1|  hypothetical protein BOTBODRAFT_44972                   142   3e-35   Botryobasidium botryosum FD-172 SS1
ref|XP_009934283.1|  PREDICTED: probable threonine--tRNA ligase 2...    142   3e-35   Opisthocomus hoazin [hoatzin]
ref|NP_001280151.1|  probable threonyl-tRNA synthetase 2, cytopla...    142   3e-35   Gallus gallus [bantam]
ref|XP_005650255.1|  threonyl-tRNA synthetase                           143   3e-35   Coccomyxa subellipsoidea C-169
ref|XP_009992825.1|  PREDICTED: probable threonine--tRNA ligase 2...    142   4e-35   Chaetura pelagica
gb|KHN80838.1|  Threonine--tRNA ligase, cytoplasmic                     139   4e-35   Toxocara canis
gb|ELU38637.1|  Ths1p                                                   142   4e-35   Rhizoctonia solani AG-1 IA
dbj|GAA98628.1|  hypothetical protein E5Q_05315                         142   4e-35   Mixia osmundae IAM 14324
ref|XP_009550526.1|  hypothetical protein HETIRDRAFT_65578              141   5e-35   Heterobasidion irregulare TC 32-1
emb|CDO68587.1|  hypothetical protein BN946_scf184996.g18               141   5e-35   Trametes cinnabarina
ref|XP_001418868.1|  predicted protein                                  141   5e-35   Ostreococcus lucimarinus CCE9901
ref|XP_010195073.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   5e-35   Colius striatus
ref|XP_007379420.1|  threonyl-tRNA synthetase                           141   6e-35   Punctularia strigosozonata HHB-11173 SS5
ref|XP_006675165.1|  hypothetical protein BATDEDRAFT_18299              141   6e-35   Batrachochytrium dendrobatidis JAM81
gb|EHJ63622.1|  hypothetical protein KGM_17077                          141   6e-35   
gb|KDD76365.1|  class II core domain (G, H, P, S and T) tRNA synt...    140   8e-35   Helicosporidium sp. ATCC 50920
ref|XP_005437495.1|  PREDICTED: probable threonine--tRNA ligase 2...    141   8e-35   
ref|XP_008554535.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   8e-35   Microplitis demolitor
gb|EJU01306.1|  threonyl-tRNA synthetase                                140   8e-35   Dacryopinax primogenitus
gb|KDQ50940.1|  hypothetical protein JAAARDRAFT_41579                   140   8e-35   Jaapia argillacea MUCL 33604
gb|KFQ76650.1|  putative threonine--tRNA ligase 2, cytoplasmic          140   9e-35   Phaethon lepturus
gb|KFP24546.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   9e-35   Colius striatus
ref|XP_007056480.1|  PREDICTED: probable threonine--tRNA ligase 2...    141   9e-35   
ref|XP_008554533.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   9e-35   Microplitis demolitor
gb|AAU89472.1|  theronyl tRNA synthatase-like protein                   136   9e-35   Aedes aegypti
ref|XP_007330835.1|  hypothetical protein AGABI1DRAFT_60603             140   1e-34   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001696198.1|  hypothetical protein CHLREDRAFT_167047             140   1e-34   Chlamydomonas reinhardtii
emb|CCO30571.1|  threonyl-tRNA synthetase                               139   1e-34   Rhizoctonia solani AG-1 IB
ref|XP_011264917.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   1e-34   Camponotus floridanus
gb|KDR13507.1|  Threonyl-tRNA synthetase, cytoplasmic                   141   1e-34   Zootermopsis nevadensis
gb|KIJ96896.1|  hypothetical protein K443DRAFT_681974                   140   1e-34   Laccaria amethystina LaAM-08-1
ref|XP_007316884.1|  hypothetical protein SERLADRAFT_368238             140   1e-34   Serpula lacrymans var. lacrymans S7.9
ref|XP_009980107.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   1e-34   Tauraco erythrolophus
gb|KFU87220.1|  putative threonine--tRNA ligase 2, cytoplasmic          140   1e-34   Chaetura pelagica
ref|XP_005025500.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   1e-34   
gb|KFW65406.1|  putative threonine--tRNA ligase 2, cytoplasmic          140   1e-34   Pygoscelis adeliae
ref|XP_011264916.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   1e-34   Camponotus floridanus
ref|XP_010287049.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   1e-34   Phaethon lepturus
ref|XP_009319874.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   1e-34   Pygoscelis adeliae
ref|XP_011264915.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    140   1e-34   Camponotus floridanus
ref|XP_007855570.1|  threonyl-trna synthetase                           140   1e-34   
gb|KFP03020.1|  putative threonine--tRNA ligase 2, cytoplasmic          139   1e-34   Calypte anna
gb|KFH72646.1|  threonyl-tRNA synthetase                                140   1e-34   Mortierella verticillata NRRL 6337
gb|KIK46023.1|  hypothetical protein CY34DRAFT_22231                    140   1e-34   Suillus luteus UH-Slu-Lm8-n1
ref|XP_005145729.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   2e-34   Melopsittacus undulatus
ref|XP_005234248.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   2e-34   
ref|XP_009553641.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   2e-34   Cuculus canorus
ref|XP_008494852.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   2e-34   Calypte anna
gb|KFO72069.1|  putative threonine--tRNA ligase 2, cytoplasmic          139   2e-34   Cuculus canorus
gb|EJW87440.1|  hypothetical protein WUBG_01653                         132   2e-34   Wuchereria bancrofti [agent of lymphatic filariasis]
emb|CEL59014.1|  threonyl-tRNA synthetase                               140   2e-34   Rhizoctonia solani AG-1 IB
gb|KFP34665.1|  putative threonine--tRNA ligase 2, cytoplasmic          139   2e-34   Chlamydotis macqueenii
ref|XP_001878968.1|  predicted protein                                  139   2e-34   Laccaria bicolor S238N-H82
ref|XP_008601338.1|  threonyl-tRNA synthetase                           140   2e-34   Beauveria bassiana ARSEF 2860
emb|CCE32326.1|  probable THS1-threonyl tRNA synthetase,cytosolic       140   2e-34   Claviceps purpurea 20.1
ref|XP_011406310.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    139   2e-34   
emb|CCG82579.1|  Threonyl-tRNA synthetase                               140   2e-34   Taphrina deformans PYCC 5710
ref|XP_009884085.1|  PREDICTED: probable threonine--tRNA ligase 2...    140   2e-34   Charadrius vociferus
ref|XP_010114469.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   3e-34   Chlamydotis macqueenii
ref|XP_003667634.1|  hypothetical protein NDAI_0A02330                  139   3e-34   Naumovozyma dairenensis CBS 421
ref|XP_006268868.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   3e-34   
ref|XP_006020081.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   3e-34   Alligator sinensis
gb|KIL94540.1|  hypothetical protein FAVG1_01471                        140   3e-34   Fusarium avenaceum
gb|KFV51513.1|  putative threonine--tRNA ligase 2, cytoplasmic          139   3e-34   Gavia stellata
gb|KFV00689.1|  putative threonine--tRNA ligase 2, cytoplasmic          139   3e-34   Tauraco erythrolophus
ref|XP_008043826.1|  tars protein                                       139   3e-34   Trametes versicolor FP-101664 SS1
ref|XP_009807382.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   3e-34   Gavia stellata
ref|XP_006672150.1|  threonine-tRNA ligase                              139   3e-34   Cordyceps militaris CM01
gb|EHK45204.1|  hypothetical protein TRIATDRAFT_128075                  139   3e-34   Trichoderma atroviride IMI 206040
gb|KFP47497.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   4e-34   Cathartes aura
gb|KIM92325.1|  hypothetical protein PILCRDRAFT_810369                  139   4e-34   Piloderma croceum F 1598
gb|KFO03777.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   4e-34   Balearica regulorum gibbericeps
gb|KFV95622.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   4e-34   Eurypyga helias
gb|KIJ28159.1|  hypothetical protein M422DRAFT_37403                    139   4e-34   Sphaerobolus stellatus SS14
gb|KFQ76130.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   4e-34   Phoenicopterus ruber ruber
ref|XP_010310509.1|  PREDICTED: probable threonine--tRNA ligase 2...    139   4e-34   Balearica regulorum gibbericeps
emb|CBY19737.1|  unnamed protein product                                139   4e-34   Oikopleura dioica
emb|CEJ81687.1|  Putative Threonyl-tRNA synthetase, cytoplasmic         139   4e-34   Torrubiella hemipterigena
ref|XP_007394540.1|  hypothetical protein PHACADRAFT_194288             139   4e-34   Phanerochaete carnosa HHB-10118-sp
emb|CBY35782.1|  unnamed protein product                                139   5e-34   Oikopleura dioica
gb|EFX86211.1|  hypothetical protein DAPPUDRAFT_127463                  138   5e-34   Daphnia pulex
ref|XP_010155633.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   5e-34   Eurypyga helias
ref|XP_009679776.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   5e-34   Struthio camelus australis
gb|KGQ05016.1|  Threonine--tRNA ligase, cytoplasmic                     139   5e-34   Beauveria bassiana D1-5
ref|XP_009679775.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   6e-34   Struthio camelus australis
ref|XP_007365562.1|  threonyl-tRNA synthetase                           138   6e-34   Dichomitus squalens LYAD-421 SS1
gb|KFM08256.1|  putative threonine--tRNA ligase 2, cytoplasmic          138   6e-34   Aptenodytes forsteri
ref|XP_011298382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    138   6e-34   Fopius arisanus
ref|XP_005987820.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   6e-34   Latimeria chalumnae
gb|EXK47356.1|  threonyl-tRNA synthetase                                139   7e-34   Fusarium oxysporum f. sp. melonis 26406
gb|EWZ50111.1|  threonyl-tRNA synthetase                                139   7e-34   Fusarium oxysporum Fo47
ref|XP_005648591.1|  threonyl-tRNA synthetase                           138   7e-34   Coccomyxa subellipsoidea C-169
gb|EWG38020.1|  threonyl-tRNA synthetase                                138   7e-34   Fusarium verticillioides 7600
ref|XP_002499537.1|  predicted protein                                  138   7e-34   Micromonas commoda
gb|EXM28576.1|  threonyl-tRNA synthetase                                138   7e-34   Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_009278712.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   7e-34   
ref|XP_011298380.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    138   8e-34   Fopius arisanus
gb|EXM10554.1|  threonyl-tRNA synthetase                                138   8e-34   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EWY94579.1|  threonyl-tRNA synthetase                                138   8e-34   Fusarium oxysporum FOSC 3-a
emb|CCT62045.1|  probable THS1-threonyl tRNA synthetase, cytosolic      138   8e-34   Fusarium fujikuroi IMI 58289
gb|EMT66828.1|  Threonyl-tRNA synthetase, cytoplasmic                   138   8e-34   Fusarium oxysporum f. sp. cubense race 4
gb|KHJ99685.1|  threonine--tRNA ligase                                  138   8e-34   Oesophagostomum dentatum [nodule worm]
ref|XP_505278.1|  YALI0F11231p                                          138   8e-34   Yarrowia lipolytica CLIB122
gb|EHK26348.1|  hypothetical protein TRIVIDRAFT_82314                   138   8e-34   Trichoderma virens Gv29-8
gb|EXA53764.1|  threonyl-tRNA synthetase                                138   8e-34   Fusarium oxysporum f. sp. pisi HDV247
ref|XP_011499017.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    137   8e-34   Ceratosolen solmsi marchali
gb|ENH60618.1|  Threonyl-tRNA synthetase, cytoplasmic                   138   9e-34   Fusarium oxysporum f. sp. cubense race 1
gb|KFV84725.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   9e-34   Struthio camelus australis
gb|KII91811.1|  hypothetical protein PLICRDRAFT_38662                   138   9e-34   Plicaturopsis crispa FD-325 SS-3
emb|CEJ02301.1|  Putative Threonyl-tRNA synthetase                      135   9e-34   
ref|XP_005987819.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   9e-34   
ref|XP_005987818.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   9e-34   
gb|EUC61236.1|  cytoplasmic threonine-tRNA ligase                       138   1e-33   
gb|KFP20154.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   1e-33   
emb|CEF69353.1|  Threonyl-tRNA synthetase                               137   1e-33   
ref|XP_002491958.1|  Threonyl-tRNA synthetase, essential cytoplas...    137   1e-33   
gb|KDQ32844.1|  hypothetical protein PLEOSDRAFT_1032700                 137   1e-33   
ref|XP_009642125.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   1e-33   
ref|XP_001658309.1|  AAEL001206-PA                                      137   1e-33   
ref|XP_005987817.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   1e-33   
ref|XP_009679773.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   1e-33   
ref|XP_002946221.1|  hypothetical protein VOLCADRAFT_102823             137   1e-33   
ref|XP_003053410.1|  predicted protein                                  137   1e-33   
gb|EGU89228.1|  hypothetical protein FOXB_00181                         138   1e-33   
ref|XP_001841372.2|  tars protein                                       137   1e-33   
ref|XP_009251840.1|  hypothetical protein FPSE_00445                    137   1e-33   
gb|KFO83315.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   1e-33   
ref|XP_010014179.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   1e-33   
ref|XP_005419820.1|  PREDICTED: probable threonine--tRNA ligase 2...    138   1e-33   
gb|KFP70847.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   1e-33   
gb|EPS93174.1|  hypothetical protein FOMPIDRAFT_1026618                 137   1e-33   
ref|XP_011317025.1|  threonyl-tRNA synthetase                           137   1e-33   
gb|EYB23886.1|  hypothetical protein FG05_01248                         137   1e-33   
ref|XP_005487937.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   1e-33   
gb|KFP63323.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   1e-33   
ref|XP_005285035.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   1e-33   
ref|XP_002420321.1|  threonyl-tRNA synthetase, cytoplasmic, putative    137   2e-33   
ref|XP_319682.4|  AGAP008929-PA                                         137   2e-33   
ref|XP_010131002.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   2e-33   
gb|KGL77238.1|  putative threonine--tRNA ligase 2, cytoplasmic          137   2e-33   
ref|XP_009076978.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   2e-33   
gb|EQK97771.1|  threonine-tRNA ligase                                   137   2e-33   
ref|XP_007303607.1|  threonyl-tRNA synthetase                           137   2e-33   
ref|XP_006780537.1|  PREDICTED: probable threonine--tRNA ligase 2...    136   2e-33   
ref|XP_002172490.1|  cytoplasmic threonine-tRNA ligase Trs1             137   2e-33   
ref|XP_004200388.1|  Piso0_002974                                       137   2e-33   
gb|ESA17167.1|  hypothetical protein GLOINDRAFT_345213                  137   2e-33   
gb|KGK38420.1|  hypothetical protein JL09_g2427                         137   2e-33   
gb|KFV92314.1|  putative threonine--tRNA ligase 2, cytoplasmic          136   2e-33   
gb|KEY67536.1|  hypothetical protein S7711_02454                        137   2e-33   
gb|KIM36149.1|  hypothetical protein M413DRAFT_20609                    137   2e-33   
gb|KFQ42737.1|  putative threonine--tRNA ligase 2, cytoplasmic          136   2e-33   
ref|XP_009576132.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   2e-33   
gb|KFZ63134.1|  putative threonine--tRNA ligase 2, cytoplasmic          136   2e-33   
ref|XP_005521510.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   2e-33   
ref|XP_006966394.1|  hypothetical protein TRIREDRAFT_49197              137   2e-33   
ref|XP_010212954.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   3e-33   
gb|KFA64144.1|  hypothetical protein S40285_00810                       137   3e-33   
ref|XP_001587735.1|  hypothetical protein SS1G_10975                    137   3e-33   
ref|XP_001550563.1|  hypothetical protein BC1G_11336                    137   3e-33   
dbj|GAM29123.1|  hypothetical protein SAMD00019534_122990               136   3e-33   
ref|XP_004933459.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   3e-33   
ref|XP_005913075.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   3e-33   
ref|XP_011342020.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   3e-33   
ref|XP_004933460.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   3e-33   
ref|XP_004539781.1|  PREDICTED: probable threonine--tRNA ligase 2...    137   3e-33   
ref|XP_005447730.1|  PREDICTED: probable threonine--tRNA ligase 2...    136   4e-33   
gb|KFV63505.1|  putative threonine--tRNA ligase 2, cytoplasmic          135   4e-33   
ref|XP_003955557.1|  hypothetical protein KAFR_0B01230                  136   4e-33   
ref|XP_011342019.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   4e-33   
gb|ETN67379.1|  threonyl-tRNA synthetase                                136   4e-33   
ref|XP_008158386.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   4e-33   
ref|XP_009044100.1|  hypothetical protein LOTGIDRAFT_103202             135   5e-33   
ref|XP_011145094.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    135   5e-33   
gb|EFN80796.1|  Threonyl-tRNA synthetase, cytoplasmic                   135   5e-33   
ref|XP_004531260.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   5e-33   
ref|XP_003437726.1|  PREDICTED: probable threonine--tRNA ligase 2...    136   5e-33   
ref|XP_011145093.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    135   5e-33   
ref|XP_005178932.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   5e-33   
ref|XP_002890262.1|  hypothetical protein ARALYDRAFT_889225             135   5e-33   
ref|XP_009909554.1|  PREDICTED: probable threonine--tRNA ligase 2...    136   5e-33   
ref|XP_003031033.1|  hypothetical protein SCHCODRAFT_77271              135   6e-33   
ref|XP_001603180.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    135   6e-33   
gb|KIM27789.1|  hypothetical protein M408DRAFT_329743                   135   6e-33   
ref|XP_002677200.1|  threonyl-tRNA synthetase                           135   6e-33   
gb|KIY49829.1|  tars protein                                            135   6e-33   
gb|KIK68334.1|  hypothetical protein GYMLUDRAFT_35720                   135   6e-33   
emb|CCE44005.1|  hypothetical protein CPAR2_502300                      136   6e-33   
gb|KDR74949.1|  hypothetical protein GALMADRAFT_249885                  135   6e-33   
ref|XP_002595927.1|  hypothetical protein BRAFLDRAFT_268618             135   7e-33   
ref|XP_008213480.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    135   7e-33   
ref|XP_009088363.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    136   7e-33   
ref|NP_001014042.1|  probable threonine--tRNA ligase 2, cytoplasmic     134   7e-33   
gb|KDN46541.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...    134   7e-33   
gb|ESZ90653.1|  threonyl-tRNA synthetase                                135   8e-33   
ref|XP_005052144.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   9e-33   
gb|KFW97023.1|  putative threonine--tRNA ligase 2, cytoplasmic          134   9e-33   
ref|XP_003489967.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    135   1e-32   
ref|XP_006874591.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   1e-32   
ref|XP_003703597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    135   1e-32   
ref|XP_009507742.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   1e-32   
gb|KFQ16963.1|  putative threonine--tRNA ligase 2, cytoplasmic          134   1e-32   
ref|XP_007958117.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   1e-32   
ref|XP_007343809.1|  threonyl-tRNA synthetase                           135   1e-32   
ref|XP_007958118.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   1e-32   
ref|XP_004351232.1|  threonyl-tRNA synthetase                           134   1e-32   
gb|KDE05999.1|  threonyl-tRNA synthetase, cytoplasmic                   135   1e-32   
ref|XP_003848298.1|  threonine--tRNA ligase                             132   1e-32   
ref|XP_005320128.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   1e-32   
gb|EKG10485.1|  hypothetical protein MPH_12343                          134   1e-32   
ref|XP_006874592.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   2e-32   
gb|ELK24179.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        133   2e-32   
ref|XP_005320127.1|  PREDICTED: probable threonine--tRNA ligase 2...    135   2e-32   
ref|XP_003058283.1|  predicted protein                                  134   2e-32   
gb|KFZ01149.1|  hypothetical protein V501_10191                         134   2e-32   
ref|XP_003397155.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    134   2e-32   
ref|XP_011290653.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
gb|KFY79763.1|  hypothetical protein V499_01279                         134   2e-32   
ref|XP_008942445.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
ref|XP_006811408.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
ref|XP_002550936.1|  threonyl-tRNA synthetase                           135   2e-32   
ref|XP_011055929.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
ref|XP_011055937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
ref|XP_005178933.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   2e-32   
ref|XP_006771831.1|  PREDICTED: probable threonine--tRNA ligase 2...    133   2e-32   
ref|XP_006975908.1|  PREDICTED: probable threonine--tRNA ligase 2...    134   2e-32   
gb|EYC34046.1|  hypothetical protein Y032_0001g216                      134   3e-32   
gb|ELR10251.1|  threonyl-tRNA synthetase                                134   3e-32   
ref|XP_010076081.1|  PREDICTED: probable threonine--tRNA ligase 2...    134   3e-32   
gb|KGU06567.1|  threonyl-tRNA synthetase, cytoplasmic                   134   3e-32   
gb|KGQ84983.1|  threonyl-tRNA synthetase, cytoplasmic                   134   3e-32   
gb|EEQ46063.1|  threonyl-tRNA synthetase                                133   3e-32   
ref|XP_004990683.1|  threonyl-tRNA synthetase isoform 2                 134   3e-32   
ref|XP_710514.1|  hypothetical protein CaO19.5685                       133   3e-32   
gb|KFU99128.1|  putative threonine--tRNA ligase 2, cytoplasmic          133   3e-32   
gb|KHC51738.1|  threonyl-tRNA synthetase, cytoplasmic                   133   3e-32   
gb|ERS96433.1|  threonine-tRNA ligase                                   134   3e-32   
gb|KHC33840.1|  threonyl-tRNA synthetase, cytoplasmic                   133   3e-32   
gb|KGU08168.1|  threonyl-tRNA synthetase, cytoplasmic                   133   3e-32   
gb|KGQ87066.1|  threonyl-tRNA synthetase, cytoplasmic                   133   3e-32   
gb|KIN00956.1|  hypothetical protein OIDMADRAFT_103659                  134   3e-32   
ref|XP_001452193.1|  hypothetical protein                               131   3e-32   
gb|KIH94797.1|  threonyl-tRNA synthetase                                134   3e-32   
gb|KFR02142.1|  putative threonine--tRNA ligase 2, cytoplasmic          133   3e-32   
ref|XP_007673015.1|  hypothetical protein BAUCODRAFT_30366              134   3e-32   
gb|KEQ91202.1|  hypothetical protein AUEXF2481DRAFT_8816                134   3e-32   
gb|EYC34047.1|  hypothetical protein Y032_0001g216                      134   4e-32   
ref|XP_006003382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   4e-32   
emb|CDQ73766.1|  unnamed protein product                                132   4e-32   
gb|EDM08408.1|  threonyl-tRNA synthetase-like 2, isoform CRA_a          134   4e-32   
ref|XP_004879582.1|  PREDICTED: probable threonine--tRNA ligase 2...    131   4e-32   
gb|KIL65999.1|  hypothetical protein M378DRAFT_75677                    133   4e-32   
ref|XP_009468051.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    134   4e-32   
ref|XP_008861219.1|  threonine-tRNA ligase                              133   4e-32   
ref|XP_005727652.1|  PREDICTED: probable threonine--tRNA ligase 2...    134   4e-32   
emb|CDR44075.1|  CYFA0S13e02894g1_1                                     133   4e-32   
gb|KFB38665.1|  AGAP008929-PA-like protein                              133   4e-32   
ref|XP_004623299.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    133   4e-32   
ref|XP_007931291.1|  hypothetical protein MYCFIDRAFT_45851              133   5e-32   
ref|XP_004658124.1|  PREDICTED: probable threonine--tRNA ligase 2...    133   5e-32   
ref|XP_006108820.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   5e-32   
ref|XP_008309055.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    133   5e-32   
ref|XP_001524878.1|  threonyl-tRNA synthetase                           133   5e-32   
ref|XP_008275872.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   6e-32   
ref|XP_001513531.2|  PREDICTED: probable threonine--tRNA ligase 2...    132   6e-32   
ref|XP_002164939.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   6e-32   
gb|KEQ62613.1|  threonyl-tRNA synthetase-like protein                   133   6e-32   
ref|XP_008275871.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    133   6e-32   
gb|EDZ71519.1|  YIL078Wp-like protein                                   132   7e-32   
ref|XP_003738717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   7e-32   
gb|KFZ14160.1|  hypothetical protein V502_06226                         134   7e-32   
ref|XP_005357853.1|  PREDICTED: probable threonine--tRNA ligase 2...    133   7e-32   
gb|EMG45420.1|  Threonyl-tRNA synthetase, cytoplasmic, putative         126   7e-32   
ref|XP_004531261.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   7e-32   
ref|XP_003867401.1|  Ths1 threonyl-tRNA synthetase                      134   7e-32   
gb|AJR47138.1|  Ths1p                                                   132   7e-32   
gb|EDN61420.1|  threonyl-tRNA synthetase                                132   7e-32   
ref|XP_005357852.1|  PREDICTED: probable threonine--tRNA ligase 2...    133   7e-32   
gb|AJR37072.1|  Ths1p                                                   132   7e-32   
gb|AJR53093.1|  Ths1p                                                   132   7e-32   
gb|AJR38945.1|  Ths1p                                                   132   7e-32   
gb|EDV09560.1|  threonyl-tRNA synthetase                                132   7e-32   
ref|NP_116578.3|  threonine--tRNA ligase THS1                           132   7e-32   
gb|EIW09934.1|  Ths1p                                                   132   8e-32   
ref|XP_011418148.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   8e-32   
ref|XP_006136948.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   8e-32   
emb|CAA26666.1|  unnamed protein product                                132   8e-32   
gb|AJR38174.1|  Ths1p                                                   132   8e-32   
gb|EHN06623.1|  Ths1p                                                   132   8e-32   
gb|EGA78432.1|  Ths1p                                                   132   8e-32   
ref|XP_010636533.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   8e-32   
emb|CDS08596.1|  Putative Threonyl-tRNA synthetase                      132   8e-32   
ref|XP_011418149.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   8e-32   
gb|KFY83935.1|  hypothetical protein V500_09757                         132   9e-32   
gb|EWG95461.1|  Ths1p                                                   132   9e-32   
emb|CDP91132.1|  Protein BM-TARS-1, isoform d                           132   1e-31   
ref|XP_004852723.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
ref|XP_002195014.2|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
ref|XP_004852724.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
ref|XP_004879581.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
dbj|GAA47460.1|  threonyl-tRNA synthetase                               132   1e-31   
ref|XP_010158119.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   1e-31   
gb|KFY16149.1|  hypothetical protein V492_01529                         132   1e-31   
gb|AJR39322.1|  Ths1p                                                   132   1e-31   
gb|EEU08659.1|  Ths1p                                                   132   1e-31   
ref|XP_005084486.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
gb|KIH54993.1|  threonine--tRNA ligase                                  130   1e-31   
ref|XP_010731410.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   1e-31   
ref|XP_009163294.1|  hypothetical protein T265_01087                    132   1e-31   
ref|XP_004067499.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   1e-31   
gb|KFY47332.1|  hypothetical protein V494_00035                         133   1e-31   
emb|CCK69517.1|  hypothetical protein KNAG_0C04150                      132   1e-31   
gb|KFY69405.1|  hypothetical protein V496_00263                         132   1e-31   
gb|KFY32296.1|  hypothetical protein V493_00327                         132   1e-31   
ref|XP_002999991.1|  threonyl-tRNA synthetase                           132   1e-31   
emb|CCA73856.1|  probable THS1-threonyl tRNA synthetase, cytosolic      131   1e-31   
emb|CDQ77454.1|  unnamed protein product                                132   1e-31   
gb|KDN71676.1|  putative threonyl-tRNA synthetase                       132   2e-31   
ref|XP_003691478.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    131   2e-31   
ref|XP_009656705.1|  threonyl-tRNA synthetase                           132   2e-31   
ref|XP_008081385.1|  Class II aaRS and biotin synthetase                132   2e-31   
ref|XP_010598480.1|  PREDICTED: probable threonine--tRNA ligase 2...    131   2e-31   
ref|XP_001845897.1|  threonyl-tRNA synthetase                           131   2e-31   
ref|XP_009862172.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    131   2e-31   
ref|XP_009862171.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    131   2e-31   
gb|KFY28417.1|  hypothetical protein V491_00475                         133   2e-31   
ref|XP_008685800.1|  PREDICTED: probable threonine--tRNA ligase 2...    131   2e-31   
ref|XP_008615206.1|  threonyl-tRNA synthetase                           131   2e-31   
ref|XP_006720450.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   2e-31   
gb|AJR45798.1|  Ths1p                                                   131   2e-31   



