BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028J15

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611467.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       222   6e-64   Nicotiana tomentosiformis
ref|XP_006364887.1|  PREDICTED: uncharacterized membrane protein ...    219   5e-63   Solanum tuberosum [potatoes]
ref|XP_004244862.1|  PREDICTED: CSC1-like protein ERD4                  217   3e-62   Solanum lycopersicum
ref|XP_009781612.1|  PREDICTED: CSC1-like protein ERD4                  206   3e-58   Nicotiana sylvestris
gb|KDO75372.1|  hypothetical protein CISIN_1g004795mg                   190   1e-54   Citrus sinensis [apfelsine]
ref