>ref|XP_009794575.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana sylvestris]
Length=725

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 183/211 (87%), Gaps = 4/211 (2%)
 Frame = +2

Query  23   TSQLLWRLIS---FRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQ  193
             S L WRL +    R PP     + +RRFS  P  MGKA K S AN+SA  +PKD++YLQ
Sbjct  4    ASPLYWRLFTQSICRRPPPCKQFLLLRRFSSEPP-MGKAAKGSEANSSAVSYPKDESYLQ  62

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            +VIPKRI+LF+SI+++Q LQRLSLSPDPIKIELP+G++KEGKKWNTTPLDIAKE+SKSLA
Sbjct  63   NVIPKRIALFQSIQNEQHLQRLSLSPDPIKIELPSGTMKEGKKWNTTPLDIAKEISKSLA  122

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
            SNALI+KVNGVLWD+ RPLEGDCKLELFTFDSDEGRDTFWHSSAHILG+S+E  YGCKLC
Sbjct  123  SNALIAKVNGVLWDLLRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGESLERTYGCKLC  182

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            IGPCTTRGEGFYYDAFYG+LGLNEDHFK+IE
Sbjct  183  IGPCTTRGEGFYYDAFYGELGLNEDHFKRIE  213



>ref|XP_009622103.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana tomentosiformis]
Length=721

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 3/212 (1%)
 Frame = +2

Query  11   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  190
            M+ A+      LI  R PP     + +R FS  P  MGK  K S AN+SA  +PKD++YL
Sbjct  1    MLLASRLFTQSLI--RRPPPCKQFLLLRSFSSEPP-MGKTPKGSEANSSAASYPKDESYL  57

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
            Q+VIPKRI+LFESI+++Q+LQRLSLSPDPIKIELP+G++KEGKKWNTTPLDIAKE+SKSL
Sbjct  58   QNVIPKRIALFESIQNEQRLQRLSLSPDPIKIELPSGTMKEGKKWNTTPLDIAKEISKSL  117

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            ASNALI+KVNGVLWD+ RPLEGDCKLELFTFDSDEGRDTFWHSSAHILG+S+E  YGCKL
Sbjct  118  ASNALIAKVNGVLWDLLRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGESLERTYGCKL  177

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFYG+LGLNEDHFK+IE
Sbjct  178  CIGPCTTRGEGFYYDAFYGELGLNEDHFKRIE  209



>ref|XP_006355966.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=725

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 181/212 (85%), Gaps = 6/212 (3%)
 Frame = +2

Query  23   TSQLLWRLI--SFRHPPSPSN--SIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  190
             S L WRL   S R PP P    S+F R FS  P  MGKA KSS AN+SA   PKD+ YL
Sbjct  4    ASPLCWRLFTQSIRRPPPPCKHFSLFRRCFS-SPPPMGKAAKSSEANSSA-SIPKDETYL  61

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
            Q+VIPKRI+LFES+++QQ+LQRL+LSPDPIKIEL +G++KEGK+WNTTP DIAKE+SKSL
Sbjct  62   QNVIPKRIALFESLQNQQRLQRLALSPDPIKIELVDGTIKEGKQWNTTPFDIAKEISKSL  121

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            A+NALI+KVNGVLWDM RPLEGDCKLE+F F+SDEGRDTFWHSSAHILG+S+E  +GCKL
Sbjct  122  AANALIAKVNGVLWDMLRPLEGDCKLEIFKFESDEGRDTFWHSSAHILGESLERTFGCKL  181

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFYGDLGLNEDHFK+I+
Sbjct  182  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKRIK  213



>ref|XP_004238685.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=725

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 180/212 (85%), Gaps = 6/212 (3%)
 Frame = +2

Query  23   TSQLLWRLI--SFRHPPSPSN--SIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  190
             S L WRL   S R PP P    SI  R FS  P  MGK  KS  AN+SA   PKD+ YL
Sbjct  4    ASPLCWRLFTQSIRRPPPPCKHFSILRRCFSSTPP-MGKTAKSCEANSSA-SIPKDETYL  61

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
            ++VIPKRI+LFESI++QQ+LQRL+LSPDPIKIEL +G++KEGKKWNTTPLDIAKE+SKSL
Sbjct  62   ENVIPKRIALFESIQNQQRLQRLALSPDPIKIELVDGTIKEGKKWNTTPLDIAKEISKSL  121

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            A+NALI+KVNGVLWD+SRPLEGDCKLE+F F++DEGRDTFWHSSAHILG+S+E  +GCKL
Sbjct  122  AANALIAKVNGVLWDLSRPLEGDCKLEIFKFETDEGRDTFWHSSAHILGESLERTFGCKL  181

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFYGDLGLNEDHF++I+
Sbjct  182  CIGPCTTRGEGFYYDAFYGDLGLNEDHFQRIK  213



>ref|XP_011076219.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Sesamum indicum]
Length=722

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P + KD+AYLQSVI KRI+LFESIK+QQ L RL+LSPD I+I LP+G VKEGKKWNTTP 
Sbjct  49   PAYSKDEAYLQSVIQKRIALFESIKNQQNLSRLALSPDQIQITLPDGKVKEGKKWNTTPF  108

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            D+AKE+SKSLASNALISKVNGVLWDM+RPLEGDCKLELFTFD+DEGRDTFWHSSAHILG+
Sbjct  109  DVAKEISKSLASNALISKVNGVLWDMNRPLEGDCKLELFTFDTDEGRDTFWHSSAHILGE  168

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGC+LCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE
Sbjct  169  SLEQTYGCRLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  210



>ref|XP_004246064.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=676

 Score =   276 bits (706),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            +P+D+ YL+ V+P+RI+LF SI++QQ+LQRLSLSPDPIKIELPNG+VKEGKKWNTTPLDI
Sbjct  5    YPRDENYLEIVVPRRIALFVSIQNQQRLQRLSLSPDPIKIELPNGTVKEGKKWNTTPLDI  64

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSL SNALI+KVNGVLWD+ RPLE DCKLELFTFDSDEGRDTFWHSSAHILG+S+
Sbjct  65   AKEISKSLGSNALIAKVNGVLWDLLRPLESDCKLELFTFDSDEGRDTFWHSSAHILGESL  124

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFK IE
Sbjct  125  ERKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKGIE  164



>gb|EPS72288.1| hypothetical protein M569_02470 [Genlisea aurea]
Length=690

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P+  KD+AYLQ+VIPKRI+LFESI++QQ+L  L+LSPDPI++ LP+G VKEGKKWNTTP 
Sbjct  17   PEFRKDEAYLQTVIPKRIALFESIQNQQKLSLLALSPDPIQVVLPDGKVKEGKKWNTTPF  76

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAK++SK+LASNALISKVNGVLWDM+RPLEGDC LELFTFD+DEGRDTFWHSSAHILG+
Sbjct  77   DIAKDISKNLASNALISKVNGVLWDMNRPLEGDCNLELFTFDTDEGRDTFWHSSAHILGE  136

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDAFYGDLGLN+DHFK IE
Sbjct  137  SLEQAYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDDHFKHIE  178



>ref|XP_010644571.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Vitis 
vinifera]
 emb|CBI39735.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDD YL  VIPKRI+LFESIKSQQ   R S+S DPIKI LP+G+VKEGKKW TTP DI
Sbjct  15   HPKDDEYLSCVIPKRIALFESIKSQQISHRRSISGDPIKITLPDGTVKEGKKWETTPFDI  74

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SK LASNALIS+VNGVLWDMSR LEGDC L+LFTFDSDEGRDTFWHSSAHILGQ++
Sbjct  75   AKEISKGLASNALISQVNGVLWDMSRALEGDCGLKLFTFDSDEGRDTFWHSSAHILGQAL  134

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFYG+LGLNEDHFKQIE
Sbjct  135  EMEYGCKLCIGPCTTRGEGFYYDAFYGELGLNEDHFKQIE  174



>ref|XP_006355233.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=676

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            +P+D+ YL+ V+P+RI+LF SI++QQ+LQRLSLSPDPIKIELPNG+VKEGKKWNTTPLDI
Sbjct  5    YPRDENYLEIVVPRRIALFVSIQNQQRLQRLSLSPDPIKIELPNGTVKEGKKWNTTPLDI  64

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSL SNALI+KVNGVLWD+ RPLE DCKLELFTFDSDEGRDTFWHSSAHILG+S+
Sbjct  65   AKEISKSLGSNALIAKVNGVLWDLLRPLESDCKLELFTFDSDEGRDTFWHSSAHILGESL  124

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFK IE
Sbjct  125  ERKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKGIE  164



>ref|XP_002265302.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Vitis vinifera]
 emb|CBI32119.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDD YL  VIPKRI++FESIK+QQ   R S+S DPIKI LP+G+VKEGKKW TTPLDI
Sbjct  15   HPKDDEYLSCVIPKRIAVFESIKAQQIAHRQSISGDPIKITLPDGTVKEGKKWATTPLDI  74

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SK LASNALIS VNG+LWDMSRPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQ++
Sbjct  75   AREISKGLASNALISLVNGILWDMSRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQAL  134

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E+ YGCKLCIGPCTTRGEGFYYDAFYG+LGLNEDHFK+IE
Sbjct  135  EVAYGCKLCIGPCTTRGEGFYYDAFYGELGLNEDHFKEIE  174



>ref|XP_010274328.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=582

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P HPKD+AYL SVI KRI LFE+IK+QQ  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  56   PSHPKDEAYLHSVIQKRIRLFEAIKAQQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  115

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAK +SKSLA+NALIS+VNGVLWDM RPLEGDC+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  116  DIAKGISKSLAANALISQVNGVLWDMFRPLEGDCELKLFTFEADEGRDTFWHSSAHILGQ  175

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+EM+YGCKLCIGPCTTRGEGFYYDAFYGDLGLNED+FKQIE
Sbjct  176  SLEMEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDYFKQIE  217



>emb|CDP00192.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 167/217 (77%), Gaps = 14/217 (6%)
 Frame = +2

Query  23   TSQLLWRLISFRHPPSPSNS-IFIRRFSLR--------PSQMGKADKssaannsaPDHPK  175
            TSQL WR         P  S +  R F LR        P  MG A   S      P  PK
Sbjct  4    TSQLCWRFALLLRRLPPPPSGLHFRTFLLRHCSSLHSPPLPMGTASNDSG-----PSVPK  58

Query  176  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  355
            D+AYL + I KRI LF+SI+ +++LQRLSLSPDPI+I LP+GSVKEGKKWNTTP D+AKE
Sbjct  59   DEAYLATAINKRIDLFKSIQDREKLQRLSLSPDPIRIVLPDGSVKEGKKWNTTPFDVAKE  118

Query  356  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  535
            +SKSLASNALI+KV+G LWDM RPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQS+E  
Sbjct  119  ISKSLASNALIAKVDGALWDMHRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQSLEQT  178

Query  536  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            YGC+LCIGPCTTRGEGFYYDAFYGDLGLNEDHFK+I+
Sbjct  179  YGCRLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKRID  215



>ref|XP_007157476.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
 gb|ESW29470.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
Length=707

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 164/208 (79%), Gaps = 16/208 (8%)
 Frame = +2

Query  32   LLWRLISFRHPPSPSNSIF---IRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVI  202
            +L+ LI  R   SP + +    I RFS   + M               H KDDAYLQ+ I
Sbjct  1    MLYSLIRLRRYASPHSPLLRLPINRFSSAVAAMVA-------------HAKDDAYLQAAI  47

Query  203  PKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNA  382
            PKRI LF++I+++QQ QRLSLSPDPIK+ LP+G V+E KKW TTPLD+A+E+SK+LA+NA
Sbjct  48   PKRIQLFQTIQAEQQTQRLSLSPDPIKVNLPDGGVREAKKWLTTPLDVAREISKNLANNA  107

Query  383  LISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  562
            LI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+E +YGCKLCIGP
Sbjct  108  LIAKVNGVLWDMTRPLEEDCQLQIFKFDDDEGRDTFWHSSAHILGQSLETEYGCKLCIGP  167

Query  563  CTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CTTRGEGFYYDAFYGDLGLN+DHFKQIE
Sbjct  168  CTTRGEGFYYDAFYGDLGLNDDHFKQIE  195



>ref|XP_010274327.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=729

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P HPKD+AYL SVI KRI LFE+IK+QQ  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  56   PSHPKDEAYLHSVIQKRIRLFEAIKAQQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  115

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAK +SKSLA+NALIS+VNGVLWDM RPLEGDC+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  116  DIAKGISKSLAANALISQVNGVLWDMFRPLEGDCELKLFTFEADEGRDTFWHSSAHILGQ  175

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+EM+YGCKLCIGPCTTRGEGFYYDAFYGDLGLNED+FKQIE
Sbjct  176  SLEMEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDYFKQIE  217



>ref|XP_006438442.1| hypothetical protein CICLE_v100308252mg, partial [Citrus clementina]
 gb|ESR51682.1| hypothetical protein CICLE_v100308252mg, partial [Citrus clementina]
Length=403

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 161/218 (74%), Gaps = 19/218 (9%)
 Frame = +2

Query  5    CFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHP  172
            C  V AT     R IS   FR     PS++  +RR    PS               P+  
Sbjct  4    CAKVLATLTFNCRRISSQLFRCQNTKPSSATNLRRIRAMPS---------------PNQV  48

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DIA+
Sbjct  49   KDEEYLNKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDIAQ  108

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
             +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++E 
Sbjct  109  GISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAIEQ  168

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFYGDLGLN DHFK I+
Sbjct  169  QYGCKLCIGPCTTRGEGFYYDAFYGDLGLNPDHFKSID  206



>gb|KDO82530.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
 gb|KDO82531.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
 gb|KDO82532.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
Length=310

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 161/218 (74%), Gaps = 19/218 (9%)
 Frame = +2

Query  5    CFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHP  172
            C  + AT     R +S   FR     PS++  +RR    PS               P+  
Sbjct  4    CAKILATLTFNCRRVSSQLFRCQNTKPSSATNLRRICAMPS---------------PNPV  48

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DIA+
Sbjct  49   KDEEYLIKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDIAQ  108

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
             +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++E 
Sbjct  109  GISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAIEQ  168

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFYGDLGLN DHFK I+
Sbjct  169  QYGCKLCIGPCTTRGEGFYYDAFYGDLGLNPDHFKSID  206



>ref|XP_004167577.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN49713.1| hypothetical protein Csa_5G080790 [Cucumis sativus]
Length=412

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL + IPKRI LF+SI++Q    R SL    IKI LP+G++KEG+KW T PLD+
Sbjct  53   HPKDEAYLSTTIPKRIQLFQSIQAQILADRSSLPSHQIKITLPDGTMKEGQKWKTAPLDV  112

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFY DLGLN+DHFKQIE
Sbjct  173  EMEYGCKLCIGPCTTRGEGFYYDAFYDDLGLNDDHFKQIE  212



>ref|XP_010272819.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nelumbo 
nucifera]
Length=726

 Score =   266 bits (681),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P H KD+AYL+SVI KRI LFE+IK++Q  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  53   PSHAKDEAYLESVIQKRIRLFEAIKAKQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  112

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIA+++SKSLA+NALIS+VNG LWDM RPLEG C+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  113  DIARDISKSLAANALISQVNGTLWDMLRPLEGHCELKLFTFETDEGRDTFWHSSAHILGQ  172

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+EM+YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE
Sbjct  173  SLEMEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  214



>ref|XP_003613276.1| Threonyl-tRNA synthetase [Medicago truncatula]
 gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=711

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 19/215 (9%)
 Frame = +2

Query  11   MVCATSQLLWRLISFRHPPSPSNSIFIR---RFSLRPSQMGKADKssaannsaPDHPKDD  181
            M+C+  +L       R+ PS + S+F+    RF+   S                 HPKD+
Sbjct  1    MLCSLIRLR------RNIPSSTTSLFLHIGNRFNFSSSAAAMV----------VAHPKDE  44

Query  182  AYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELS  361
            +YL + IPKR+ +FE+++++QQ +RLSLSPDPIK+ LP+G+VKEGKKW TTP DIA+E+S
Sbjct  45   SYLAATIPKRVQIFEALQAEQQTRRLSLSPDPIKVTLPDGNVKEGKKWQTTPFDIAREIS  104

Query  362  KSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  541
            K+LA+NALISKVNGVLWDM+RPLE D  L+LF FD DEGRDTFWHSSAHILGQS+E +YG
Sbjct  105  KNLANNALISKVNGVLWDMNRPLEEDSSLQLFKFDDDEGRDTFWHSSAHILGQSLETEYG  164

Query  542  CKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CKLCIGPCTTRGEGFYYDAFYGDLGLN+DHFKQIE
Sbjct  165  CKLCIGPCTTRGEGFYYDAFYGDLGLNDDHFKQIE  199



>ref|XP_008460557.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cucumis melo]
Length=724

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+ YL + IPKRI LF+SI++Q    R SL   PIKI LP+G++KEG+KW TTPLD+
Sbjct  53   HPKDETYLSTTIPKRIQLFQSIQAQLLADRSSLPSHPIKITLPDGTMKEGQKWKTTPLDV  112

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFY DLGLN+DHFKQIE
Sbjct  173  EMEYGCKLCIGPCTTRGEGFYYDAFYDDLGLNDDHFKQIE  212



>ref|XP_010100498.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXB82632.1| Threonine--tRNA ligase [Morus notabilis]
Length=625

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  349
            PKD+AYL +VIPKRI LFESIK+QQQ++RLSL  DPIKI LP+G+VKEGKKW T+P D+A
Sbjct  62   PKDEAYLNAVIPKRIQLFESIKAQQQVERLSLQSDPIKITLPDGTVKEGKKWVTSPFDVA  121

Query  350  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  529
            KE+SKSLA+NALIS+VNGVLWDM+RPLEGDC+L+LFTF+SDEGRDTFWHSSAHILGQ++E
Sbjct  122  KEISKSLAANALISQVNGVLWDMTRPLEGDCELKLFTFESDEGRDTFWHSSAHILGQALE  181

Query  530  MKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            M+YGCKLCIGPCTTRGEGFYYDA+YGD GLN+ + K+I+
Sbjct  182  MEYGCKLCIGPCTTRGEGFYYDAYYGDFGLNDKNLKKID  220



>ref|XP_010044651.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW86747.1| hypothetical protein EUGRSUZ_B03357 [Eucalyptus grandis]
Length=737

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+ YL+ VIPKRI+LFESIK++Q  QR S++ +PIKI LP+GSVKEGKKW T+PLDIA+
Sbjct  68   KDENYLKLVIPKRIALFESIKAKQLSQRQSIAGEPIKITLPDGSVKEGKKWETSPLDIAR  127

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
             +SKSLA+NALIS+V+G LWDMSRPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQS+EM
Sbjct  128  GISKSLAANALISQVDGALWDMSRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQSLEM  187

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFY DLGLN+DHFKQIE
Sbjct  188  EYGCKLCIGPCTTRGEGFYYDAFYDDLGLNDDHFKQIE  225



>gb|EYU25062.1| hypothetical protein MIMGU_mgv1a002240mg [Erythranthe guttata]
Length=696

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 2/164 (1%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P   KD+ YLQ V+PKRI++FE+I ++Q L RL LSPDPIKI LP+G+VKEGKKWNTTPL
Sbjct  21   PAFVKDEDYLQRVVPKRIAMFETILNEQTLSRLQLSPDPIKITLPDGNVKEGKKWNTTPL  80

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            D+AKE+SKSLA+NALI+KV+GVLWDMSRP EGDCKLELF FD+DEGRDTFWHSSAHILG+
Sbjct  81   DVAKEISKSLAANALIAKVDGVLWDMSRPFEGDCKLELFNFDTDEGRDTFWHSSAHILGE  140

Query  521  SVEMKYGCKLCIGPCTTRGE--GFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGC+LCIGPCTTRG+  GFYYD FYGDLGLNEDHFK IE
Sbjct  141  SLEQAYGCRLCIGPCTTRGDLKGFYYDGFYGDLGLNEDHFKHIE  184



>ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=710

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD+AYL + IPKRI LFE+I ++Q  QRLSLSPDPIK+ LP+GSVKE KKW+TTPLD+
Sbjct  39   HAKDEAYLSATIPKRIRLFETILAEQHTQRLSLSPDPIKVTLPDGSVKEAKKWHTTPLDV  98

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  99   AREISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSL  158

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYG+LGLN+DHFKQIE
Sbjct  159  ETEYGCKLCIGPCTTRGEGFYYDAFYGELGLNDDHFKQIE  198



>ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=724

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL + IPKRI LF+SI++Q    R SL    IKI LP+G++KEG+KW T PLD+
Sbjct  53   HPKDEAYLSTTIPKRIQLFQSIQAQILADRSSLPSHQIKITLPDGTMKEGQKWKTAPLDV  112

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFY DLGLN+DHFKQIE
Sbjct  173  EMEYGCKLCIGPCTTRGEGFYYDAFYDDLGLNDDHFKQIE  212



>ref|XP_006483810.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=718

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 161/218 (74%), Gaps = 19/218 (9%)
 Frame = +2

Query  5    CFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHP  172
            C  V AT     R IS   FR     PS++  +RR    PS               P+  
Sbjct  4    CAKVLATLTFNCRRISSQLFRCQNTKPSSATNLRRICAMPS---------------PNQV  48

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DIA+
Sbjct  49   KDEEYLNKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDIAQ  108

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
             +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++E 
Sbjct  109  GISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAIEQ  168

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFYGDLGLN DHFK I+
Sbjct  169  QYGCKLCIGPCTTRGEGFYYDAFYGDLGLNPDHFKSID  206



>ref|XP_002521030.1| threonyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF41447.1| threonyl-tRNA synthetase, putative [Ricinus communis]
Length=691

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD++YL++VI KRI  FESIK+QQ  +  SL  D IKI LPNG+VKEGK+W ++P+DI
Sbjct  43   HPKDESYLRTVIDKRIKFFESIKAQQLSRLQSLEHDTIKISLPNGTVKEGKRWISSPMDI  102

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA+NALI++V+GVLWDM+RPLE +C+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  103  AKEISKSLAANALIAQVDGVLWDMNRPLETNCELKIFTFDSDEGRDTFWHSSAHILGQSL  162

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFYG+LGLNE+HFK+IE
Sbjct  163  EMEYGCKLCIGPCTTRGEGFYYDAFYGELGLNEEHFKKIE  202



>ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=719

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD++YL + IPKR+ +FESI+++QQ++RLSLS DPIK+ LP+GSVKEGKKW TTPLD+
Sbjct  48   HAKDESYLAATIPKRVRIFESIQAEQQIRRLSLSADPIKVTLPDGSVKEGKKWQTTPLDV  107

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SK+LA+NALI+KVNGVLWDM+RPLE D +L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  108  AREISKNLANNALIAKVNGVLWDMTRPLEEDSQLQIFRFDDDEGRDTFWHSSAHILGQSL  167

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYGDLGLN+DHFKQIE
Sbjct  168  ETEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDDHFKQIE  207



>gb|KDP21323.1| hypothetical protein JCGZ_21794 [Jatropha curcas]
Length=676

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL++VI KRI LFESIKSQQ     SL+ D IKI LP+G+VKEGKKW ++P+DI
Sbjct  5    HPKDEAYLKAVIDKRIKLFESIKSQQLASLQSLNHDTIKITLPDGTVKEGKKWLSSPMDI  64

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA+NALI++V+G LWDM+RPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AKEISKSLAANALIAQVDGTLWDMNRPLECDCELKLFTFDSDEGRDTFWHSSAHILGQSL  124

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  YGCKLCIGPCTTRGEGFYYDAFYG+LGLN++HFKQIE
Sbjct  125  EATYGCKLCIGPCTTRGEGFYYDAFYGELGLNDEHFKQIE  164



>ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=717

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD+AYL + IPKR+ LFE+I+++Q+ QRLSLSPDPIK+ LP+G+VK+ KKW +TPLD+
Sbjct  46   HAKDEAYLSAAIPKRVRLFETIQAEQRTQRLSLSPDPIKVTLPDGNVKDAKKWLSTPLDV  105

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  106  AREISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSL  165

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYGDLGLN+DHFKQIE
Sbjct  166  ETEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDDHFKQIE  205



>gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=725

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+AYL + IPKRI LFE+I ++Q  QRLSLSPDPIK+ LP+GSVKE KKW+TTPLD+A+
Sbjct  44   KDEAYLSATIPKRIRLFETILAEQHTQRLSLSPDPIKVTLPDGSVKEAKKWHTTPLDVAR  103

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+E 
Sbjct  104  EISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSLET  163

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFYG+LGLN+DHFKQIE
Sbjct  164  EYGCKLCIGPCTTRGEGFYYDAFYGELGLNDDHFKQIE  201



>ref|XP_010533069.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=714

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD++YL +VIPKRI LFE I++ Q  Q  SL  DPIKI LP+GSV+EGK+W TTP+DI
Sbjct  43   HPKDESYLSAVIPKRIKLFEQIQALQLEQLQSLPQDPIKITLPDGSVREGKRWATTPMDI  102

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A  +SK LA+NALIS VN VLWDMSRPLEGDC LE+FTFDSD+GRDTFWHSSAHILG+++
Sbjct  103  ALGISKGLAANALISSVNDVLWDMSRPLEGDCNLEIFTFDSDKGRDTFWHSSAHILGEAL  162

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHF +I+
Sbjct  163  EQEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFSKID  202



>gb|KJB48102.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=714

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 165/217 (76%), Gaps = 20/217 (9%)
 Frame = +2

Query  11   MVCATSQLLWRLISFRHPP-----SPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPK  175
            M+CA S  L R  SF HP       PS S  +R FS              A   A  HPK
Sbjct  1    MLCALSFALRRYYSF-HPALFLLSKPSFSSPLRLFS--------------AFTMASSHPK  45

Query  176  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  355
            D+AYL  VI KRI LF+S++SQQQ   LSL  DP+K+ LP+GSVKEGKKW +TP+DIA+ 
Sbjct  46   DEAYLNQVIKKRIKLFQSLQSQQQSHLLSLPHDPLKVTLPDGSVKEGKKWVSTPMDIAQG  105

Query  356  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  535
            +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  
Sbjct  106  ISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESI  165

Query  536  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE
Sbjct  166  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  202



>ref|XP_008361801.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Malus domestica]
Length=731

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 155/200 (78%), Gaps = 6/200 (3%)
 Frame = +2

Query  62   PPSPSNSIFIRRFSLRP------SQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLF  223
            P + + S F+RR S  P      S      +    + +   HPKDDAYL++VIPKRI LF
Sbjct  12   PAAAAISFFLRRNSYSPFSSLSTSPPPLLPQLPTDSAAMAPHPKDDAYLEAVIPKRIKLF  71

Query  224  ESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNG  403
            E+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DIAK++SKSLAS+A+I+KVNG
Sbjct  72   EAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDIAKDISKSLASSAVIAKVNG  131

Query  404  VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEG  583
             LWDM RPLEGDC+L+LF F+ DEGRDTFWHSSAHILGQ++E++YGCKLCIGPCTTRGEG
Sbjct  132  DLWDMGRPLEGDCELKLFKFEDDEGRDTFWHSSAHILGQALEVEYGCKLCIGPCTTRGEG  191

Query  584  FYYDAFYGDLGLNEDHFKQI  643
            FYYDAFYGDLGLN++HFK I
Sbjct  192  FYYDAFYGDLGLNDEHFKDI  211



>ref|XP_009360487.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009363511.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=676

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDDAYL++VIPKRI LFE+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  4    HPKDDAYLEAVIPKRIKLFEAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDI  63

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AK++SKSLAS+A+I+KVNG LWDMSRPLEGDC+L+LF F+ DEGRDTFWHSSAHILGQ++
Sbjct  64   AKDISKSLASSAVIAKVNGDLWDMSRPLEGDCELKLFKFEDDEGRDTFWHSSAHILGQAL  123

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            E++YGCKLCIGPCTTRGEGFYYDAFYGDLGLN++HFK I
Sbjct  124  EVEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDEHFKDI  162



>ref|XP_004296467.2| PREDICTED: threonine--tRNA ligase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD AYL +V+PKRI LF  I +QQ  +R +L  DPIKI LP+G VKEGKKW T+P DI
Sbjct  60   HPKDGAYLTTVVPKRIGLFMKIHAQQHGERQALPSDPIKITLPDGKVKEGKKWVTSPFDI  119

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SK LASNALIS VNG LWDM+RPLEGDC+L+LFTFD DEGRDTFWHSSAHILG+++
Sbjct  120  AKEISKGLASNALISGVNGQLWDMTRPLEGDCELKLFTFDDDEGRDTFWHSSAHILGEAL  179

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYGDLGLNE+HFK IE
Sbjct  180  EAEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEEHFKLIE  219



>ref|XP_006394912.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
 gb|ESQ32198.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
Length=712

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI+LFE I++ Q  +  SL  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  40   NHPKDEAYLATVIPKRITLFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGKKWETTPMD  99

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA+++SK LA++ALIS VN VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  100  IAEQISKGLANSALISAVNDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  159

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYDAFYGDLGLN++HF +I
Sbjct  160  LEQEYGCQLCIGPCTTRGEGFYYDAFYGDLGLNDNHFPKI  199



>ref|XP_007044584.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
 gb|EOY00416.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
Length=686

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 164/212 (77%), Gaps = 9/212 (4%)
 Frame = +2

Query  11   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  190
            M+C  S  L R IS   P S   ++F+       S+   + +  +A   A  HPKD+AYL
Sbjct  1    MLCTLSSTLRRSIS---PSSSQPALFLL------SKPSSSLRLFSALTMASSHPKDEAYL  51

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
              VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DIA+ +SKSL
Sbjct  52   NQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDIAQGISKSL  111

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            A+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  YGCKL
Sbjct  112  AANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESIYGCKL  171

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFYG+LGLNEDHFKQIE
Sbjct  172  CIGPCTTRGEGFYYDAFYGELGLNEDHFKQIE  203



>ref|XP_007044582.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY00414.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=715

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 164/212 (77%), Gaps = 9/212 (4%)
 Frame = +2

Query  11   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  190
            M+C  S  L R IS   P S   ++F+       S+   + +  +A   A  HPKD+AYL
Sbjct  1    MLCTLSSTLRRSIS---PSSSQPALFLL------SKPSSSLRLFSALTMASSHPKDEAYL  51

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
              VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DIA+ +SKSL
Sbjct  52   NQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDIAQGISKSL  111

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            A+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  YGCKL
Sbjct  112  AANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESIYGCKL  171

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFYG+LGLNEDHFKQIE
Sbjct  172  CIGPCTTRGEGFYYDAFYGELGLNEDHFKQIE  203



>ref|XP_007225203.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
 gb|EMJ26402.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
Length=724

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDDAYL +VIPKRI LFE+I++QQ+    SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  52   HPKDDAYLATVIPKRIKLFEAIQAQQRAHLQSLPSDPIKITLPGGQEKEGKRWITSPFDI  111

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SKSLASNALIS+VNGVLWDM+RPLEGDC L++F F+ + GRDTFWHSSAHILGQ++
Sbjct  112  AREISKSLASNALISEVNGVLWDMNRPLEGDCTLKIFKFEDEVGRDTFWHSSAHILGQAL  171

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            E++YGCKLCIGPCTTRGEGFYYDAFYGDLGLN++HFK+I
Sbjct  172  EVEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDEHFKEI  210



>ref|XP_008221771.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Prunus 
mume]
Length=721

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDD YL +VIPKRI LFE+I++QQ+    SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  49   HPKDDTYLAAVIPKRIKLFEAIQAQQRAHLQSLPSDPIKITLPGGQEKEGKRWITSPFDI  108

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+E+SKSLASNALIS+VNGVLWDM+RPLEGDC L++F F+ D GRDTFWHSSAHILGQ++
Sbjct  109  AREISKSLASNALISEVNGVLWDMNRPLEGDCTLKIFKFEDDVGRDTFWHSSAHILGQAL  168

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            E++YGCKLCIGPCTTRGEGFYYDAFYGDLGLN++HFK+I
Sbjct  169  EVEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDEHFKEI  207



>ref|XP_007044585.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
 gb|EOY00417.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
Length=616

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL  VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DI
Sbjct  5    HPKDEAYLNQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDI  64

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+ +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AQGISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSL  124

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  YGCKLCIGPCTTRGEGFYYDAFYG+LGLNEDHFKQIE
Sbjct  125  ESIYGCKLCIGPCTTRGEGFYYDAFYGELGLNEDHFKQIE  164



>ref|XP_007044583.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
 gb|EOY00415.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
Length=645

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL  VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DI
Sbjct  5    HPKDEAYLNQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDI  64

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A+ +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AQGISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSL  124

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  YGCKLCIGPCTTRGEGFYYDAFYG+LGLNEDHFKQIE
Sbjct  125  ESIYGCKLCIGPCTTRGEGFYYDAFYGELGLNEDHFKQIE  164



>ref|XP_010551550.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=717

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKD+AYL +VIPKRI LFE I++QQ  Q  SL  D IKI LP+GS +EGK+W TTP++I
Sbjct  46   HPKDEAYLSAVIPKRIKLFEQIQAQQLEQLQSLPHDAIKITLPDGSAREGKRWATTPMEI  105

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A  +SK LA+NALIS VN VLWDM+RPLEGDC LE+FTFDSD+GRDTFWHSSAHILGQ++
Sbjct  106  ALGISKGLAANALISSVNDVLWDMTRPLEGDCNLEIFTFDSDKGRDTFWHSSAHILGQAL  165

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E +YGCKLCIGPCTTRGEGFYYDAFYGD GLNEDHF +I+
Sbjct  166  EQEYGCKLCIGPCTTRGEGFYYDAFYGDFGLNEDHFSKID  205



>ref|XP_008340003.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Malus 
domestica]
Length=676

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDDAYL++VIPKRI LFE+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  4    HPKDDAYLEAVIPKRIKLFEAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDI  63

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AK++SKSLAS+A+I+KVNG LWDM+RPLE DC+L+LF F+ DEGRDTFWHSSAHILGQ++
Sbjct  64   AKDISKSLASSAVIAKVNGDLWDMARPLEFDCELKLFKFEDDEGRDTFWHSSAHILGQAL  123

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            E++YGCKLCIGPCTTRGEGFYYDAFYGDLGLN++HFK I
Sbjct  124  EVEYGCKLCIGPCTTRGEGFYYDAFYGDLGLNDEHFKDI  162



>ref|XP_006289423.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
 gb|EOA22321.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
Length=713

 Score =   251 bits (640),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     S+  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  41   NHPKDEAYLSAVIPKRIRLFEQIQANQLENLKSMPHDPIKITLPDGNVKEGKKWETTPMD  100

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS VN VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  101  IAAQISKGLANSALISAVNDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  160

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYGDLGL+++HF  I
Sbjct  161  LEQEYGCQLCIGPCTTRGEGFYYDGFYGDLGLSDNHFPSI  200



>ref|XP_011021655.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=678

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD+ YL +VIPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VK GK+W ++P+DI
Sbjct  7    HQKDEGYLNTVIPKRIQLFQSIQSEQLSRIQSLPHDSIKITLPDGTVKVGKRWQSSPMDI  66

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+ KS+A+NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  67   AKEIGKSVAANALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  126

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDA+YG+LGLN++HFKQI+
Sbjct  127  EMEYGCKLCIGPCTTRGEGFYYDAYYGELGLNDNHFKQID  166



>ref|XP_010455043.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Camelina sativa]
Length=716

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI +FE I++ Q  +  SL  DPIKI LP+G+VKEG+KW TTP+D
Sbjct  44   NHPKDEAYLSAVIPKRIKIFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGRKWETTPMD  103

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  104  IAAQISKGLANSALISAVDDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  163

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYGDLGLN++HF +I
Sbjct  164  LEQEYGCQLCIGPCTTRGEGFYYDGFYGDLGLNDNHFPKI  203



>ref|XP_010493938.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Camelina 
sativa]
Length=712

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI +FE I++ Q  +  SL  DPIKI LP+G+VKEG+KW TTP+D
Sbjct  40   NHPKDEAYLSAVIPKRIKIFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGRKWETTPMD  99

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  100  IAAQISKGLANSALISAVDDVLWDMTRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  159

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYGDLGLN++HF +I
Sbjct  160  LEQEYGCQLCIGPCTTRGEGFYYDGFYGDLGLNDNHFPKI  199



>ref|XP_010688668.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=688

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+AYL SVIPKRISLFESIK++Q L  LS+S + IKI LP+G+VKEGKKW TTP +IA 
Sbjct  19   KDEAYLTSVIPKRISLFESIKAEQALHHLSISGESIKITLPDGNVKEGKKWITTPFEIAA  78

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            ++SK LASNA+IS+VNG LWDM+RP EGDC L+L+TFD DEGRDTFWHSSAHILGQ++EM
Sbjct  79   QISKKLASNAVISRVNGDLWDMNRPFEGDCDLKLYTFDDDEGRDTFWHSSAHILGQALEM  138

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
             YGCKLCIGPCTTRGEGFYYDA+YG+L LNED+FKQI
Sbjct  139  TYGCKLCIGPCTTRGEGFYYDAYYGELSLNEDNFKQI  175



>ref|XP_002872240.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48499.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  41   NHPKDEAYLSAVIPKRIRLFEQIQANQLENLKSLPHDPIKITLPDGNVKEGKKWETTPID  100

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  101  IAAQISKGLANSALISAVDDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  160

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYG+LGL+E+HF  I
Sbjct  161  LEQEYGCQLCIGPCTTRGEGFYYDGFYGELGLSENHFPNI  200



>ref|XP_010913364.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Elaeis guineensis]
Length=727

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +2

Query  104  LRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIK  283
            L  S MG++    A   + P   KD+AYL+++I KR+ LFE+I++QQ  +R  +  +PIK
Sbjct  35   LSVSAMGESRAGEAKGKAKPKASKDEAYLEAIIEKRVRLFEAIQAQQLTERQKVGGEPIK  94

Query  284  IELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTF  463
            I LP+G+VKEGKKW T+P+DIAKE+S  LA++ALI++VNG LWDM+RPLEGDC+L+LF F
Sbjct  95   ITLPDGTVKEGKKWMTSPIDIAKEISSGLAASALIAQVNGTLWDMTRPLEGDCELKLFKF  154

Query  464  DSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            DS+EGRDTFWHSSAHILGQSVEM++GCKLCIGPCTTRGEGFYYDAFY DL LNE++F QI
Sbjct  155  DSNEGRDTFWHSSAHILGQSVEMEFGCKLCIGPCTTRGEGFYYDAFYDDLTLNEEYFDQI  214

Query  644  E  646
            +
Sbjct  215  K  215



>ref|XP_011025470.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=715

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H +D+ YL   IPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W ++P+DI
Sbjct  44   HARDEGYLNIAIPKRIQLFQSIQSEQLSRLQSLPHDSIKITLPDGTVKEGKRWESSPMDI  103

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+ KS+A NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  104  AKEIGKSVAGNALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  163

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFYG+LGLN+DHFK+I+
Sbjct  164  EMEYGCKLCIGPCTTRGEGFYYDAFYGELGLNDDHFKKID  203



>ref|XP_009111770.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brassica rapa]
Length=707

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  89   IRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlsls  268
            I R++  PS++            + +HPK+++YL +VIPKRI LFE I+S Q  +  SL 
Sbjct  10   ISRYASPPSRLASTSSFCTLPTMSTNHPKNESYLSAVIPKRIKLFEQIQSHQLEKLKSLP  69

Query  269  PDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKL  448
             DPIKI LP+G+VKEG+KW TTP+DIA E+ K LA++ALIS VN  LWDMSR LEGDCKL
Sbjct  70   HDPIKITLPDGTVKEGRKWETTPMDIAGEILKGLANSALISSVNDELWDMSRVLEGDCKL  129

Query  449  ELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNED  628
            ELF FDSD+GRDT WHSSAH+LGQ++E +YGC+LCIGPCTTRGEGFYYDAFYGDLGLN++
Sbjct  130  ELFKFDSDKGRDTLWHSSAHVLGQALEQEYGCQLCIGPCTTRGEGFYYDAFYGDLGLNDN  189

Query  629  HFKQIE  646
            HF  IE
Sbjct  190  HFPNIE  195



>ref|XP_002311580.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE88947.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=715

 Score =   249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H +D+ YL   IPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W ++P+DI
Sbjct  44   HARDEEYLNIAIPKRIQLFQSIQSEQLSRLQSLPHDSIKITLPDGTVKEGKRWESSPMDI  103

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+ KS+A NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  104  AKEIGKSVAGNALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  163

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFYG+LGLN+DHFK+I+
Sbjct  164  EMEYGCKLCIGPCTTRGEGFYYDAFYGELGLNDDHFKKID  203



>gb|KFK26446.1| hypothetical protein AALP_AA8G249500 [Arabis alpina]
Length=714

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL SVIPKRI LFE I+  Q     +L  DPIKI LP+G+VK+G+KW TTP+D
Sbjct  42   NHPKDEAYLSSVIPKRIKLFEEIQVNQLEYLRALPHDPIKITLPDGTVKDGRKWETTPMD  101

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS+VN  LWDM+RPLEGDCKL+LF FDSD+GRDT WHSSAHILGQ+
Sbjct  102  IAGQISKGLATSALISEVNDALWDMTRPLEGDCKLQLFKFDSDKGRDTLWHSSAHILGQA  161

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGF+YDAFYG+LGLN+DHF +I
Sbjct  162  LEQEYGCQLCIGPCTTRGEGFFYDAFYGNLGLNDDHFPKI  201



>ref|XP_006836673.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
 gb|ERM99526.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
Length=723

 Score =   248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD+AYLQ+VI KRISLFE IK++Q   R ++  + IKI LP G VKEGKK  T+P+DI
Sbjct  52   HKKDEAYLQAVIQKRISLFEKIKAEQLAHRQAIGGEKIKITLPGGKVKEGKKLITSPMDI  111

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSLA NALIS+VNG LWDMSRPLE DC+L+L+TFDS EGRDTFWHSSAHILGQS+
Sbjct  112  AKEISKSLAGNALISQVNGTLWDMSRPLEEDCELKLYTFDSHEGRDTFWHSSAHILGQSL  171

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            EM+YGCKLCIGPCTTRGEGFYYDAFY DL LNE+HF  I+
Sbjct  172  EMEYGCKLCIGPCTTRGEGFYYDAFYNDLTLNEEHFGHIQ  211



>emb|CDX87030.1| BnaC09g03450D [Brassica napus]
Length=719

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPK+++YL +VIPKRI LFE I+S Q  +  SL  DPIKI LP+G+VKEG+KW TTP+DI
Sbjct  38   HPKNESYLSAVIPKRIKLFEQIQSHQLEKLKSLPHDPIKITLPDGTVKEGRKWETTPMDI  97

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A E+SK LA+ ALIS VN  LWDMSRPLEGDCKLELF FDSD+GRDT WHSSAH+LGQ++
Sbjct  98   AGEISKGLANAALISSVNDELWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHVLGQAL  157

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            E +YGC+LCIGPCTTRGEGFYYDAFYGDLGLN++HF  I
Sbjct  158  EQEYGCQLCIGPCTTRGEGFYYDAFYGDLGLNDNHFPNI  196



>emb|CAA74705.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  156

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYG+LGL+++HF  I
Sbjct  157  LEQEYGCQLCIGPCTTRGEGFYYDGFYGELGLSDNHFPSI  196



>ref|NP_198035.2| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O04630.3|SYTM_ARATH RecName: Full=Threonine--tRNA ligase, mitochondrial; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93610.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  156

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYG+LGL+++HF  I
Sbjct  157  LEQEYGCQLCIGPCTTRGEGFYYDGFYGELGLSDNHFPSI  196



>ref|XP_008802022.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Phoenix dactylifera]
Length=727

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 7/211 (3%)
 Frame = +2

Query  35   LWRLIS-----FRHPPSPSNSIFIRRFSLRP--SQMGKADKssaannsaPDHPKDDAYLQ  193
            L RL+S     F  PP  +   F+      P  S MG++        + P   KDDAYL+
Sbjct  5    LRRLVSVPRPFFAPPPLATPPRFLSAVLSPPPASAMGESRAGEVKGKAKPKASKDDAYLE  64

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            ++I KRI +FESI++QQ  +R  +S +PIKI LP+G+ KEGKKW T+P+DIA+ +S  LA
Sbjct  65   AIIEKRIRMFESIQAQQLAERQKISGEPIKITLPDGTTKEGKKWMTSPIDIAQGISSGLA  124

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
            ++ALI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILGQSVEM++GCKLC
Sbjct  125  ASALIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGQSVEMEFGCKLC  184

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            IGPCTTRGEGFYYDAFY DL LNE++F QI+
Sbjct  185  IGPCTTRGEGFYYDAFYDDLTLNEEYFDQIK  215



>gb|AAK82468.1| AT5g26830/F2P16_90 [Arabidopsis thaliana]
 gb|AAO64760.1| At5g26830/F2P16_90 [Arabidopsis thaliana]
Length=676

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  4    NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  63

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWD++RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  64   IAAQISKGLANSALISAVDDVLWDVNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  123

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            +E +YGC+LCIGPCTTRGEGFYYD FYG+LGL+++HF  I
Sbjct  124  LEQEYGCQLCIGPCTTRGEGFYYDGFYGELGLSDNHFPSI  163



>emb|CDX80596.1| BnaC07g28480D [Brassica napus]
Length=714

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 146/192 (76%), Gaps = 7/192 (4%)
 Frame = +2

Query  89   IRRFSLR------PSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqql  250
            IRRF+        PS++          + A  + K++AYL +VIPKRI+LFE I++ Q  
Sbjct  10   IRRFTASHSVSPPPSRLASLSSFRTVPSMAASNQKNEAYLSAVIPKRITLFEQIQADQLE  69

Query  251  qrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPL  430
            +  SL  DPIKI LP+GSVKEGKKW TTP+DIA ++SK LA++ALIS VN  LWDMSRPL
Sbjct  70   KLKSLPHDPIKITLPDGSVKEGKKWETTPMDIAAQISKGLANSALISSVNDELWDMSRPL  129

Query  431  EGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFY-G  607
            EGDCKLELF FDSD+GRDT WHSSAHILGQ++E +YGCKLCIGPCTTRGEGFYYDA Y  
Sbjct  130  EGDCKLELFKFDSDKGRDTLWHSSAHILGQAIEQEYGCKLCIGPCTTRGEGFYYDARYEN  189

Query  608  DLGLNEDHFKQI  643
            DLGLN++HF  I
Sbjct  190  DLGLNDNHFPNI  201



>dbj|BAC41894.1| unknown protein [Arabidopsis thaliana]
Length=186

 Score =   224 bits (570),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  343
            HPKD+AYL SVIPKRI LFE I+++Q  Q  S   DPIKI L P+G  KEG++W T+P+D
Sbjct  6    HPKDEAYLSSVIPKRIRLFEEIQAEQLEQLQSRPHDPIKITLLPDGIEKEGRRWETSPMD  65

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GR+TFWHSSAHILGQ+
Sbjct  66   IAVQISKGLAKSALVSSVNHVLWDMNRPLEGDCSLEIFGFDSDQGRNTFWHSSAHILGQA  125

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDA-FYGDLGLNEDHFKQIE  646
            +E +YGCKLCIGPC  R EGFYYD+ +YG+LGLN++HF  IE
Sbjct  126  LEQEYGCKLCIGPCEPRDEGFYYDSLYYGELGLNDNHFPNIE  167



>ref|XP_009151164.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
 emb|CDX88245.1| BnaA06g28360D [Brassica napus]
Length=718

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            K++AYL +VIPKRI+LFE I++ Q  +  SL  DPIKI LP+GSVKEGKKW TTP+DIA 
Sbjct  48   KNEAYLSAVIPKRITLFEQIQADQLEKLKSLPHDPIKITLPDGSVKEGKKWETTPMDIAA  107

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            ++SK LA++ALIS VN  LWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ++E 
Sbjct  108  QISKGLANSALISSVNDELWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQAIEQ  167

Query  533  KYGCKLCIGPCTTRGEGFYYDAFY-GDLGLNEDHFKQI  643
            +YGCKLCIGPCTTRGEGFYYDA Y  DLGLN++HF  I
Sbjct  168  EYGCKLCIGPCTTRGEGFYYDACYEKDLGLNDNHFPNI  205



>ref|XP_009412586.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            KD+AYL +VI KR+ LFESI++QQ+ +RL L  + I+I LP+G++KEGKKW T+P+DIAK
Sbjct  62   KDEAYLDAVIQKRVHLFESIQAQQKAERLDLDGESIRITLPDGTIKEGKKWLTSPMDIAK  121

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S  LA++ALI++VNG LWDM+RPLEGD  L+LF FD  EGRDTFWHSSAHILGQS+EM
Sbjct  122  EISSGLAASALIAQVNGFLWDMTRPLEGDSNLKLFKFDDAEGRDTFWHSSAHILGQSLEM  181

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +YGCKLCIGPCTTRGEGFYYDAFY +L LNE+HF QI+
Sbjct  182  EYGCKLCIGPCTTRGEGFYYDAFYDELTLNEEHFNQIQ  219



>ref|NP_173238.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|Q8GZ45.2|SYTC_ARATH RecName: Full=Probable threonine--tRNA ligase, cytoplasmic; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS [Arabidopsis 
thaliana]
 gb|AAF97275.1|AC034106_18 Strong similarity to threonyl-tRNA synthetase from Arabidopsis 
thaliana gb|Y14329 and is a member of the tRNA synthetase 
PF|00587 class II [Arabidopsis thaliana]
 gb|AEE29656.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=458

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  343
            HPKD+AYL SVIPKRI LFE I+++Q  Q  S   DPIKI L P+G  KEG++W T+P+D
Sbjct  6    HPKDEAYLSSVIPKRIRLFEEIQAEQLEQLQSRPHDPIKITLLPDGIEKEGRRWETSPMD  65

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GR+TFWHSSAHILGQ+
Sbjct  66   IAVQISKGLAKSALVSSVNHVLWDMNRPLEGDCSLEIFGFDSDQGRNTFWHSSAHILGQA  125

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDA-FYGDLGLNEDHFKQIE  646
            +E +YGCKLCIGPC  R EGFYYD+ +YG+LGLN++HF  IE
Sbjct  126  LEQEYGCKLCIGPCEPRDEGFYYDSLYYGELGLNDNHFPNIE  167



>gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group]
Length=701

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  28   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  87

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  88   DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  147

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA+Y DL LNE HF  I+
Sbjct  148  SLERAYGCKLCIGPCTTRGEGFYYDAYYNDLTLNETHFGIID  189



>gb|EEC83307.1| hypothetical protein OsI_28676 [Oryza sativa Indica Group]
Length=716

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  72   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  131

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  132  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  191

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA+Y DL LNE HF  I+
Sbjct  192  SLERAYGCKLCIGPCTTRGEGFYYDAYYNDLTLNETHFGIID  233



>ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  72   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  131

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  132  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  191

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA+Y DL LNE HF  I+
Sbjct  192  SLERAYGCKLCIGPCTTRGEGFYYDAYYNDLTLNETHFGIID  233



>dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group]
Length=749

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  76   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  135

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  136  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  195

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA+Y DL LNE HF  I+
Sbjct  196  SLERAYGCKLCIGPCTTRGEGFYYDAYYNDLTLNETHFGIID  237



>ref|XP_008664856.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Zea mays]
Length=737

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            +DD+YL++V  KRI LFE I+++Q ++RL++  + IKI LP+G++KEGKKW TTP+DIAK
Sbjct  68   RDDSYLEAVTHKRIRLFEEIQARQAVERLNIGGEVIKITLPDGAIKEGKKWITTPMDIAK  127

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S   A++ LI++V+  LWDM RPLEGDCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  128  EISSGFAASCLIAQVDETLWDMGRPLEGDCKLQMFKFDTNEGRDTFWHSSAHILGESLER  187

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             YGCKLCIGPCTTRGEGFYYDA+Y +L LNE+HF  IE
Sbjct  188  AYGCKLCIGPCTTRGEGFYYDAYYNELTLNEEHFGVIE  225



>ref|XP_004973168.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=739

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            +DD+YL+++  KRI +F+ I++++ L+RL++  + IK+ LP+G++K+GKKW TTP+DIAK
Sbjct  70   RDDSYLEAITQKRIRMFDDIQARRALERLNIGGEVIKVTLPDGAIKDGKKWITTPMDIAK  129

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S  LA++ LI++V+  LWDM RPLEGDCKL+LF FDS+EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGLAASCLIAQVDETLWDMGRPLEGDCKLQLFKFDSNEGRDTFWHSSAHILGESLER  189

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             YGCKLCIGPCTTRGEGFYYDA+Y DL LNE+HF  IE
Sbjct  190  AYGCKLCIGPCTTRGEGFYYDAYYNDLTLNEEHFGIIE  227



>ref|XP_008644625.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Zea mays]
 gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays]
Length=739

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            +DD+YL++V  KRI  FE I+++Q ++RL++  + IK+ LP+G++KEGKKW TTP+DIAK
Sbjct  70   RDDSYLEAVTQKRIRFFEEIQARQAVERLNIGGEVIKVTLPDGAIKEGKKWITTPMDIAK  129

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S   A++ LI++V+  LWDM RPLEGDCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGFAASCLIAQVDETLWDMGRPLEGDCKLQMFKFDTNEGRDTFWHSSAHILGESIER  189

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             YGCKLCIGPCTTRGEGFYYDA+Y D  LNE+HF  IE
Sbjct  190  AYGCKLCIGPCTTRGEGFYYDAYYNDQTLNEEHFGIIE  227



>ref|XP_003573669.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=736

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  176  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  355
            D AYL++V  KRI LFE I+S+Q L+RL++  +PIKI LP+G+VKEGKKW +TP+DIAK 
Sbjct  68   DGAYLEAVTQKRIRLFEEIQSRQALERLNIGGEPIKIILPDGAVKEGKKWISTPMDIAKG  127

Query  356  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  535
            +S  LA++ LI++VNG+LWDM RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+S+E  
Sbjct  128  ISSGLAASCLIAQVNGILWDMERPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGESLERA  187

Query  536  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            YGCKLCIGPCTTRGEGFYYDA Y D+ LN+ HF  +E
Sbjct  188  YGCKLCIGPCTTRGEGFYYDAHYNDVTLNDTHFGLVE  224



>ref|XP_002892976.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69235.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  343
            HPKD+AYL SVIPKRI +FE I+++Q  Q  S   DPIKI L P+G VKEGK+W TTP+D
Sbjct  6    HPKDEAYLSSVIPKRIRIFEEIQAEQLEQLQSRPHDPIKITLLPDGIVKEGKRWETTPMD  65

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK  A +AL+S V+ VLWDM+RPLEGDC LE+F FDSD+GRDTFWHSSA ILG +
Sbjct  66   IAVQISKGFAKSALVSSVDHVLWDMNRPLEGDCSLEIFGFDSDQGRDTFWHSSALILGHA  125

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFY-GDLGLNEDHFKQIE  646
            +E +YGCKLCIGPC T  EGF+ DAFY G+LGLN++HF  IE
Sbjct  126  LEQEYGCKLCIGPCKTIDEGFFCDAFYHGELGLNDNHFPNIE  167



>ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
 gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
Length=739

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            +DD+YL++V  KRI LFE I+++Q ++RL++  + IK+ LP+G++KEGKKW TTP+DIAK
Sbjct  70   RDDSYLEAVTQKRIRLFEEIQARQAVERLNIGGEVIKVTLPDGAIKEGKKWITTPMDIAK  129

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S   AS+ LI++V+  LWDM RPLE DCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGFASSCLIAQVDETLWDMGRPLESDCKLQMFKFDTNEGRDTFWHSSAHILGESIER  189

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             YGCKLCIGPCTTRGEGFYYDA+Y D  LNE+HF  IE
Sbjct  190  AYGCKLCIGPCTTRGEGFYYDAYYKDQTLNEEHFGIIE  227



>dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P    D AYL  V PKRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+
Sbjct  38   PAVAPDAAYLAVVTPKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPM  97

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  98   DIATGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  157

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA Y DL LN+ HF  I+
Sbjct  158  SLERVYGCKLCIGPCTTRGEGFYYDAHYKDLTLNDTHFGLID  199



>ref|XP_006659275.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Oryza 
brachyantha]
Length=696

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P    D  YL++   KRI +FE I+++Q L+RLS+  +PIK+ LP+G+VKE KKW +TP+
Sbjct  23   PTFEPDVPYLEAGTAKRIRMFEEIQAKQALERLSIGGEPIKVTLPDGAVKECKKWISTPM  82

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIAKE+S  LA+  LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  83   DIAKEISTGLAAGCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  142

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDAFY D  LNE HF  I+
Sbjct  143  SLERAYGCKLCIGPCTTRGEGFYYDAFYNDTTLNETHFGIID  184



>ref|XP_007199721.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
 gb|EMJ00920.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
Length=691

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 15/175 (9%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsP-DPIKIELPNGSVKEGKKWNTTPLD  343
              KD+AYL++VIPKRI LFESI+++Q+  R SL   DPI+I L +G VKEGKKW T+P +
Sbjct  4    QAKDEAYLEAVIPKRIELFESIQAEQRAARQSLPSFDPIRITLSDGKVKEGKKWITSPFE  63

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDS----DEGRDTFWHSSAHI  511
            IA E+SKSLASNALIS+VNGVLWDM+RPLEGD +L LFT DS    ++ R TFWHSS+HI
Sbjct  64   IASEISKSLASNALISEVNGVLWDMNRPLEGDAELRLFTLDSFDNNEDVRHTFWHSSSHI  123

Query  512  LGQSVEMKYGCKLCIGP----------CTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            LGQ++E++YGCKLCIGP          C T  EGFYYDAFYGD GLN++HFKQIE
Sbjct  124  LGQALEVEYGCKLCIGPCARIETRHDMCATSKEGFYYDAFYGDFGLNDEHFKQIE  178



>ref|XP_004968434.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=741

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  173  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  352
            +DD+YL++V   RI  FE I+++Q L+RL++  + IK+ LP+G++KEGKK  TTP+DIAK
Sbjct  72   RDDSYLEAVTQTRIRKFEEIQARQALERLNIGGELIKVTLPDGAIKEGKKLITTPMDIAK  131

Query  353  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  532
            E+S  LA++ LI+KV+  LWDM RPLEGDCKL+LF FDS+EGRDTFWHSSAHILG+S+E 
Sbjct  132  EISSGLAASCLIAKVDETLWDMGRPLEGDCKLQLFKFDSNEGRDTFWHSSAHILGESLER  191

Query  533  KYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             YGCKLCIGPCTTRGEGFYYDA+Y DL LNE+HF  IE
Sbjct  192  VYGCKLCIGPCTTRGEGFYYDAYYNDLTLNEEHFGIIE  229



>gb|EMT11254.1| Threonyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1098

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 4/162 (2%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            PD P    YL++V  KRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+
Sbjct  8    PDAP----YLEAVTQKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPM  63

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  64   DIATGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  123

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA Y DL LN+ HF  I+
Sbjct  124  SIERVYGCKLCIGPCTTRGEGFYYDAHYKDLTLNDTHFGLID  165



>ref|XP_001784310.1| predicted protein [Physcomitrella patens]
 gb|EDQ50872.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            +VI KR+ LFE ++ +Q     +   DPIKI +P+G+V++GKKW T+P+D+A+E+S+ LA
Sbjct  22   TVIKKRVELFEKLQKEQAEAFRAKGGDPIKITMPDGAVRDGKKWITSPMDVAREISQGLA  81

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
            ++ALI++VNGVLWDM+RPLEGDC L+L  F+SD+GRDTFWHSSAHILGQS+EM YGCKLC
Sbjct  82   NSALIAEVNGVLWDMTRPLEGDCTLQLHKFESDKGRDTFWHSSAHILGQSIEMTYGCKLC  141

Query  554  IGPCTTRGEGFYYDAFYGDLGLNE-DHFKQIE  646
            IGPCTTRGEGFYYDAFY  L L E D F +I+
Sbjct  142  IGPCTTRGEGFYYDAFYHGLTLTEKDDFGKIQ  173



>emb|CDM81189.1| unnamed protein product [Triticum aestivum]
Length=706

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 131/162 (81%), Gaps = 4/162 (2%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            PD P    YL +V  KRI +FE I+++Q L+RL++  D I++ LP+G++KEGKKW +TP+
Sbjct  37   PDAP----YLDAVTQKRIRIFEEIQARQALERLNIGGDSIRVTLPDGAIKEGKKWISTPM  92

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  93   DIASGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  152

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            S+E  YGCKLCIGPCTTRGEGFYYDA Y DL LN+ HF  I+
Sbjct  153  SLERVYGCKLCIGPCTTRGEGFYYDAHYKDLTLNDTHFGLID  194



>ref|XP_006303165.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
 gb|EOA36063.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
Length=664

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  346
            P+D+AYL SVIPKRI LFE I++    Q  SL  DPIKI L P+G VKEGK+W TTP+DI
Sbjct  7    PRDEAYLSSVIPKRIRLFEQIQADHLEQLQSLPHDPIKITLLPDGIVKEGKRWETTPMDI  66

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A ++S+ LA +AL+S VN VLWDM+RPLE DC LE+  FDS++GRDT WHSSAHILGQ++
Sbjct  67   AVQISRGLAKSALVSSVNNVLWDMNRPLESDCSLEILGFDSNQGRDTLWHSSAHILGQAL  126

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFY-GDLGLNEDHFKQIE  646
            E +YGCKL IGPC T  EGFYYDAFY GD+ +NE+HF  IE
Sbjct  127  EQEYGCKLYIGPCKTIYEGFYYDAFYHGDVAINENHFPNIE  167



>ref|XP_010476961.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=453

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 9/161 (6%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  346
            PKD+AYL SVI KRI LF+ I++    +  SL  DPIKI L PNG VKEGK+W TTP+DI
Sbjct  7    PKDEAYLSSVISKRIRLFQQIQADHLEKLQSLPHDPIKITLLPNGIVKEGKRWETTPMDI  66

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A ++S+ LA +AL+S VN VLWDM+RPLEG        FDSD+GRDTFWHSSAHILGQS+
Sbjct  67   AGQISRVLAKSALVSSVNRVLWDMNRPLEG-------XFDSDQGRDTFWHSSAHILGQSL  119

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAF-YGDLGLNEDHFKQIE  646
            E +YGCKLC+GPC TR EGFYYDAF YG+LGLN+ +F  IE
Sbjct  120  EQEYGCKLCLGPCETRHEGFYYDAFYYGNLGLNDSYFPNIE  160



>ref|XP_006378416.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP56213.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=696

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KD+ YL +VIPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W+++P+DI
Sbjct  45   HQKDEGYLNTVIPKRIQLFQSIQSEQLSRIQSLPHDSIKITLPDGTVKEGKRWHSSPMDI  104

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+ KS+A+NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  105  AKEIGKSVAANALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  164

Query  527  EMKYGCKLCIGPCTTRGE  580
            EM+YGCKLCIGPCTTRGE
Sbjct  165  EMEYGCKLCIGPCTTRGE  182



>ref|XP_009117622.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
Length=628

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 126/162 (78%), Gaps = 5/162 (3%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNG-SVKEGKKWNTTPL  340
            +HP+D+AYL +VI KRI LFE  +++Q  +  S   +PIK+ + +G +VKEGK+W TTP 
Sbjct  4    EHPRDEAYLSAVIEKRIRLFEEFQAKQLAEIQSRPHEPIKVTIRDGGNVKEGKRWETTPA  63

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            +IA+++S  LA++ALIS VN VLWDM+RPLE DC LE F+FDSD+GRDTFW SSAHIL  
Sbjct  64   EIARQISVGLANSALISSVNDVLWDMNRPLEADCSLEFFSFDSDKGRDTFWRSSAHILA-  122

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
               ++YGCKLC+GPC  R EGF+YDAFYGDLGLNE HF + E
Sbjct  123  ---LEYGCKLCVGPCKARDEGFFYDAFYGDLGLNEQHFPETE  161



>gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu]
Length=1047

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 21/183 (11%)
 Frame = +2

Query  161  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  340
            P    D AYL++V  KRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+
Sbjct  4    PAVAPDAAYLEAVTQKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPM  63

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG-  517
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG 
Sbjct  64   DIASGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  123

Query  518  --------------------QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFK  637
                                QS+E  YGCKLCIGPCTTRGEGFYYDA Y DL LN+ HF 
Sbjct  124  VSVIIHSQFIFFLIEEDVCLQSIERVYGCKLCIGPCTTRGEGFYYDAHYKDLTLNDTHFG  183

Query  638  QIE  646
             I+
Sbjct  184  LID  186



>emb|CDY21715.1| BnaA09g44660D [Brassica napus]
Length=628

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNG-SVKEGKKWNTTPL  340
            +HP+D+AYL +VI KRI LFE  +++Q  +  S   DPIK+ + +G +VKEGK+W TTP 
Sbjct  4    EHPRDEAYLSAVIEKRIRLFEEFQAKQLAEIQSRPHDPIKVTIRDGGNVKEGKRWETTPA  63

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            +IA+++S  LA++ALIS VN VLWDM+RPLE DC LE F+FDSD+GRDTFW SSAHI   
Sbjct  64   EIARQISVGLANSALISSVNDVLWDMNRPLEADCSLEFFSFDSDKGRDTFWRSSAHI---  120

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
                +YGCKLC+GPC  R EGF+YDAFYGDLGLNE HF + E
Sbjct  121  -CRCEYGCKLCVGPCKARDEGFFYDAFYGDLGLNEQHFPETE  161



>ref|XP_007200687.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
 gb|EMJ01886.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
Length=689

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 17/175 (10%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsP-DPIKIELPNGSVKEGKKWNTTPLD  343
            H KD  YL   IPKR  LFESI+++Q+  R S    DPI+I LP+G VKEGKKW T+P +
Sbjct  4    HAKD--YLMVDIPKRNKLFESIQAEQRAARQSHPSFDPIRITLPDGKVKEGKKWITSPFE  61

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDS----DEGRDTFWHSSAHI  511
            IA E+SKSLASNALIS+VNGVLWDM+RPLEGD +L + T DS    ++ R TFWHSS+HI
Sbjct  62   IASEISKSLASNALISEVNGVLWDMNRPLEGDAELRILTLDSFDNNEDVRHTFWHSSSHI  121

Query  512  LGQSVEMKYGCKLCIGP----------CTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            LGQ++EM+YGC+LCIGP          CTT  EGFYYDAF+GD GLN++HFK+IE
Sbjct  122  LGQALEMEYGCRLCIGPCARIGTRLDLCTTSKEGFYYDAFHGDYGLNDEHFKKIE  176



>ref|XP_010480524.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=668

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 5/161 (3%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  346
            PKD+ YL SVI KRI LFE I+++Q         DPIKI L P+G VKEG +W TTP+DI
Sbjct  7    PKDETYLSSVISKRIRLFEQIQAEQLQSLPH---DPIKITLLPDGIVKEGNRWETTPMDI  63

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A ++S+ LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GRDTFWHSSAH+LGQ++
Sbjct  64   AGQISRVLAESALVSSVNRVLWDMNRPLEGDCSLEIFRFDSDQGRDTFWHSSAHLLGQAL  123

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFY-GDLGLNEDHFKQIE  646
            + ++GCKLC+GPC TR EGFYYDA Y  + G N+  F  IE
Sbjct  124  KQEFGCKLCLGPCETRHEGFYYDALYLRNQGSNDSGFLNIE  164



>gb|AAB61048.1| Similar to threonyl-tRNA synthetase; coded for by A. thaliana 
cDNA R65376 [Arabidopsis thaliana]
Length=702

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 118/160 (74%), Gaps = 20/160 (13%)
 Frame = +2

Query  164  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  343
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  344  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  523
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ 
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQ-  155

Query  524  VEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
                               GFYYD FYG+LGL+++HF  I
Sbjct  156  -------------------GFYYDGFYGELGLSDNHFPSI  176



>ref|XP_004304268.2| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467923.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467924.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=746

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +2

Query  191  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKE---GKKWNTTPLDIAKELS  361
            +++I ++I LFESI+++Q+    SL  + IKI L  G VKE   GKKW T+PLDIA+E+S
Sbjct  75   KAIISRKIKLFESIQAEQEEPIQSLPAESIKITLWYGQVKEVKEGKKWITSPLDIAEEVS  134

Query  362  KSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  541
            +S AS AL+++VNG  WDMS+PLE DC+L++FTF+ ++GRDTFWHSS+HILG ++E ++G
Sbjct  135  ESFASKALVAEVNGTPWDMSKPLECDCELKIFTFEDNKGRDTFWHSSSHILGHALEAEFG  194

Query  542  CKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            CKLCIGPCTT+ EGFYYDA+YG LGLN++H K+IE
Sbjct  195  CKLCIGPCTTKQEGFYYDAYYGGLGLNDEHLKKIE  229



>ref|XP_008237148.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like, partial 
[Prunus mume]
Length=648

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 14/135 (10%)
 Frame = +2

Query  284  IELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTF  463
            I LP+G VKEGKKW T+P +IA E+SKSLASNALIS+VNGVLWDM+RPLEGD +L LFT 
Sbjct  1    ITLPDGKVKEGKKWITSPFEIASEISKSLASNALISEVNGVLWDMNRPLEGDAELRLFTL  60

Query  464  DS----DEGRDTFWHSSAHILGQSVEMKYGCKLCIGP----------CTTRGEGFYYDAF  601
            DS    ++ R TFWHSS+HILGQ++E++YGCKLCIGP          C T  EGFYYDAF
Sbjct  61   DSFDNNEDVRHTFWHSSSHILGQALEVEYGCKLCIGPCARIETRHDMCATSKEGFYYDAF  120

Query  602  YGDLGLNEDHFKQIE  646
            YGD GLN++HFKQIE
Sbjct  121  YGDFGLNDEHFKQIE  135



>ref|XP_007204844.1| hypothetical protein PRUPE_ppa026578mg [Prunus persica]
 gb|EMJ06043.1| hypothetical protein PRUPE_ppa026578mg [Prunus persica]
Length=134

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 106/136 (78%), Gaps = 11/136 (8%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            H KDDAYL +VIPK I LFESI++QQ   RL    DPIKI LP+G V+EGKKW T+P DI
Sbjct  6    HAKDDAYLDAVIPKGIQLFESIEAQQHAARLPS--DPIKITLPDGKVEEGKKWITSPFDI  63

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEG----RDTFWHSSAHIL  514
            A E+SKSLASNALIS+VNGVLWD++RPLEGD +L++FT DS +     R TFWHSSAHI+
Sbjct  64   ASEISKSLASNALISEVNGVLWDINRPLEGDAELKIFTLDSFDDNVDVRHTFWHSSAHII  123

Query  515  GQSVEMKYGCKLCIGP  562
            GQ     YGCKLCIGP
Sbjct  124  GQ-----YGCKLCIGP  134



>emb|CDY19754.1| BnaA09g04070D [Brassica napus]
Length=609

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
            +DIA E+SK LA++ALIS VN  LWDMSR LEGDCKLELF FDSD+GRDT WHSSAH+LG
Sbjct  1    MDIAGEISKGLANSALISSVNDELWDMSRVLEGDCKLELFKFDSDKGRDTLWHSSAHVLG  60

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            Q++E +YGC LCIGPCTTRGEGFYYDAFYGDLGLN++HF  I
Sbjct  61   QALEQEYGCHLCIGPCTTRGEGFYYDAFYGDLGLNDNHFPNI  102



>ref|XP_002991732.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
 gb|EFJ07136.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
Length=647

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = +2

Query  197  VIPKRISLFESIKsqqqlqrlslsPDPIKIE-LPNGSV-KEGKKWNTTPLDIAKELSKSL  370
            VI KRI +F  +++ ++ +   L   PI +  L +G V   G++  TTPLDIA+ +SK  
Sbjct  6    VIQKRIRIFSELQASERARNEELGGQPIDVTVLKDGEVVYPGRRLLTTPLDIARLISKKK  65

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            A++ +I++VNG LWDM RPLE DC L L+ F  ++GRDTFWHSSAHILG+S+E  YGCKL
Sbjct  66   AADYVIAQVNGTLWDMGRPLEEDCTLVLYAFKDEQGRDTFWHSSAHILGESLEQAYGCKL  125

Query  551  CIGPCTTRGEGFYYDAFYGD-LGLNEDHFKQIE  646
            CIGPCTTRGEGFYYDAFY D   LNE++F  ++
Sbjct  126  CIGPCTTRGEGFYYDAFYEDGRTLNEENFPAVQ  158



>ref|XP_002989765.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
 gb|EFJ09242.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
Length=647

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 3/154 (2%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGS--VKEGKKWNTTPLDIAKELSKS  367
            +VI KRI +F  +++ ++ +   L   PI + +      V  G++  TTPLDIA+ +SK 
Sbjct  5    AVIQKRIRIFSELQASERARNEKLGGQPIDVTVHKDGEVVYPGRRLLTTPLDIARLISKK  64

Query  368  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  547
             A++ +I++VNG LWDM RPLE DC L L+ F  ++GRDTFWHSSAHILG+S+E  YGCK
Sbjct  65   KAADYVIAQVNGTLWDMGRPLEEDCTLVLYAFKDEQGRDTFWHSSAHILGESLEQAYGCK  124

Query  548  LCIGPCTTRGEGFYYDAFYGD-LGLNEDHFKQIE  646
            LCIGPCTTRGEGFYYDAFY D   LNE++F  ++
Sbjct  125  LCIGPCTTRGEGFYYDAFYEDGRTLNEENFPAVQ  158



>ref|XP_005837214.1| hypothetical protein GUITHDRAFT_93029 [Guillardia theta CCMP2712]
 gb|EKX50234.1| hypothetical protein GUITHDRAFT_93029 [Guillardia theta CCMP2712]
Length=690

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            R+ +FE IK++++ ++ +L  DPIK+ LP+G+VKEG K  TTP DIA E+SK LA+NA++
Sbjct  30   RLEMFEKIKAKREAEKGNLPNDPIKVTLPDGNVKEGVKNKTTPFDIAMEISKGLANNAVV  89

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG  WD+ RPLEGD +LEL  FDS EGR+TFWHSSAH+LG ++E ++G  LC+GP  
Sbjct  90   AKVNGKTWDLHRPLEGDAELELCKFDSPEGRETFWHSSAHVLGLALENRFGAHLCVGPAI  149

Query  569  TRGEGFYYDAFYG  607
               +GFYYD + G
Sbjct  150  D--DGFYYDVYAG  160



>gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=599

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  416  MSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYD  595
            M+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+E +YGCKLCIGPCTTRGEGFYYD
Sbjct  1    MTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSLETEYGCKLCIGPCTTRGEGFYYD  60

Query  596  AFYGDLGLNEDHFKQIE  646
            AFYGDLGLN+DHFKQIE
Sbjct  61   AFYGDLGLNDDHFKQIE  77



>gb|EST08708.1| threonyl-tRNA synthetase [Pseudozyma brasiliensis GHG001]
Length=759

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+PLDIAKE+SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSYETSPLDIAKEISKSLSERIVI  144

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLEGDCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDETLWDLERPLEGDCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204

Query  569  TRGEGFYYDAFYGDLG  616
               +GF+Y+   GD G
Sbjct  205  E--DGFFYEMAMGDSG  218



>dbj|GAC98443.1| threonyl-tRNA synthetase [Pseudozyma hubeiensis SY62]
Length=760

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P+DIAKE+SKSL+   +I
Sbjct  86   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSYETSPMDIAKEISKSLSERIVI  145

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DCKLELF FDS EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  146  SKVDDNLWDLERPLEADCKLELFDFDSPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  205

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  206  E--EGFFYEMAMGDSG  219



>ref|XP_004296468.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
 ref|XP_011462344.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
 ref|XP_011462345.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=114

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HPKDDAYL +V+PKRI LF  I+++          DPIKI L +G VKEGKKW T+P D+
Sbjct  4    HPKDDAYLTNVVPKRIRLFMEIQARHAALPS----DPIKITLLDGKVKEGKKWVTSPFDV  59

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRD  484
             KE+SKSLASNALIS+VNGVLWDM+RPLEGDC L+LFTF++ EGRD
Sbjct  60   VKEISKSLASNALISEVNGVLWDMTRPLEGDCDLKLFTFENAEGRD  105



>emb|CCF49315.1| probable THS1-threonyl tRNA synthetase, cytosolic [Ustilago hordei]
Length=770

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P++IAKE+SKSL+   +I
Sbjct  96   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSFETSPMNIAKEISKSLSERIVI  155

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLEGDCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  156  SKVDDTLWDLERPLEGDCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  215

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  216  E--EGFFYEMAMGDSG  229



>ref|XP_007880033.1| hypothetical protein PFL1_04316 [Pseudozyma flocculosa PF-1]
 gb|EPQ27989.1| hypothetical protein PFL1_04316 [Pseudozyma flocculosa PF-1]
Length=763

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q     S    PI++ +P+GSVKEG  W TTP+DIAK++SKSL+   +I
Sbjct  89   RIAMFEKLKAEQDAHAASQPRQPIQVTMPDGSVKEGTAWETTPMDIAKQISKSLSERVVI  148

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+  LWD+ RPLE   KL+LF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  149  AKVDDTLWDLERPLEQSAKLQLFDFESPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  208

Query  569  TRGEGFYYDAFYGD  610
               EGF+Y+   GD
Sbjct  209  D--EGFFYEMGMGD  220



>emb|CBQ69805.1| probable THS1-threonyl tRNA synthetase, cytosolic [Sporisorium 
reilianum SRZ2]
Length=764

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P+DIAKE+SKSL+   +I
Sbjct  90   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSKRQGTSYETSPMDIAKEISKSLSERIVI  149

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  150  SKVDDNLWDLERPLEADCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  209

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  210  E--EGFFYEMAMGDSG  223



>dbj|GAK66757.1| threonyl-tRNA synthetase [Pseudozyma antarctica]
Length=760

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  86   RIAMFEKLKAEQDAELAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  145

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  146  SKVDDTLWDLERPLEADCKLELFDFESAEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  205

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  206  E--EGFFYEMAMGDSG  219



>ref|XP_011391697.1| putative threonine--tRNA ligase THS1 [Ustilago maydis 521]
 gb|KIS66786.1| putative threonine--tRNA ligase THS1 [Ustilago maydis 521]
Length=759

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  Q  ++   PI + +P+GS ++G  + T+P+DIAK++SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAQIAAMPRQPITVTMPDGSTRQGICYETSPMDIAKQISKSLSERIVI  144

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DCKLELF FDS EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDDNLWDLERPLEADCKLELFDFDSPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  205  E--EGFFYEMAMGDSG  218



>dbj|GAC77380.1| threonyl-trna synthetase [Pseudozyma antarctica T-34]
Length=759

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAELAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  144

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DC+LELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDDTLWDLERPLEADCRLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  205  E--EGFFYEMAMGDSG  218



>gb|ETS60492.1| hypothetical protein PaG_05336 [Pseudozyma aphidis DSM 70725]
Length=757

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  83   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  142

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DC+LELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  143  SKVDDTLWDLERPLEADCRLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  202

Query  569  TRGEGFYYDAFYGDLG  616
               EGF+Y+   GD G
Sbjct  203  E--EGFFYEMAMGDSG  216



>gb|EPB83961.1| threonyl-tRNA synthetase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=716

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 97/149 (65%), Gaps = 1/149 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  RI +F+ +K+    +      +PI I LP+G+ KEG  W TTPL IA  ++KSLA  
Sbjct  42   LQHRIDMFDRLKAAADAEIAQKPREPITITLPDGTQKEGTSWETTPLSIALGIAKSLAER  101

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +ISKV+G LWD++RPLEG CKLEL  FD+DEG+  FWHSSAH+LG++ E  Y C LCIG
Sbjct  102  TVISKVDGELWDLTRPLEGSCKLELLDFDNDEGKMVFWHSSAHMLGEACERHYACNLCIG  161

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P    G GFYY+    D  +++  +  +E
Sbjct  162  PPLKEG-GFYYEMGVEDRVVSQQDYANLE  189



>dbj|GAN09335.1| threonyl-tRNA synthetase [Mucor ambiguus]
Length=716

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HP +       +  RI +F+ +K+    +      +PI I LP+G+ KEG  W TTPL I
Sbjct  31   HPLEITPAPEFLQHRIDMFDKLKAAADAEIAQKPREPITITLPDGTQKEGTSWETTPLSI  90

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A  ++KSLA   +ISKV+G LWD++RPLE  CKLEL  F++DEG+  FWHSSAH+LG++ 
Sbjct  91   ALGIAKSLAERTVISKVDGELWDLTRPLEASCKLELLDFENDEGKMVFWHSSAHMLGEAC  150

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  YGC LCIGP    G GFYY+    D  +++  +  +E
Sbjct  151  ERHYGCNLCIGPPLKEG-GFYYEMGVEDRVVSQQDYANLE  189



>ref|XP_003080220.1| putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
Length=673

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +2

Query  272  DPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLE  451
            +PI + LP+G VK G ++ TTP D+A  + K LA NAL++KV+G  WDM RPLEGDC L+
Sbjct  50   EPIAVTLPDGGVKAGVRFATTPYDVAMSIHKKLAQNALVAKVDGEFWDMRRPLEGDCALQ  109

Query  452  LFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNED  628
            +FTFD  EG++ +WHSSAH+LG+++E++YG  L IGP     EGFYYD F G+  LN D
Sbjct  110  MFTFDDAEGKECYWHSSAHVLGEALELEYGADLTIGPAIE--EGFYYDCFLGERTLNPD  166



>emb|CCV00396.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=737

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++Q   R +    PI I +P+GS +EG KW T+P+D+A+++SKSL+   +I
Sbjct  60   RIDMFERVKAEQDAARAAAERSPIVITMPDGSTREGTKWETSPMDVARQISKSLSERVVI  119

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKVNG LWD+ RPLE +  LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  120  SKVNGQLWDLERPLEDNVTLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  179

Query  569  TRGEGFYYDAFYGDLG  616
               +GFYY+   GD G
Sbjct  180  D--DGFYYEMGMGDSG  193



>emb|CEG83597.1| Putative Threonyl-tRNA synthetase [Rhizopus microsporus]
Length=177

 Score =   140 bits (354),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 6/142 (4%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIELFDKWKKEADEEIAKKPREPITITLPDGSTKEGVSWETTPLSLAADISK  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  545  KLCIGPCTTRGEGFYYDAFYGD  610
             LCIGP     EGFYY+    D
Sbjct  157  HLCIGP--PLDEGFYYEMGVKD  176



>emb|CEF98631.1| Anticodon-binding [Ostreococcus tauri]
Length=693

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +2

Query  272  DPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLE  451
            +PI + LP+G VK G ++ TTP D+A  + K LA NAL++KV+G  WDM RPLEGDC L+
Sbjct  50   EPIAVTLPDGGVKAGVRFATTPYDVAMSIHKKLAQNALVAKVDGEFWDMRRPLEGDCALQ  109

Query  452  LFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNED  628
            +FTFD  EG++ +WHSSAH+LG+++E++YG  L IGP     EGFYYD F G+  LN D
Sbjct  110  MFTFDDAEGKECYWHSSAHVLGEALELEYGADLTIGPAIE--EGFYYDCFLGERTLNPD  166



>ref|XP_002771785.1| threonyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03601.1| threonyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
Length=820

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 106/152 (70%), Gaps = 11/152 (7%)
 Frame = +2

Query  218  LFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKV  397
            LF+ + + Q+ +  +L  DPI I LP+G+ KEG+K+ TTPLDIA  +SK LA++ + +K+
Sbjct  62   LFDKLYAAQEERLAALPKDPITIVLPDGTQKEGRKFETTPLDIAIGISKGLANSVVAAKI  121

Query  398  ---------NGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
                     +  +WD+SRPLEG CKLEL  FDS EG+DTFWHSSAHILG+++E +YGC L
Sbjct  122  LYTEPVDSMDQTVWDLSRPLEGSCKLELLKFDSPEGKDTFWHSSAHILGEAMEQEYGCYL  181

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             IGP      GFYYD F+G+L L  + +++IE
Sbjct  182  TIGPPLE--NGFYYDGFFGNLKLGPNDYEKIE  211



>emb|CEP09308.1| hypothetical protein [Parasitella parasitica]
Length=987

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K+    +      +PI + LP+GS KEG  W TTP  IA  ++KSLA   +I
Sbjct  316  RIDMFDRLKAAADAEIAQKPREPITVTLPDGSQKEGTSWETTPFSIALGIAKSLAERTVI  375

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+G LWD++RPLE  CKLEL  FD+ EG+  FWHSSAH+LG++ E  Y C LCIGP  
Sbjct  376  SKVDGELWDLTRPLESSCKLELLDFDNQEGKMVFWHSSAHMLGEACERHYACNLCIGPPL  435

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
            + G GFYY+    D  +N+D +  +E
Sbjct  436  SEG-GFYYEMGVEDRVVNQDDYANLE  460



>gb|KIY63302.1| threonyl-tRNA synthetase [Cylindrobasidium torrendii FP15055 
ss-10]
Length=702

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 94/129 (73%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI LFE +K++   +  + + +PI++ +P+GS + G  W T+P+DIAKE+SKSL+   +I
Sbjct  37   RIKLFEELKAEYDAEVKAKTKEPIEVTMPDGSTRTGTSWETSPMDIAKEVSKSLSERIVI  96

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG+S E  YGC LC+GP T
Sbjct  97   AKVDGNLWDLERPLEGPCKLELLDFEHPEGKRVFWHSSAHVLGESAEKHYGCHLCLGPPT  156

Query  569  TRGEGFYYD  595
               +GF+Y+
Sbjct  157  D--DGFFYE  163



>gb|KDN39007.1| threonyl-tRNA synthetase [Tilletiaria anomala UBC 951]
Length=756

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 3/140 (2%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S    RI LFE +K++Q     +   D I I LP+GS K GK W T+P+DIAK +SKSLA
Sbjct  72   SFFSHRIQLFEKLKAEQDAHAAAQPRDGINITLPDGSNKPGKAWETSPMDIAKAISKSLA  131

Query  374  SNALISKVNG-VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
               +ISKV+   LWD+ RPLE  CK+E F F+SDEG+  FWHSSAH+LG++ E  YGC L
Sbjct  132  ERIVISKVDDETLWDLERPLEKSCKVEFFDFNSDEGKRVFWHSSAHVLGEAAEQHYGCHL  191

Query  551  CIGPCTTRGEGFYYDAFYGD  610
            CIGP T+  EGF+Y+   G+
Sbjct  192  CIGPPTS--EGFFYEMGMGE  209



>ref|XP_636821.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
 sp|Q54J66.1|SYTC1_DICDI RecName: Full=Probable threonine--tRNA ligase 1, cytoplasmic; 
AltName: Full=Threonyl-tRNA synthetase; Short=ThrRS [Dictyostelium 
discoideum]
 gb|EAL63315.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
Length=710

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            + +RI ++ES+K++       +  +PI + LP+G V  G K  TTP DIAK +S+ LA +
Sbjct  50   VKERIEIWESLKAKHLESLKDMKEEPINVTLPDGKVVAGIKNKTTPYDIAKGISRGLADS  109

Query  380  ALISKVNG-VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCI  556
             + SKVNG  +WD+SRPLE DC L+L  FDS+EG+ TFWHSSAHILGQ++E  YG +LCI
Sbjct  110  IVSSKVNGEQIWDISRPLEADCNLQLCKFDSEEGKKTFWHSSAHILGQAMERIYGGQLCI  169

Query  557  GPCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            GP T+  EGFYYD   GD  ++ + +K I
Sbjct  170  GPATS--EGFYYDMAMGDKIVSAEDYKLI  196



>gb|ESW99362.1| Threonine--tRNA ligase, cytoplasmic [Ogataea parapolymorpha DL-1]
Length=714

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +FE IK++Q  +  +    PIK+ L +G+VKE   W TTP DIAKE+ KS    
Sbjct  43   IEHRIRIFERIKARQDAELAAKERLPIKVTLKDGTVKEATSWETTPFDIAKEIGKSFCER  102

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +ISKVNG LWD+ RP E D KLE F FDS EG+  FWHSSAHILG+  E  YG  LC G
Sbjct  103  QVISKVNGELWDLERPFEADSKLEFFDFDSPEGKQVFWHSSAHILGEGCENHYGAHLCFG  162

Query  560  PCTTRGEGFYYDAFY--GDLGLNEDHFKQIE  646
            P T   +GF+YD     GD  ++++ F  IE
Sbjct  163  PPTE--DGFFYDMAIDEGDYKVSQNDFSDIE  191



>gb|KIZ00239.1| threonyl-tRNA synthetase [Monoraphidium neglectum]
Length=659

 Score =   147 bits (370),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 73/149 (49%), Positives = 101/149 (68%), Gaps = 4/149 (3%)
 Frame = +2

Query  206  KRISLFESI--KsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            KRI+LFE    + QQ+++    +  PIK+ LP+G++KE  K  TTPLD+A E+SKSL   
Sbjct  31   KRIALFEQFYEREQQRVEEARKAAVPIKVVLPDGAIKEAIKGATTPLDVANEISKSLGKK  90

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             L++ V+G +WD  RPLE DC L+L T+D  +G++TFWHSSAH+LG+++EM++G  L IG
Sbjct  91   VLVATVDGEVWDAFRPLEADCALQLLTWDEPDGKETFWHSSAHVLGEALEMEFGVDLTIG  150

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P     EGFYYD + GD  L E     IE
Sbjct  151  PALE--EGFYYDCYMGDKTLAEAERPSIE  177



>ref|NP_001022034.1| Protein TARS-1, isoform b [Caenorhabditis elegans]
 emb|CAD89723.1| TARS-1, isoform b [Caenorhabditis elegans]
Length=684

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  349
            P D A   + I +RI L++ +K++   +  +   +PI+I LP+G + EGK W TTP +IA
Sbjct  5    PTDMAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIA  64

Query  350  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  529
            + +SK LA  A+I+KVNG +WD+ RP EG+ KLEL  FD DE +  FWHSSAH+LG+++E
Sbjct  65   ERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAME  124

Query  530  MKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
               G  LC GP     EGFYYD ++ +  +  D F +I+
Sbjct  125  RYCGGHLCYGPPIQ--EGFYYDMWHENRTICPDDFPKID  161



>ref|NP_001022033.1| Protein TARS-1, isoform a [Caenorhabditis elegans]
 sp|P52709.1|SYTC_CAEEL RecName: Full=Threonine--tRNA ligase, cytoplasmic; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Caenorhabditis elegans]
 emb|CAA93762.1| TARS-1, isoform a [Caenorhabditis elegans]
Length=725

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  349
            P D A   + I +RI L++ +K++   +  +   +PI+I LP+G + EGK W TTP +IA
Sbjct  46   PTDMAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIA  105

Query  350  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  529
            + +SK LA  A+I+KVNG +WD+ RP EG+ KLEL  FD DE +  FWHSSAH+LG+++E
Sbjct  106  ERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAME  165

Query  530  MKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
               G  LC GP     EGFYYD ++ +  +  D F +I+
Sbjct  166  RYCGGHLCYGPPIQ--EGFYYDMWHENRTICPDDFPKID  202



>ref|XP_002432585.1| Threonyl-tRNA synthetase, cytoplasmic, putative [Pediculus humanus 
corporis]
 gb|EEB19847.1| Threonyl-tRNA synthetase, cytoplasmic, putative [Pediculus humanus 
corporis]
Length=717

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +R  L+  +K+  + +  S + +PIKI LP+G + EG+ W T+P DIAK +S+ LA
Sbjct  50   NYIEERNVLWNKLKTAYEAEIASKTSNPIKITLPDGKIVEGESWKTSPYDIAKGISQGLA  109

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVNGVLWD+ RPLE DCKL+L  FD +E +  FWHS+AHILG+++E  YG  LC
Sbjct  110  DNTVIAKVNGVLWDLERPLESDCKLQLLKFDDEEAQQVFWHSTAHILGEALERLYGGHLC  169

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F  D  ++   F  IE
Sbjct  170  YGPPIEN--GFYYDMFTPDSQVSNTDFPSIE  198



>ref|XP_009919139.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Haliaeetus albicilla]
Length=323

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D  Y  S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP
Sbjct  38   HRNDLQYEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMTEGESWKTTP  97

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  98   YQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  157

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  158  EAMEGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  198



>emb|CDI55881.1| probable THS1-threonyl tRNA synthetase, cytosolic [Melanopsichium 
pennsylvanicum 4]
Length=770

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI++FE +K++Q  +  +    PI + +P+GS ++   ++T+P+DIAK++SKSL+   +I
Sbjct  95   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQVTSYDTSPMDIAKDISKSLSERIVI  154

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  155  SKVDDNLWDLERPLEADCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  214

Query  569  TRGEGFYYDAFYGDLG  616
               +GF+Y+   GD G
Sbjct  215  E--DGFFYEMAMGDSG  228



>gb|KIJ16340.1| hypothetical protein PAXINDRAFT_168488 [Paxillus involutus ATCC 
200175]
Length=728

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI LFE ++++      + S + I I +P+GS ++G  W TTP+D+AKE+SKSL+
Sbjct  51   AYIDERIKLFEQLQAEYNEYVKAQSREEIAITMPDGSERKGTSWQTTPMDVAKEVSKSLS  110

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            IGP T   +GF+Y+    D  +    +  +E
Sbjct  171  IGPPT--DDGFFYEMAIEDRVVTNTDYPALE  199



>gb|ENN74529.1| hypothetical protein YQE_08853, partial [Dendroctonus ponderosae]
 gb|ERL89808.1| hypothetical protein D910_07169 [Dendroctonus ponderosae]
Length=699

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I +R+ L++ +K+Q +    + +P PIK+ LP+G V E   W TT  D+AK +S+ LA
Sbjct  26   SFIQERLQLWDKLKAQYEADLAAKTPAPIKVTLPDGKVVEATAWKTTVYDVAKGISQGLA  85

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N++ISKVNGVLWD+ RPLE DCK+EL  FD  E +  FWHS+AH+LG+++E  YG  LC
Sbjct  86   DNSVISKVNGVLWDLDRPLESDCKVELLKFDDTEAQAVFWHSTAHVLGEALERIYGGCLC  145

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD +  + G+++  F  +E
Sbjct  146  YGPPIE--SGFYYDMWLDEKGISQSDFPYVE  174



>gb|EMD37085.1| hypothetical protein CERSUDRAFT_84103 [Ceriporiopsis subvermispora 
B]
Length=723

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++      +   + I I LP+GSV++GK W T+P+D+AKE+SK LA   +I
Sbjct  57   RIKIFEKLKAEYDEWVKAQPREEIDITLPDGSVRKGKSWETSPMDVAKEISKGLADRIVI  116

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVN  +WD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  117  AKVNDNVWDLERPLEGSCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  176

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  177  E--EGFFYE  183



>gb|KIK95681.1| hypothetical protein PAXRUDRAFT_140136 [Paxillus rubicundulus 
Ve08.2h10]
Length=730

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI LFE ++++      + S + I I +P+GS ++G  W TTP+D+AKE+SKSL+
Sbjct  51   AYIDERIKLFEQLQAEYNEHVKAQSREEITITMPDGSERKGTSWETTPMDVAKEVSKSLS  110

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  554  IGPCTTRGEGFYYD  595
            IGP T   +GF+Y+
Sbjct  171  IGPPT--DDGFFYE  182



>gb|EFA05822.1| hypothetical protein TcasGA2_TC008604 [Tribolium castaneum]
Length=685

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  19   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  78

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  79   DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  138

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F  D G++   F  +E
Sbjct  139  YGPPIE--SGFYYDMFLEDKGISAGDFPYLE  167



>ref|XP_008198247.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Tribolium 
castaneum]
Length=712

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  46   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  105

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  106  DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  165

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F  D G++   F  +E
Sbjct  166  YGPPIE--SGFYYDMFLEDKGISAGDFPYLE  194



>ref|XP_967345.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Tribolium 
castaneum]
Length=707

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  41   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  100

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  101  DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  160

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F  D G++   F  +E
Sbjct  161  YGPPIE--SGFYYDMFLEDKGISAGDFPYLE  189



>emb|CEI97578.1| Putative Threonyl-trna synthetase [Rhizopus microsporus]
Length=463

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 98/154 (64%), Gaps = 6/154 (4%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIGLFDKWKKEADEEIAKKPREPITITLPDGSTKEGISWETTPLSLAADISK  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LCIGP     EGFYY+    D  ++++ +  +E
Sbjct  157  HLCIGP--PLDEGFYYEMGVKDRVVSQNDYPNLE  188



>gb|KIP05628.1| hypothetical protein PHLGIDRAFT_24993 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=730

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++          + I+I LP+GS ++G  W T+PLDIAKE+SK LA   +I
Sbjct  59   RIKIFEKLKAEYDEWVKVQPREEIEITLPDGSKRKGTSWETSPLDIAKEISKGLADRIVI  118

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+G +WD+ RPLEG C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  119  SKVDGAVWDLERPLEGSCSLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  178

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               EGF+Y+    D  +    +  +E
Sbjct  179  --DEGFFYEMAIQDRPVTHADYPSLE  202



>gb|EIE81909.1| hypothetical protein RO3G_06614 [Rhizopus delemar RA 99-880]
Length=713

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 6/137 (4%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            YLQ     RI LFE +K +   +      +PI I LP+GSVKEG  W TTP+ IA  ++K
Sbjct  28   YLQH----RIDLFEKLKKEADEEIAKKPREPITITLPDGSVKEGTSWETTPISIAVGIAK  83

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            SLA   +I+KV+G LWD++RP E  C+LEL  F+++EG+  FWHSSAH+LG++ E  YGC
Sbjct  84   SLAERTVIAKVDGELWDLTRPFEKSCQLELLDFENEEGKKVFWHSSAHMLGEACERHYGC  143

Query  545  KLCIGPCTTRGEGFYYD  595
             LCIGP     EGFYY+
Sbjct  144  HLCIGPPLD--EGFYYE  158



>gb|KFV55285.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Tyto 
alba]
Length=673

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIMLTDGKVAEGESWKTTPYQLAIGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD + GD G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIGDRGVSSTEFSLLE  153



>ref|XP_009968247.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Tyto alba]
Length=708

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  37   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIMLTDGKVAEGESWKTTPYQLAIGISQ  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  97   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  156

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD + GD G++   F  +E
Sbjct  157  CLCYGPPIEN--GFYYDMYIGDRGVSSTEFSLLE  188



>gb|KFM74402.1| Threonine--tRNA ligase, cytoplasmic, partial [Stegodyphus mimosarum]
Length=670

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I +R+ ++E + +  + +  + +P+PI I LP+G V EG+ W TTP  IA+ +S+ LA
Sbjct  37   SYIQERLEMWEKLYADYKAELAAKTPNPITITLPDGKVVEGESWRTTPYQIAQGISQGLA  96

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             + +I+KVNG LWD+ RPLE DCKLEL  FDS+EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  97   DSVVIAKVNGELWDLDRPLELDCKLELKKFDSEEGKQVFWHSSAHMLGEAMERVYGGCLC  156

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F     ++++ F  +E
Sbjct  157  YGPPIEN--GFYYDMFLESNSVSKNEFPVLE  185



>gb|KIJ63654.1| hypothetical protein HYDPIDRAFT_175966 [Hydnomerulius pinastri 
MD-312]
Length=728

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI LFE ++++      +   + I I +P+GS ++G  W T+P+DIAKE+SKSL+
Sbjct  51   AYIDQRIKLFEQLQAEHSDFVKAQPREDITITMPDGSERKGTSWETSPMDIAKEVSKSLS  110

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            IGP T   +GF+Y+    D  +    +  +E
Sbjct  171  IGPPT--DDGFFYEMAIEDRVVTNADYPALE  199



>ref|XP_010160781.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Caprimulgus carolinensis]
Length=313

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 98/152 (64%), Gaps = 5/152 (3%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  370
            I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S++L
Sbjct  39   IEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKVAEGESWKTTPYQLAVGISQAL  98

Query  371  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  550
            ASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G  L
Sbjct  99   ASNAVIAKVNGDLWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGGCL  158

Query  551  CIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            C GP      GFYYD +  D G++   F  +E
Sbjct  159  CYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  188



>ref|XP_006455238.1| hypothetical protein AGABI2DRAFT_226641 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV43973.1| hypothetical protein AGABI2DRAFT_226641 [Agaricus bisporus var. 
bisporus H97]
Length=721

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K +      +   + I I LP+GS ++GK W T+PLDIAK LSKSLA   +I
Sbjct  56   RIKMFDELKVKYDAFVAAQPREEITITLPDGSERKGKSWETSPLDIAKLLSKSLADRVVI  115

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+GVLWD+ RPLE   KLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  SKVDGVLWDLERPLEKSVKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCIGPPT  175

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  176  --DEGFFYE  182



>ref|XP_011158574.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Solenopsis 
invicta]
Length=709

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  RI L++ +K +      + +P  I + LP+G    GK W TTP D+AK +S+ LA
Sbjct  43   SYIQDRIVLWDKLKKEYDDSVAAKTPANITVTLPDGKKISGKSWRTTPYDVAKGISQGLA  102

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  103  DNTVIAKVNNELWDLDRPLESDCKLQLLKFDEPEGQQVFWHSSAHVLGEAMERVYGGCLC  162

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  163  YGPPIEN--GFYYDMYLGDQGISNADFPYLE  191



>gb|EFZ18882.1| hypothetical protein SINV_16250 [Solenopsis invicta]
Length=807

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  RI L++ +K +      + +P  I + LP+G    GK W TTP D+AK +S+ LA
Sbjct  205  SYIQDRIVLWDKLKKEYDDSVAAKTPANITVTLPDGKKISGKSWRTTPYDVAKGISQGLA  264

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  265  DNTVIAKVNNELWDLDRPLESDCKLQLLKFDEPEGQQVFWHSSAHVLGEAMERVYGGCLC  324

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  325  YGPPIE--NGFYYDMYLGDQGISNADFPYLE  353



>ref|XP_011158573.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Solenopsis 
invicta]
Length=714

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  RI L++ +K +      + +P  I + LP+G    GK W TTP D+AK +S+ LA
Sbjct  48   SYIQDRIVLWDKLKKEYDDSVAAKTPANITVTLPDGKKISGKSWRTTPYDVAKGISQGLA  107

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  108  DNTVIAKVNNELWDLDRPLESDCKLQLLKFDEPEGQQVFWHSSAHVLGEAMERVYGGCLC  167

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  168  YGPPIE--NGFYYDMYLGDQGISNADFPYLE  196



>ref|XP_011397153.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24266.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
Length=727

 Score =   144 bits (362),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +2

Query  275  PIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLEL  454
            P++I LP+G V++G K  TTPLDIA  LSKSLA  A++++V+G  WD+ RPLE DC L +
Sbjct  77   PVQITLPDGHVRDGVKDVTTPLDIAAALSKSLAKKAVVAEVDGKPWDLFRPLEQDCNLAI  136

Query  455  FTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNE  625
             TFDS +G+D FWHSSAHILGQS+E+++G +L IGP     EGFYYD + GD  L E
Sbjct  137  HTFDSPKGKDAFWHSSAHILGQSLELEFGAELTIGPALE--EGFYYDCYLGDRTLCE  191



>gb|KFH73555.1| threonyl-tRNA synthetase [Mortierella verticillata NRRL 6337]
Length=725

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  RI++F+ +K +      +    PI I +P+GSV+EG  W T+P+DIAK ++KSL+  
Sbjct  54   VAHRIAMFDELKKKSDAADAAQPRVPITITMPDGSVREGTAWETSPMDIAKSIAKSLSER  113

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KV+ VLWD+ RPL   CKLEL  F+++EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  114  VVIAKVDKVLWDLERPLVASCKLELLDFENEEGKSVFWHSSAHVLGEACEKHYGCHLCIG  173

Query  560  PCTTRGEGFYYDAFYGD  610
            P     +GFYY+    D
Sbjct  174  PPIE--DGFYYEMAMKD  188



>gb|EMC81245.1| putative threonyl-tRNA synthetase 2, cytoplasmic, partial [Columba 
livia]
Length=673

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAHRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYMEDRGVSSTEFSLLE  153



>gb|KJA25358.1| hypothetical protein HYPSUDRAFT_64939 [Hypholoma sublateritium 
FD-334 SS-4]
Length=724

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K++      +   D I + +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  57   RIKIFDELKAEYDAFVAAQPRDEITVTMPDGSERKGKAWETSPMDVAKEVSKSLSERIVI  116

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+GVLWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGVLWDLDRPLEKACKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCLGPPT  176

Query  569  TRGEGFYYDAFYGD  610
               +GF+Y+    D
Sbjct  177  --DDGFFYEMAIND  188



>emb|CEG74606.1| Putative Threonyl-tRNA synthetase [Rhizopus microsporus]
Length=717

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 98/154 (64%), Gaps = 6/154 (4%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIELFDKWKKEADEEIAKKPREPITITLPDGSTKEGISWETTPLSLAADISK  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LCIGP     EGFYY+    D  ++++ +  +E
Sbjct  157  HLCIGPPL--DEGFYYEMGVKDRVVSQNDYPNLE  188



>gb|KFP72660.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Apaloderma 
vittatum]
Length=562

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            + I  R+ L+E++K +        + +   PIKI L +G   EG+ W TTP  +A  +S+
Sbjct  2    NFIEDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKTTEGESWKTTPYQLAAGVSQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   GLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++ + F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSNEFPLLE  153



>ref|XP_002631322.1| C. briggsae CBR-TRS-1 protein [Caenorhabditis briggsae]
Length=704

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  349
            P D +   + I +RI L++ +K++   +  +   +PI+I LP+G V EGK W TTP +IA
Sbjct  26   PTDMSPWPAFIDERIKLWDKLKNEYDAEIEAKESEPIEITLPDGKVHEGKSWRTTPFEIA  85

Query  350  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  529
            + +SK LA  A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E
Sbjct  86   ERISKGLAEAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAME  145

Query  530  MKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
               G  LC GP     EGFYYD ++ +  +  + F +I+
Sbjct  146  RYCGGHLCYGPPIQ--EGFYYDMWHENRTICPEDFPKID  182



>ref|XP_009867831.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Apaloderma vittatum]
Length=628

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D     + I  R+ L+E++K +        + +   PIKI L +G   EG+ W TTP
Sbjct  60   HQNDLESEPNFIEDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKTTEGESWKTTP  119

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  120  YQLAAGVSQGLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  179

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++ + F  +E
Sbjct  180  EAMEGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSNEFPLLE  220



>gb|KIK27269.1| hypothetical protein PISMIDRAFT_28163 [Pisolithus microcarpus 
441]
Length=728

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = +2

Query  188  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  367
            L + +  RI +FE ++ +      +   + I I +P+GS ++G  W T+P+D+AKE+SKS
Sbjct  49   LPNYVDHRIKMFEQLQQEYTEFVKAQPREEITITMPDGSQRKGTSWETSPMDVAKEVSKS  108

Query  368  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  547
            L+   +I+KVN  LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC 
Sbjct  109  LSERIVIAKVNDQLWDLERPLESSCKLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCH  168

Query  548  LCIGPCTTRGEGFYYD  595
            LCIGP T   EGF+Y+
Sbjct  169  LCIGPPT--DEGFFYE  182



>emb|CAP23504.2| Protein CBR-TARS-1 [Caenorhabditis briggsae]
Length=729

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +2

Query  170  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  349
            P D +   + I +RI L++ +K++   +  +   +PI+I LP+G V EGK W TTP +IA
Sbjct  50   PTDMSPWPAFIDERIKLWDKLKNEYDAEIEAKESEPIEITLPDGKVHEGKSWRTTPFEIA  109

Query  350  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  529
            + +SK LA  A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E
Sbjct  110  ERISKGLAEAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAME  169

Query  530  MKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
               G  LC GP     EGFYYD ++ +  +  + F +I+
Sbjct  170  RYCGGHLCYGPPIQ--EGFYYDMWHENRTICPEDFPKID  206



>gb|EPE06040.1| threonyl-trna synthetase [Ophiostoma piceae UAMH 11346]
Length=770

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            IP R+++++ +K+    +  S+  +PI + LP+G   EG  W+T P DIA+ +SKSLA  
Sbjct  30   IPHRLAIYDRLKAVADAKVASMPREPITVTLPDGRKIEGTAWDTRPYDIARGISKSLADR  89

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +ISKVNGVLWD+ RP EGD  +EL  F+ +E +  FWHSSAHILG++ E ++GC LC G
Sbjct  90   TVISKVNGVLWDLMRPFEGDAAVELLDFEDEEAKRVFWHSSAHILGEAAEKQFGCHLCFG  149

Query  560  PCTTRGEGFYYD  595
            P T   EGF+YD
Sbjct  150  PPTD--EGFFYD  159



>gb|KIO11143.1| hypothetical protein M404DRAFT_13351 [Pisolithus tinctorius Marx 
270]
Length=639

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +FE ++        +   + I I +P+GS ++G  W T+P+D+AKE+SKSL+  
Sbjct  53   IDHRIKMFEQLQQDYIEFVKAQPREEITITMPDGSERKGMSWETSPMDVAKEVSKSLSER  112

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KV+G LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  113  IVIAKVDGELWDLERPLERSCKLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  172

Query  560  PCTTRGEGFYYD  595
            P T   EGF+Y+
Sbjct  173  PPT--DEGFFYE  182



>ref|XP_008925398.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase 
2, cytoplasmic [Manacus vitellinus]
Length=724

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D   + S I  R+ L+E++K +        + +    IKI L +G++ EG+ W TTP
Sbjct  46   HQSDLQCVPSFIEDRLKLYEALKKEHDALLAYRAANQSQSIKITLKDGTMAEGESWKTTP  105

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              IA  +S++LASNA+I+KVNG LWD+ RPLEGDC LEL TFD +E +  +WHSSAHILG
Sbjct  106  YQIAVGISQALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDDEEAKAVYWHSSAHILG  165

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  166  EAMEGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  206



>ref|XP_005511265.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Columba 
livia]
Length=772

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  101  SFIEDRLKLYEALKKEHDALLAHRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  160

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  161  VLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  220

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  221  CLCYGPPIEN--GFYYDMYMEDRGVSSTEFSLLE  252



>ref|XP_003288175.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
 gb|EGC35308.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
Length=713

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I +RI+++E +K+Q      +L  +PI I LP+G V  G K  TTP D+AK +S+ LA +
Sbjct  54   IKERIAIWEGLKAQHLEAIKNLPDEPILITLPDGKVIHGVKNKTTPYDVAKGISRGLADS  113

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             + S VN  + D+SRPLEGDCKLEL  FD+D G+ TFWHSSAHILGQ++E  YG +LCIG
Sbjct  114  IVSSIVNEQIHDISRPLEGDCKLELCKFDTDAGKKTFWHSSAHILGQAMERVYGGQLCIG  173

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQI  643
            P T+  EGFYYD   G+  ++ + +K I
Sbjct  174  PATS--EGFYYDMAMGEKIVSAEDYKLI  199



>gb|KFQ99509.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Opisthocomus 
hoazin]
Length=673

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A E+S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRATNQSKPIKITLTDGKMVEGESWKTTPYQLATEISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             L+SNA+I+KVN  LWD+ RPLEGDC LEL TFDS+E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLSSNAVIAKVNSELWDLDRPLEGDCTLELLTFDSEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|KFP96981.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Leptosomus 
discolor]
Length=673

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E +K +          +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEVLKKEHDALLAYRVANQSKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            +LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   ALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYMEDRGVSSTEFPLLE  153



>ref|XP_010570569.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Haliaeetus 
leucocephalus]
Length=786

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D  Y  S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP
Sbjct  106  HRNDLQYEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMTEGESWKTTP  165

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  166  YQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  225

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  226  EAMEGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  266



>ref|XP_009944987.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Leptosomus discolor]
Length=708

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D     S I  R+ L+E +K +          +   PIKI L +G + EG+ W TTP
Sbjct  28   HQNDLQCEPSFIEDRLKLYEVLKKEHDALLAYRVANQSKPIKITLTDGKMAEGESWKTTP  87

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S++LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  88   YQLAVGISQALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  147

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  148  EAMEGYFGGCLCYGPPIEN--GFYYDMYMEDRGVSSTEFPLLE  188



>ref|XP_007769801.1| threonyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW79924.1| threonyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
Length=757

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE ++++      +     I + LP+GS ++G  W T+P+DIAKE+SK L+   +I
Sbjct  77   RIQIFEKLQAEHTEWVKAQPRQEITVTLPDGSERKGTSWETSPMDIAKEISKGLSEKVVI  136

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  CKL L  F+SDEG+  FWHSSAH+LG+S E  YGC LCIGP T
Sbjct  137  AKVDGTLWDLERPLEASCKLVLLDFESDEGKRVFWHSSAHVLGESAERHYGCHLCIGPPT  196

Query  569  TRGEGFYYD  595
               +GF+Y+
Sbjct  197  E--DGFFYE  203



>ref|XP_003116880.1| CRE-TARS-1 protein [Caenorhabditis remanei]
 gb|EFO85746.1| CRE-TARS-1 protein [Caenorhabditis remanei]
Length=749

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI L++ +K +   +  +   +PI+I LP+G V +GK W TTP +IA+++SK LA
Sbjct  78   AFIEERIKLWDKLKLEYDAEIAAKVSEPIEITLPDGKVHDGKSWRTTPFEIAEKISKGLA  137

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
              A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E   G  LC
Sbjct  138  EAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAMERYCGGHLC  197

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP     EGFYYD ++ +  ++ + F +I+
Sbjct  198  YGPPIE--EGFYYDMWHENRTISPEDFPKID  226



>gb|KIM53290.1| hypothetical protein SCLCIDRAFT_1222926 [Scleroderma citrinum 
Foug A]
Length=715

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +FE ++ +  +   S   + I I +P+GS ++G  W T+P+DIAKE+SKSL+  
Sbjct  40   IDHRIKMFEQLQEEYDVFVKSQQREEITITMPDGSQRKGTSWETSPMDIAKEVSKSLSER  99

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KVNG LWD+ RPLE  CK+EL  F+  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  100  VVIAKVNGELWDLERPLESSCKVELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  159

Query  560  PCTTRGEGFYYD  595
            P T   +GF+Y+
Sbjct  160  PPT--DDGFFYE  169



>gb|KDQ13759.1| hypothetical protein BOTBODRAFT_44972 [Botryobasidium botryosum 
FD-172 SS1]
Length=736

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K++      +     I + +P+GS ++G  W T+P+DIAKE+SKSL+   +I
Sbjct  64   RIKIFDKLKAEHDEWLKNQPRQAISVTMPDGSARQGTSWETSPMDIAKEISKSLSERVVI  123

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  124  AKVNGELWDLERPLEASCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  183

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               EGF+Y+    D  ++   +  +E
Sbjct  184  E--EGFFYEMAINDRVVHPTDYAPLE  207



>ref|XP_009934283.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Opisthocomus 
hoazin]
Length=730

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A E+S+
Sbjct  59   SFIEDRLKLYEALKKEHDALLAYRATNQSKPIKITLTDGKMVEGESWKTTPYQLATEISQ  118

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             L+SNA+I+KVN  LWD+ RPLEGDC LEL TFDS+E +  +WHSSAHILG+++E  +G 
Sbjct  119  VLSSNAVIAKVNSELWDLDRPLEGDCTLELLTFDSEEAKAVYWHSSAHILGEAMEGYFGG  178

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  179  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  210



>ref|NP_001280151.1| probable threonyl-tRNA synthetase 2, cytoplasmic [Gallus gallus]
Length=784

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + +G+ W TTP  +A  +S+
Sbjct  113  SFIEDRLKLYETLKKEHDALLAYRAANETKPIKITLTDGKIADGESWKTTPYQLAVGISQ  172

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD  E +  +WHSSAHILG+++E  YG 
Sbjct  173  GLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDDQEAQAVYWHSSAHILGEAMEGYYGG  232

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  233  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPALE  264



>ref|XP_005650255.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE25711.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=1049

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD--PIKIELPNGSVKEGKKWNTTPL  340
            H ++   LQ  + +RI LF+  K+++         +  PI++ LP+G+ +EG K  TTP 
Sbjct  37   HEEEAQALQDYVKRRIDLFDQYKNREVEAVEKAKAENVPIRVTLPDGTTREGVKGVTTPQ  96

Query  341  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  520
            DI   LS+SLA  AL +KV+G ++D+ RPL+GDC+L++ TF+  +G++TFWHSSAH+LG+
Sbjct  97   DIVGTLSRSLAKKALAAKVDGEVYDIFRPLDGDCQLQILTFEDPDGKETFWHSSAHVLGE  156

Query  521  SVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNE  625
            ++E  +G KL IGP     EGFYYD + GD  L E
Sbjct  157  ALESCFGAKLTIGPALE--EGFYYDCYLGDRTLTE  189



>ref|XP_009992825.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Chaetura 
pelagica]
Length=735

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKs---qqqlqrlslsPDPIKIELPNGSVKEGKKWNTTP  337
            H KD     S I  R+ L+E++K         R +    PIKI L +G V EG+ W TTP
Sbjct  55   HQKDVQCEPSFIKDRLKLYEALKKEHDALLAYRAASESKPIKITLTDGKVAEGESWKTTP  114

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S+ LASNA+I+KVNG LWD+ R LEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  115  YQLAVGISQMLASNAVIAKVNGELWDLDRQLEGDCTLELLTFDNEEAKAVYWHSSAHILG  174

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  175  EAMEGYFGGCLCYGPPIEN--GFYYDMYLEDRGVSSTEFPLLE  215



>gb|KHN80838.1| Threonine--tRNA ligase, cytoplasmic [Toxocara canis]
Length=405

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 97/149 (65%), Gaps = 2/149 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  R++ F+ + ++++ +  + +P+ IKI LP+G   EG+ W TTP +IA ++S+ LA  
Sbjct  37   LDNRVAYFDKLMAKRKAELAAKNPEQIKITLPDGKELEGQSWRTTPFEIAAKISRGLADT  96

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
            AL +KVNG +WD+ RP EGD  ++  TF+ +EG+  FWHSSAHILGQ+ E   G  LC G
Sbjct  97   ALAAKVNGEVWDLDRPFEGDATVQFLTFEDEEGKQVFWHSSAHILGQAAERYCGAHLCYG  156

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P     EGFYYD F  D  ++ + F ++E
Sbjct  157  PPL--AEGFYYDMFKEDGSISPEDFAKLE  183



>gb|ELU38637.1| Ths1p [Rhizoctonia solani AG-1 IA]
Length=752

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  90   RIQIYDKLKKEYDEFVSAQPREPITITLPDGSTKEGKSWETSPMSIAAQLSKSLSERVVI  149

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  150  AKVDGNLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  209

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GF+Y+    +  ++   +  +E
Sbjct  210  --DDGFFYEMAIQERAVSSGDYSSLE  233



>dbj|GAA98628.1| hypothetical protein E5Q_05315 [Mixia osmundae IAM 14324]
 gb|KEI38990.1| hypothetical protein L969DRAFT_88382 [Mixia osmundae IAM 14324]
Length=798

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            + +R++LFE +K++Q  +  + + + I+I LP+G VK+G  + T+P+ IA ++SK LA  
Sbjct  115  LARRLALFEQLKAEQDAELKNKAKEVIEITLPSGDVKKGTSYETSPMSIALDISKGLAEK  174

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KV+G LWD+ RPLE  CKLEL  F+S EG++ FWHSSAHILG++ E  YGC LCIG
Sbjct  175  TVIAKVDGDLWDLERPLEKSCKLELLDFESKEGKNVFWHSSAHILGEAAERHYGCHLCIG  234

Query  560  PCTTRGEGFYYD  595
            P T   EGF+Y+
Sbjct  235  PPT--DEGFFYE  244



>ref|XP_009550526.1| hypothetical protein HETIRDRAFT_65578 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77277.1| hypothetical protein HETIRDRAFT_65578 [Heterobasidion irregulare 
TC 32-1]
Length=739

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  346
            HP +     +    RI +F+ +K++      +   + I I LP+GS ++G  W T+P+D+
Sbjct  45   HPLEMQPAPAFFDHRIKIFDRLKAEHDAFVAAQPREEIAITLPDGSQRKGTSWETSPMDV  104

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            AKE+SKSL+   +I+KV+ VLWD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG++ 
Sbjct  105  AKEISKSLSERLVIAKVDDVLWDLERPLEGPCKLELLDFEHPEGKKVFWHSSAHVLGEAS  164

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  YGC LCIGP T   +GF+Y+    D  +    +  +E
Sbjct  165  ERHYGCHLCIGPPTD--DGFFYEMAIEDRPVTNADYPSLE  202



>emb|CDO68587.1| hypothetical protein BN946_scf184996.g18 [Trametes cinnabarina]
Length=729

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            R+ +FE +K+       +     I + LP+GS ++G  W TTP+D+AKE+++SLA   +I
Sbjct  56   RLKIFEKLKADYDEWVKNQPRQEITVTLPDGSQRKGTSWETTPMDVAKEIAQSLADRVVI  115

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG LWD+ RPLEG C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  AKVNGELWDLERPLEGSCNLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  175

Query  569  TRGEGFYYD  595
               +GF+Y+
Sbjct  176  --DDGFFYE  182



>ref|XP_001418868.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97161.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=674

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 96/140 (69%), Gaps = 4/140 (3%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsP--DPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNA  382
            RI LF+  ++++  +        + IK+ LP+G+ K+G ++ TTP DIA  + K LA +A
Sbjct  23   RIDLFDKYRARELTRIEEAKARGEGIKVTLPDGAQKDGTRFATTPFDIALGIHKKLAQSA  82

Query  383  LISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  562
            L++KV+G  WDM RPLEGDC L LFTFD +EG++ +WHSSAH+LG+++E++YG  L IGP
Sbjct  83   LVAKVDGEFWDMRRPLEGDCALALFTFDDEEGKECYWHSSAHVLGEALELEYGADLTIGP  142

Query  563  CTTRGEGFYYDAFYGDLGLN  622
                 EGFYYD + G+  L 
Sbjct  143  AIE--EGFYYDCYLGERTLT  160



>ref|XP_010195073.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Colius striatus]
Length=474

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 8/160 (5%)
 Frame = +2

Query  185  YLQ---SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDI  346
            YLQ   S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +
Sbjct  31   YLQCEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKITLADGKMAEGQSWKTTPYQL  90

Query  347  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  526
            A  +S+ LASNA+I+KVNG LWD+ RPLEG C +EL TFD++E +  +WHSSAHILG+++
Sbjct  91   AVGISQVLASNAVIAKVNGELWDLDRPLEGACTVELLTFDNEEAKAVYWHSSAHILGEAM  150

Query  527  EMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  151  EGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  188



>ref|XP_007379420.1| threonyl-tRNA synthetase [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN14503.1| threonyl-tRNA synthetase [Punctularia strigosozonata HHB-11173 
SS5]
Length=732

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 92/146 (63%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++      +     I I +P+GS + G  W T+P+D+AKE+SKSLA   +I
Sbjct  61   RIKMFEQLKAEYDEWVKAQPRQEIAISMPDGSQRTGTSWETSPMDVAKEISKSLAERVVI  120

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE    LEL +FD  EG+  FWHSSAH+LG+S E  YGC LCIGP T
Sbjct  121  AKVDGELWDLERPLEKSASLELLSFDDAEGKRVFWHSSAHVLGESAERHYGCHLCIGPPT  180

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               EGF+Y+    D  +    +  +E
Sbjct  181  E--EGFFYEMAIEDRPVTHADYPALE  204



>ref|XP_006675165.1| hypothetical protein BATDEDRAFT_18299 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83910.1| hypothetical protein BATDEDRAFT_18299 [Batrachochytrium dendrobatidis 
JAM81]
Length=706

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +F+ +K +   +  +    PI++ LP+G +  G  W TTP +IAK LSKSLA  
Sbjct  38   IQHRIDMFDRLKKEYDAEIAAKPRTPIEVTLPDGRIMPGVAWETTPFEIAKTLSKSLADR  97

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KV+GVL+D+ RP+E  C LEL  FD +EG+  FWHSSAH+LG++ E+ YGC LCIG
Sbjct  98   VVIAKVDGVLFDLVRPMEQSCSLELLDFDHEEGKKVFWHSSAHVLGEACELHYGCHLCIG  157

Query  560  PCTTRGEGFYYD  595
            P     EGFYY+
Sbjct  158  PPIE--EGFYYE  167



>gb|EHJ63622.1| hypothetical protein KGM_17077 [Danaus plexippus]
Length=712

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 96/149 (64%), Gaps = 2/149 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I KRI L++  K+Q      S     + + LP+G   E K W+TTP D+AK +S+ LA  
Sbjct  45   IQKRIDLWDKYKAQYAEALASKPDVSVVVTLPDGKTVEAKAWHTTPYDVAKGISQGLADA  104

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I++VNGVLWD+ RPLEGDCKLEL  +D+ + +  FWHSSAH+LG+++E  YG  LC G
Sbjct  105  TIIARVNGVLWDLDRPLEGDCKLELLRWDNTDAQAVFWHSSAHMLGEAMERVYGGCLCYG  164

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P     EGFYYD FY + G++   F  I+
Sbjct  165  PPIE--EGFYYDMFYPEKGISSTDFGVID  191



>gb|KDD76365.1| class II core domain (G, H, P, S and T) tRNA synthetase [Helicosporidium 
sp. ATCC 50920]
Length=697

 Score =   140 bits (354),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +2

Query  206  KRISLFESIKsqqqlq--rlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +R+ LFE  K +Q     +   + +PI I LP+G+ + G +  TTP+DIA  +SKSLA  
Sbjct  23   RRVELFEEFKKRQVEALEQSKAAAEPITITLPDGATRPGVRGVTTPMDIANGISKSLAKK  82

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +++  +G  WD+ RPL GDCKLE  TFD  EG+D FWHSSAH+LGQ++E++YG  L IG
Sbjct  83   VVVAVQDGKPWDLLRPLTGDCKLEFKTFDDAEGKDAFWHSSAHMLGQALELEYGADLTIG  142

Query  560  PCTTRGEGFYYDAFYGDLGLNE  625
            P  +  EGFYYD F G+  L +
Sbjct  143  PALS--EGFYYDCFLGERTLGD  162



>ref|XP_005437495.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Falco 
cherrug]
Length=783

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKs---qqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K         R +    PIK+ L +G + EG+ W TTP  +A  +S+
Sbjct  112  SFIEDRLKLYEALKKEHDALLAYRAASQSKPIKVTLTDGKMAEGESWKTTPYQLAVGISQ  171

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E R  +WHSSAHILG+++E  +G 
Sbjct  172  VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEARAVYWHSSAHILGEAMEGYFGG  231

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++ + F  +E
Sbjct  232  CLCYGPPIEN--GFYYDMYIEDRGVSSNEFPLLE  263



>ref|XP_008554535.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Microplitis 
demolitor]
Length=708

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  RI +++ +K++ + +  S     I + LP+G    G+ W TTP D+AK +S+ LA
Sbjct  41   SFIQDRIKMWDELKAKYEEELASKPVKDITVTLPDGKQVNGQSWRTTPYDVAKGISQGLA  100

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLEGDCKLEL  FDS +G+  FWHSSAHILG+++E  YG  LC
Sbjct  101  DNTVIAKVNNELWDLDRPLEGDCKLELLKFDSPDGQQVFWHSSAHILGEAMERVYGGCLC  160

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD   GD G++   F  +E
Sbjct  161  YGPPIEN--GFYYDMHLGDKGISNLDFPYLE  189



>gb|EJU01306.1| threonyl-tRNA synthetase [Dacryopinax sp. DJM-731 SS1]
Length=735

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 6/138 (4%)
 Frame = +2

Query  182  AYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELS  361
            AY+Q    +RI ++  +K++Q           I++ LP+GSV++G  W T+P+ IA+E+S
Sbjct  60   AYMQ----ERIDMWNKLKAEQDEFYAKQPRQEIQVTLPDGSVRKGMSWETSPMMIAEEIS  115

Query  362  KSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  541
            KSLA   +I KV+G LWD+ RP+EG CKL+L  F+  EG+  FWHSSAH+LG++ E  YG
Sbjct  116  KSLAEKVVIGKVDGQLWDLHRPMEGSCKLQLLAFEDKEGQQVFWHSSAHVLGEAAERHYG  175

Query  542  CKLCIGPCTTRGEGFYYD  595
            C LCIGP T   EGF+Y+
Sbjct  176  CHLCIGPPTE--EGFFYE  191



>gb|KDQ50940.1| hypothetical protein JAAARDRAFT_41579 [Jaapia argillacea MUCL 
33604]
Length=733

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K++      +     I + LP+GS ++G  W T+P+DIAKELSKSL+   +I
Sbjct  61   RIQMFDKLKAEYDAWVKAQPRQEIAVTLPDGSERKGTSWETSPMDIAKELSKSLSERIVI  120

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG LWD+ RPLE  CKLEL  F++ +G+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  121  AKVNGDLWDLDRPLESSCKLELLDFENPDGKKVFWHSSAHVLGEASERHYGCHLCIGPPT  180

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  181  D--EGFFYE  187



>gb|KFQ76650.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Phaethon 
lepturus]
Length=673

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            +LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   ALASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYMEDRGVSSTEFPLLE  153



>gb|KFP24546.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Colius 
striatus]
Length=424

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKITLADGKMAEGQSWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEG C +EL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGACTVELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIE--NGFYYDMYIEDRGVSSTEFPLLE  153



>ref|XP_007056480.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Chelonia 
mydas]
Length=766

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIK+ L +G V EG+ W  TP  +A  +S+
Sbjct  95   SFIEDRLKLYETLKKEHDALLAYRAANQSKPIKVILTDGKVIEGESWKMTPYQLAAGISR  154

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LA NA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  YG 
Sbjct  155  GLADNAVIAKVNGELWDLDRPLEGDCSLELLTFDNEEAQAVYWHSSAHILGEAMESYYGG  214

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  215  CLCYGPPIE--NGFYYDMYIEDRGISSTEFPTLE  246



>ref|XP_008554533.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Microplitis 
demolitor]
Length=719

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  RI +++ +K++ + +  S     I + LP+G    G+ W TTP D+AK +S+ LA
Sbjct  52   SFIQDRIKMWDELKAKYEEELASKPVKDITVTLPDGKQVNGQSWRTTPYDVAKGISQGLA  111

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLEGDCKLEL  FDS +G+  FWHSSAHILG+++E  YG  LC
Sbjct  112  DNTVIAKVNNELWDLDRPLEGDCKLELLKFDSPDGQQVFWHSSAHILGEAMERVYGGCLC  171

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD   GD G++   F  +E
Sbjct  172  YGPPIE--NGFYYDMHLGDKGISNLDFPYLE  200



>gb|AAU89472.1| theronyl tRNA synthatase-like protein [Aedes aegypti]
Length=301

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 92/149 (62%), Gaps = 2/149 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +++ +K+Q   +      +PIK+ LP+G   +   W +TP D+AK +S  LA N
Sbjct  30   IDHRIKIYDELKAQYLEELAKKPKNPIKVTLPDGKEVDATSWESTPYDVAKGISXGLADN  89

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I++VN  LWD+ RPLEGDCKL+L  FD  + +  FWHSSAHILG+++E +YG  LC G
Sbjct  90   TVIARVNNELWDLDRPLEGDCKLQLLKFDDPDAQAVFWHSSAHILGEAMEKRYGGHLCYG  149

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P      GFYYD F    G++   +  +E
Sbjct  150  PPIE--NGFYYDMFLEGSGISNQDYGALE  176



>ref|XP_007330835.1| hypothetical protein AGABI1DRAFT_60603 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78406.1| hypothetical protein AGABI1DRAFT_60603 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=721

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K +      +   + I I L +GS ++GK W T+PLDIAK LSKSLA   +I
Sbjct  56   RIKMFDELKVKYDAFVAAQPREEITITLLDGSERKGKSWETSPLDIAKLLSKSLADRVVI  115

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            SKV+GVLWD+ RPLE   KLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  SKVDGVLWDLERPLEKSVKLELLDFEDPEGKKVFWHSSAHVLGEAAERHYGCHLCIGPPT  175

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  176  --DEGFFYE  182



>ref|XP_001696198.1| hypothetical protein CHLREDRAFT_167047 [Chlamydomonas reinhardtii]
 gb|EDP08175.1| predicted protein [Chlamydomonas reinhardtii]
Length=688

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 99/149 (66%), Gaps = 4/149 (3%)
 Frame = +2

Query  206  KRISLFESI--KsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            KR+ +FE    + Q +L+    +   IK+ +P+G  +   +  TTP+DIAKE+S SLA  
Sbjct  20   KRVEVFEKFLEREQAKLEAAKAANVAIKVIMPDGKERAAVQGVTTPMDIAKEISASLAKK  79

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +++ V+G  WD++RPLEGDC L+LF+FD  EG+D FWHSSAH+LGQ++E+++G  L IG
Sbjct  80   VVVADVDGHAWDLARPLEGDCALKLFSFDDTEGKDAFWHSSAHLLGQALELEFGVDLTIG  139

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P     EGFYYD F GD  L E    ++E
Sbjct  140  PALE--EGFYYDCFMGDRTLTEADKARLE  166



>emb|CCO30571.1| threonyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=622

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  57   RIQIYDKLKKEYDEFVAAQPREPITITLPDGSTKEGKSWETSPMAIAAQLSKSLSERVVI  116

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  176

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GF+Y+    +  ++   +  +E
Sbjct  177  D--DGFFYEMAIEERAVSSGDYPSLE  200



>ref|XP_011264917.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Camponotus 
floridanus]
 gb|EFN62386.1| Threonyl-tRNA synthetase, cytoplasmic [Camponotus floridanus]
Length=689

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ L++ +K + +      +P  I + LP+G     + W TTP ++AK +S+ LA
Sbjct  22   SFIQDRLVLWDKLKKKYEADLARKTPVDITVTLPDGKEVSAQSWRTTPYEVAKNISQGLA  81

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EGR  FWHSSAHILG+++E  YG  LC
Sbjct  82   DNTVIAKVNNELWDLDRPLEYDCKLQLLKFDDAEGRQVFWHSSAHILGEAMERIYGGCLC  141

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  142  YGPPIE--NGFYYDMYIGDKGISNTDFPYLE  170



>gb|KDR13507.1| Threonyl-tRNA synthetase, cytoplasmic [Zootermopsis nevadensis]
Length=791

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI+L++ +K Q + +  + +  PIKI LP+G V EG+ W TTP ++A+ +S+ LA
Sbjct  124  TYIEERINLWDKLKLQYETELAAKTSVPIKITLPDGKVTEGQSWRTTPYEVARGISQGLA  183

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N++++KVNG LWD+ RPLE D +L+L  FD +EG+  FWHS+AHILG+++E  YG  LC
Sbjct  184  DNSVVAKVNGELWDLGRPLEKDSELQLLKFDDNEGQQVFWHSTAHILGEAMERVYGGCLC  243

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD F  D  ++   F  +E
Sbjct  244  YGPPIE--NGFYYDMFIDDKQVSNLDFPVVE  272



>gb|KIJ96896.1| hypothetical protein K443DRAFT_681974 [Laccaria amethystina LaAM-08-1]
Length=722

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K++      S   + I I +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  56   RIKIFDELKAEYDEFVKSQPREEIAITMPDGSERKGKSWETSPMDVAKEVSKSLSERIVI  115

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  116  AKVDGELWDLERPLEKACKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  175

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  176  --DEGFFYE  182



>ref|XP_007316884.1| hypothetical protein SERLADRAFT_368238 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01054.1| hypothetical protein SERLA73DRAFT_121422 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO26711.1| hypothetical protein SERLADRAFT_368238 [Serpula lacrymans var. 
lacrymans S7.9]
Length=727

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++      +     I I LP+GS ++G  W T+P+D+AKE+SKSL+   +I
Sbjct  55   RIKIFEKLKAEYDDFVKAQPRQEIVITLPDGSERKGTSWETSPMDVAKEVSKSLSERIVI  114

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP  
Sbjct  115  AKVDGNLWDLERPLEAACKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPV  174

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               EGF+Y+    D  ++   +  +E
Sbjct  175  E--EGFFYEMALEDRAVSMTDYPALE  198



>ref|XP_009980107.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Tauraco 
erythrolophus]
Length=736

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H KD     S I  R+ L++ +K +        + +   PIKI L +G + EG+ W TTP
Sbjct  56   HRKDLQCEPSFIEDRLKLYKELKKEHDALLAYRAANQSKPIKINLTDGKIAEGESWKTTP  115

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S+ LASNA+++KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  116  YQLAAGISQVLASNAVVAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  175

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GF+YD +  D G++   F  +E
Sbjct  176  EAMEGYFGGCLCYGPPIEN--GFHYDMYIEDRGVSSTEFPLLE  216



>gb|KFU87220.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Chaetura 
pelagica]
Length=673

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKs---qqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K         R +    PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  2    SFIKDRLKLYEALKKEHDALLAYRAASESKPIKITLTDGKVAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ R LEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   MLASNAVIAKVNGELWDLDRQLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYLEDRGVSSTEFPLLE  153



>ref|XP_005025500.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Anas 
platyrhynchos]
Length=721

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G   EG+ W TTP  +A  +S+
Sbjct  50   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKTVEGESWKTTPYQLAVGISQ  109

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  YG 
Sbjct  110  GLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAQAVYWHSSAHILGEAMEGYYGG  169

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  170  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPALE  201



>gb|KFW65406.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Pygoscelis 
adeliae]
Length=673

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   MLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYTEDRGVSSTEFPLLE  153



>ref|XP_011264916.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Camponotus 
floridanus]
Length=710

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ L++ +K + +      +P  I + LP+G     + W TTP ++AK +S+ LA
Sbjct  43   SFIQDRLVLWDKLKKKYEADLARKTPVDITVTLPDGKEVSAQSWRTTPYEVAKNISQGLA  102

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EGR  FWHSSAHILG+++E  YG  LC
Sbjct  103  DNTVIAKVNNELWDLDRPLEYDCKLQLLKFDDAEGRQVFWHSSAHILGEAMERIYGGCLC  162

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  163  YGPPIE--NGFYYDMYIGDKGISNTDFPYLE  191



>ref|XP_010287049.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Phaethon lepturus]
Length=734

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  63   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  122

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            +LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  123  ALASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  182

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  183  CLCYGPPIEN--GFYYDMYMEDRGVSSTEFPLLE  214



>ref|XP_009319874.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Pygoscelis 
adeliae]
Length=712

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  41   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  100

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  101  MLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  160

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  161  CLCYGPPIEN--GFYYDMYTEDRGVSSTEFPLLE  192



>ref|XP_011264915.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Camponotus 
floridanus]
Length=713

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            S I  R+ L++ +K + +      +P  I + LP+G     + W TTP ++AK +S+ LA
Sbjct  46   SFIQDRLVLWDKLKKKYEADLARKTPVDITVTLPDGKEVSAQSWRTTPYEVAKNISQGLA  105

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EGR  FWHSSAHILG+++E  YG  LC
Sbjct  106  DNTVIAKVNNELWDLDRPLEYDCKLQLLKFDDAEGRQVFWHSSAHILGEAMERIYGGCLC  165

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP      GFYYD + GD G++   F  +E
Sbjct  166  YGPPIE--NGFYYDMYIGDKGISNTDFPYLE  194



>ref|XP_007855570.1| threonyl-trna synthetase [Moniliophthora roreri MCA 2997]
 gb|ESK85122.1| threonyl-trna synthetase [Moniliophthora roreri MCA 2997]
Length=723

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE +K++      S   + I I LP+G+ K+G  W T+P+DIAKE+SK L+   +I
Sbjct  49   RIQMFEQLKAEYDEAAKSKPREEITITLPDGNEKKGISWETSPMDIAKEISKGLSEKVVI  108

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  109  AKVDGELWDLERPLESSCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCLGPPT  168

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GF+Y+    D  + E  +  +E
Sbjct  169  D--DGFFYEMGIQDRPVVEADYPALE  192



>gb|KFP03020.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Calypte 
anna]
Length=673

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIKDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCSLELLMFDNEEAKAVYWHSSAHILGEAMEDYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYLEDRGVSSTEFPLLE  153



>gb|KFH72646.1| threonyl-tRNA synthetase [Mortierella verticillata NRRL 6337]
Length=721

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 91/137 (66%), Gaps = 2/137 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  RI++F+ +K +      +    PI I +P+GS++EG  W T+P+DIAK +SKSL+  
Sbjct  49   VAHRIAMFDDLKKKADEVEAAQPRVPISIAMPDGSIREGIAWETSPMDIAKAISKSLSER  108

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KV+ VLWD+ RPL   C+LEL  F+ +EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  109  VVIAKVDKVLWDLERPLVDSCQLELLDFEHEEGKAVFWHSSAHVLGEACEKHYGCHLCIG  168

Query  560  PCTTRGEGFYYDAFYGD  610
            P     +GFYY+    D
Sbjct  169  PPIE--DGFYYEMAMRD  183



>gb|KIK46023.1| hypothetical protein CY34DRAFT_22231 [Suillus luteus UH-Slu-Lm8-n1]
Length=728

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI LFE + ++          + I + +P+GS + G  W T+P+D+AKE+SKSL+   +I
Sbjct  56   RIKLFEELHAKHNEFVKIQPREEIVVTMPDGSERMGTSWETSPMDVAKEVSKSLSERIVI  115

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  AKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  175

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GF+Y+    D  +    +  +E
Sbjct  176  --DDGFFYEMAIEDRAVTNADYPALE  199



>ref|XP_005145729.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Melopsittacus 
undulatus]
Length=790

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D  +  S I  R+ L+E++K +          +   PIKI L +G V EG+ W TTP
Sbjct  110  HQNDLQHEPSFIEDRLKLYEALKKEHDALLAYRVANQSKPIKITLTDGKVAEGESWKTTP  169

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S++LA +A+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  170  YQLAVGISQALAGDAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  229

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  230  EAMEDYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  270



>ref|XP_005234248.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Falco 
peregrinus]
Length=806

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 99/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIK+ L +G + EG+ W TTP  +A  +S+
Sbjct  135  SFIEDRLKLYEALKKEHDALLAYRAANHSKPIKVTLTDGKMAEGESWKTTPYQLAVGISQ  194

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  195  VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  254

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++ + F  +E
Sbjct  255  CLCYGPPIEN--GFYYDMYIEDRGVSSNEFPLLE  286



>ref|XP_009553641.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Cuculus 
canorus]
Length=725

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 100/163 (61%), Gaps = 5/163 (3%)
 Frame = +2

Query  167  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  337
            H  D     + I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP
Sbjct  45   HQNDLQCEPNFIQDRLKLYEALKKEHDALLAYRAANQSKPIKITLTDGKVAEGESWKTTP  104

Query  338  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  517
              +A  +S++LASNA+I+KVN  LWD+ RPLEGDC LEL TFD +E +  +WHSSAHILG
Sbjct  105  HQLAVGISQALASNAVIAKVNSELWDLDRPLEGDCALELLTFDDEEAKAVYWHSSAHILG  164

Query  518  QSVEMKYGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            +++E  +G  LC GP      GFYYD +  D G++   F  +E
Sbjct  165  EAMEGYFGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  205



>ref|XP_008494852.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Calypte 
anna]
Length=691

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  20   SFIKDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  79

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  80   VLASNAVIAKVNGELWDLDRPLEGDCSLELLMFDNEEAKAVYWHSSAHILGEAMEDYFGG  139

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  140  CLCYGPPIEN--GFYYDMYLEDRGVSSTEFPLLE  171



>gb|KFO72069.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Cuculus 
canorus]
Length=673

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            + I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  2    NFIQDRLKLYEALKKEHDALLAYRAANQSKPIKITLTDGKVAEGESWKTTPHQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
            +LASNA+I+KVN  LWD+ RPLEGDC LEL TFD +E +  +WHSSAHILG+++E  +G 
Sbjct  62   ALASNAVIAKVNSELWDLDRPLEGDCALELLTFDDEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|EJW87440.1| hypothetical protein WUBG_01653, partial [Wuchereria bancrofti]
Length=207

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 96/151 (64%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  373
            + I +RI+LF+ + ++   +      + +KI LP+G   EG+ W TTPL IA+++S+  A
Sbjct  26   NFIEERIALFDKLMAKYHEEIAEKKSEKVKITLPDGKELEGESWRTTPLMIAEQISRGFA  85

Query  374  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  553
             +A+++KVNG +WD+ RP E D  LE+  FD DEG+  FWHSSAHI+G+++E   G  LC
Sbjct  86   DSAVVAKVNGEVWDLDRPFECDATLEILKFDDDEGKQVFWHSSAHIMGEAMERYCGGHLC  145

Query  554  IGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             GP  +  EGFYYD +     +  D F ++E
Sbjct  146  YGPPIS--EGFYYDMWKEGSAITPDDFPKLE  174



>emb|CEL59014.1| threonyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=726

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  57   RIQIYDKLKKEYDEFVAAQPREPITITLPDGSTKEGKSWETSPMAIAAQLSKSLSERVVI  116

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  176

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GF+Y+    +  ++   +  +E
Sbjct  177  --DDGFFYEMAIEERAVSSGDYPSLE  200



>gb|KFP34665.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Chlamydotis 
macqueenii]
Length=673

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PI I L +G   EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYETLKKEHNALLAYRAANQSKPINIILTDGKTAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   MLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>ref|XP_001878968.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR10518.1| predicted protein [Laccaria bicolor S238N-H82]
Length=721

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +F+ +K++      S   + I I +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  55   RIKIFDELKAEYDEFVKSQPREEIVITMPDGSERKGKSWETSPMDVAKEVSKSLSERIVI  114

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  115  AKVDGELWDLDRPLEKACKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  174

Query  569  TRGEGFYYD  595
               EGF+Y+
Sbjct  175  --DEGFFYE  181



>ref|XP_008601338.1| threonyl-tRNA synthetase [Beauveria bassiana ARSEF 2860]
 gb|EJP63008.1| threonyl-tRNA synthetase [Beauveria bassiana ARSEF 2860]
Length=737

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            R+ LF+ IK++Q  +  +   + I + +PNG+  +G  W TTPL IAK +SKSL    +I
Sbjct  51   RLDLFDKIKARQDAEIAAKPREEITVTMPNGNETKGTSWETTPLAIAKGISKSLVERTVI  110

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            ++V+G LWD++RPLE  CKLEL  FD  EG+  FWHSSAHILG++ E ++GC LC GP T
Sbjct  111  AQVDGELWDLTRPLEKSCKLELLDFDHTEGKKVFWHSSAHILGEACERRFGCYLCNGPPT  170

Query  569  TRGEGFYYD  595
                GFYYD
Sbjct  171  ENPPGFYYD  179



>emb|CCE32326.1| probable THS1-threonyl tRNA synthetase,cytosolic [Claviceps purpurea 
20.1]
Length=740

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +2

Query  188  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  367
            L   I  R+ +F+ IK++Q  +  +   + I I L +G  ++G  W TTPL IAK +SKS
Sbjct  47   LPQFIQHRLDIFDQIKARQDAEIAAKPREEITITLSDGKEEKGTSWETTPLMIAKGISKS  106

Query  368  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  547
            L    +I+KV+G LWD++RPLE  C LEL +FDS+EG+  FWHSSAHILG++ E +YGC 
Sbjct  107  LVERTVITKVDGELWDLTRPLEKSCNLELISFDSEEGKAVFWHSSAHILGEACERRYGCY  166

Query  548  LCIGPCTTRGEGFYYD  595
            LC GP T    GFYYD
Sbjct  167  LCNGPPTKDPPGFYYD  182



>ref|XP_011406310.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Amphimedon 
queenslandica]
Length=653

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  R ++F+ +K++   +  +  P PIK+ LP+G V EG  W TTP DIA ++SK LA N
Sbjct  17   IASRNAIFDRLKAEYLAEIEAKEPRPIKVTLPDGKVMEGLSWRTTPYDIASQISKGLADN  76

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
            A+ISKVNG ++D+ RPLE DC LEL  F+  E +  FWHS+AHILG+++E  YG  LC G
Sbjct  77   AVISKVNGSVFDLERPLEEDCTLELLKFEDPEAQTVFWHSTAHILGEAMERHYGGCLCYG  136

Query  560  PCTTRGEGFYYDAF  601
            P      GFYYD F
Sbjct  137  PPIE--SGFYYDMF  148



>emb|CCG82579.1| Threonyl-tRNA synthetase [Taphrina deformans PYCC 5710]
Length=755

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  RI+LF+ +K++Q           I I LP+G+ K G  W TTP+ +A E+S+ LA  
Sbjct  59   MAHRIALFDKLKAEQDDIAAKSERKRITITLPDGATKIGTSWETTPMSVALEISQGLADR  118

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KVNG LWDM+RP+E D  LELF F++ EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  119  TIIAKVNGNLWDMTRPIEEDASLELFDFNTPEGKRVFWHSSAHMLGEATERHYGCHLCIG  178

Query  560  PCTTRGEGFYYD  595
            P T   EGF+Y+
Sbjct  179  PPTE--EGFFYE  188



>ref|XP_009884085.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Charadrius 
vociferus]
Length=770

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  120  SFIEDRLKLYEALKKEHDALLAYRAANLSKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  179

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  180  VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  239

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  240  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  271



>ref|XP_010114469.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Chlamydotis macqueenii]
Length=708

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PI I L +G   EG+ W TTP  +A  +S+
Sbjct  37   SFIEDRLKLYETLKKEHNALLAYRAANQSKPINIILTDGKTAEGESWKTTPYQLAVGISQ  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  97   MLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  156

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  157  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  188



>ref|XP_003667634.1| hypothetical protein NDAI_0A02330 [Naumovozyma dairenensis CBS 
421]
 emb|CCD22391.1| hypothetical protein NDAI_0A02330 [Naumovozyma dairenensis CBS 
421]
Length=730

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 7/137 (5%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I +RI LFE++K Q   +  S+   P+KI L +G+VKE   W TTP+DIA+ +SKSLA N
Sbjct  38   IEERIQLFETLKKQYDEKVASMKRVPLKIVLKDGAVKEATSWETTPMDIARGISKSLADN  97

Query  380  ALISKVNGVLWDMSRPLEGDC-----KLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
              I+KVNG LWD+ RP EGD      KL+L  FDSDEG+  FWHSSAH+LG++ E   G 
Sbjct  98   VCIAKVNGQLWDLDRPFEGDVADEEIKLQLLDFDSDEGKKVFWHSSAHVLGEACECNLGA  157

Query  545  KLCIGPCTTRGEGFYYD  595
             +C+GP T   +GF+Y+
Sbjct  158  HICLGPPTD--DGFFYE  172



>ref|XP_006268868.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic-like 
[Alligator mississippiensis]
Length=761

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKE  355
            Y    I  R+ ++E++K +        +     PIKI L +G+V EG+ W TTP  I   
Sbjct  87   YEPDFIEDRMKIYETLKKEHDALLSYRAASENRPIKIILTDGNVVEGESWKTTPYQIGAG  146

Query  356  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  535
            +S+ LA NA+I+KVN  LWDM RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  
Sbjct  147  ISQGLAENAVIAKVNSELWDMDRPLEGDCTLELLTFDNEEAQAVYWHSSAHILGEAMESY  206

Query  536  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            YG  LC GP      GFYYD +  D G++   F  +E
Sbjct  207  YGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPSLE  241



>ref|XP_006020081.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic-like 
[Alligator sinensis]
Length=726

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 96/157 (61%), Gaps = 5/157 (3%)
 Frame = +2

Query  185  YLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKE  355
            Y    I  R+ ++E++K +        +     PIKI L +G+V EG+ W TTP  I   
Sbjct  52   YEPDFIEDRMKIYETLKKEHDALLSYRAASENRPIKIILTDGNVVEGESWKTTPYQIGAG  111

Query  356  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  535
            +S+ LA NA+I+KVN  LWDM RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  
Sbjct  112  ISQGLAENAVIAKVNSELWDMDRPLEGDCTLELLTFDNEEAQAVYWHSSAHILGEAMESY  171

Query  536  YGCKLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            YG  LC GP      GFYYD +  D G++   F  +E
Sbjct  172  YGGCLCYGPPIEN--GFYYDMYIEDRGVSSTEFPSLE  206



>gb|KIL94540.1| hypothetical protein FAVG1_01471 [Fusarium avenaceum]
Length=980

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  R+ LF+ IK++Q  +  +   + I I LPNG  ++G  W TTP  IAK +SKSL   
Sbjct  290  IQHRLDLFDKIKARQDAEIAAKPREEITISLPNGKEEKGTSWETTPGAIAKGISKSLFER  349

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +IS+V+G LWD++RPLE  CKLEL  FD  EG+  FWHSSAHILG++ E ++GC LC G
Sbjct  350  TVISRVDGELWDLTRPLEKSCKLELLDFDHTEGKKVFWHSSAHILGEAAERRFGCYLCNG  409

Query  560  PCTTRGEGFYYD-AFYGDLGLNEDHFKQIE  646
            P T    GFYYD A  G+  + ++  K +E
Sbjct  410  PPTEDPPGFYYDMANMGEQVIADEDKKALE  439



>gb|KFV51513.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Gavia 
stellata]
Length=673

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +          +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRVANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|KFV00689.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Tauraco 
erythrolophus]
Length=673

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L++ +K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYKELKKEHDALLAYRAANQSKPIKINLTDGKIAEGESWKTTPYQLAAGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+++KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVVAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GF+YD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFHYDMYIEDRGVSSTEFPLLE  153



>ref|XP_008043826.1| tars protein [Trametes versicolor FP-101664 SS1]
 gb|EIW53517.1| tars protein [Trametes versicolor FP-101664 SS1]
Length=725

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            R+ +FE +K++Q     +     I I LP+GS ++G  W T+P+D+AK++S+SLA   +I
Sbjct  53   RLKIFEKLKAEQDEWVKNQPRQEISITLPDGSQRKGTSWETSPMDVAKQISQSLADRVVI  112

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLEG C +EL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  113  AKVDGNLWDLERPLEGSCSVELLDFEHPEGKRVFWHSSAHVLGEASERHYGCHLCIGPPT  172

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               +GFYY+    D  +    +  IE
Sbjct  173  --DDGFYYEMAIEDRPVVNSDYPAIE  196



>ref|XP_009807382.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Gavia stellata]
Length=708

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +          +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  37   SFIEDRLKLYEALKKEHDALLAYRVANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  96

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  97   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  156

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  157  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  188



>ref|XP_006672150.1| threonine-tRNA ligase [Cordyceps militaris CM01]
 gb|EGX90529.1| threonine-tRNA ligase [Cordyceps militaris CM01]
Length=734

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 96/147 (65%), Gaps = 0/147 (0%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  R+ LF+ +K++Q  +  +   + I I +P+G+  +G  W TTPL IAK +SKSL   
Sbjct  45   IQYRLDLFDKLKARQDAEIAAKPREEITITMPSGNTTKGTSWETTPLAIAKGISKSLVER  104

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I++V+G LWD++RPLE  CKLEL  FD  EG+  FWHSSAHILG++ E ++GC LC G
Sbjct  105  TVIAQVDGELWDLTRPLEKSCKLELLDFDHTEGKKVFWHSSAHILGEACERRFGCYLCNG  164

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQ  640
            P T    GFYYD    D  + +D+ K+
Sbjct  165  PPTENPPGFYYDMANMDGQVVDDNDKK  191



>gb|EHK45204.1| hypothetical protein TRIATDRAFT_128075 [Trichoderma atroviride 
IMI 206040]
Length=738

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +2

Query  188  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  367
            L   I  RI++F+ IK+++  +  +   + I + LPNG   +G  W TTP  IAK +SKS
Sbjct  45   LPDFIQHRIAIFDKIKAKRDAEIAAKPREEITVSLPNGKEAKGISWETTPGAIAKGISKS  104

Query  368  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  547
            L    +IS V+G LWD++RPLE  CKLEL  F+++EG+  FWHSSAH+LG++ E ++GC 
Sbjct  105  LFERTVISMVDGELWDLTRPLEKSCKLELIDFENEEGKKVFWHSSAHVLGEAAERRFGCY  164

Query  548  LCIGPCTTRGEGFYYD  595
            LC GP TT   GFYYD
Sbjct  165  LCNGPPTTDPPGFYYD  180



>gb|KFP47497.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Cathartes 
aura]
Length=673

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD +E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCALELLMFDDEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|KIM92325.1| hypothetical protein PILCRDRAFT_810369 [Piloderma croceum F 1598]
Length=728

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  RI +FE +K++      +   + I I +P+GS ++GK W T+P+D+AKE+SKSL+  
Sbjct  53   IDHRIKIFEKLKAEHDEFVKAQPREDIVITMPDGSERKGKSWETSPMDVAKEISKSLSER  112

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +I+KVNG +WD+ RPLEG   LE   F+  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  113  IVIAKVNGDVWDLERPLEGPSSLEFLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  172

Query  560  PCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
            P T   +GF+Y+    D  +    +  +E
Sbjct  173  PPT--DDGFFYEMAMEDRAVTTADYPALE  199



>gb|KFO03777.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Balearica 
regulorum gibbericeps]
Length=673

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRMKLYEALKKEHDTLLAYRAANQSKPIKIILTDGKIAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASN +I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   GLASNTIIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|KFV95622.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Eurypyga 
helias]
Length=673

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +          +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRVANQSKPIKITLTDGKVAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I+KVNG LWD+ RPLE DC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   MLASNAIIAKVNGELWDLDRPLEEDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGFFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  YLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>gb|KIJ28159.1| hypothetical protein M422DRAFT_37403 [Sphaerobolus stellatus 
SS14]
Length=737

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI +FE+ +++      +   + I + +P+GS+++G  W T+P+D+A+E+SKS +   +I
Sbjct  61   RIKIFEAEQAKYVEWVKNQPREEIDVTMPDGSIRKGTSWETSPIDVAREISKSFSERMVI  120

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KV+G LWD+ RPLE   KLEL  FD+DEG+  FWHSSAHILG++ E  +GC LCIGP T
Sbjct  121  AKVDGQLWDLERPLEKSSKLELLDFDNDEGKRVFWHSSAHILGEAAERHFGCHLCIGPPT  180

Query  569  TRGEGFYYDAFYG  607
               EGF+Y+   G
Sbjct  181  E--EGFFYEMGMG  191



>gb|KFQ76130.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Phoenicopterus 
ruber ruber]
Length=673

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  61

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASNA+I KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIGKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  122  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  153



>ref|XP_010310509.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Balearica regulorum gibbericeps]
Length=704

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 5/154 (3%)
 Frame = +2

Query  194  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  364
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  33   SFIEDRMKLYEALKKEHDTLLAYRAANQSKPIKIILTDGKIAEGESWKTTPYQLAVGISQ  92

Query  365  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  544
             LASN +I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  93   GLASNTIIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  152

Query  545  KLCIGPCTTRGEGFYYDAFYGDLGLNEDHFKQIE  646
             LC GP      GFYYD +  D G++   F  +E
Sbjct  153  CLCYGPPIEN--GFYYDMYIEDRGVSSTEFPLLE  184



>emb|CBY19737.1| unnamed protein product [Oikopleura dioica]
Length=800

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  R+ +F+ + + Q+ +  ++  +PIK+ LP+G+VKEG  W TTPLDIAK +S  LA+ 
Sbjct  114  VAYRLKMFDELFAAQEERIAAMPKNPIKVTLPDGAVKEGTSWETTPLDIAKSISSGLANV  173

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             + +KVNG +WD++R LEGDC +EL  F   EG++T+WHSSAHILG+ +E  +G  LC G
Sbjct  174  VVCAKVNGQVWDLTRKLEGDCSIELLKFSDKEGKETYWHSSAHILGECMERYFGGALCYG  233

Query  560  PCTTRGEGFYYDAFYGDLGLNED  628
            P     +GFYYD + G+  ++ +
Sbjct  234  PDIE--DGFYYDMWMGNTTISSE  254



>emb|CEJ81687.1| Putative Threonyl-tRNA synthetase, cytoplasmic [Torrubiella hemipterigena]
Length=737

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            I  R+++F+ +K+++  +  +   + I + LPNGS ++G  W TTP  IA+ LSKSL   
Sbjct  48   IQHRLNVFDRVKAKRAEELAAKPREEITVSLPNGSEQKGTSWETTPGSIARALSKSLFER  107

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             +IS+V+G LWD++RPLE  CKLEL  F+  EG+  FWHS+AHILG++ E ++GC LC G
Sbjct  108  TVISRVDGELWDLTRPLEKSCKLELLDFEHTEGKKVFWHSAAHILGEAAERRFGCYLCNG  167

Query  560  PCTTRGEGFYYD  595
            P T    GFYYD
Sbjct  168  PPTENPPGFYYD  179



>ref|XP_007394540.1| hypothetical protein PHACADRAFT_194288 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56703.1| hypothetical protein PHACADRAFT_194288 [Phanerochaete carnosa 
HHB-10118-sp]
Length=730

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  209  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  388
            RI LFE +K++   +  +     I+I L +GS ++G  W T+P+ IAK++S+ LA   +I
Sbjct  59   RIKLFEKLKAEYDERLKTQPRQEIEITLLDGSKRQGTSWETSPMGIAKQISQGLADRTVI  118

Query  389  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  568
            +KVNG +WD+ RPLEG C LEL  FD  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  119  AKVNGQVWDLERPLEGSCTLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCHLCVGPPT  178

Query  569  TRGEGFYYDAFYGDLGLNEDHFKQIE  646
               EGF+Y+    D  +    +  +E
Sbjct  179  E--EGFFYEMAIEDRPVTHADYPALE  202



>emb|CBY35782.1| unnamed protein product [Oikopleura dioica]
Length=800

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = +2

Query  200  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  379
            +  R+ +F+ + S Q+ +  ++  +PIK+ LP+G+VKEG  W TTPLDIAK +S  LA+ 
Sbjct  114  VAYRLKMFDELFSAQEERIAAMPKNPIKVTLPDGAVKEGTSWETTPLDIAKSISSGLANV  173

Query  380  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  559
             + +KVNG +WD++R LEGDC +EL  F   EG++T+WHSSAHILG+ +E  +G  LC G
Sbjct  174  VVCAKVNGQVWDLTRKLEGDCSIELLKFSDKEGKETYWHSSAHILGECMERYFGGALCYG  233

Query  560  PCTTRGEGFYYDAFYGDLGLNED  628
            P     +GFYYD + G+  ++ +
Sbjct  234  PDIE--DGFYYDMWMGNTTISSE  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000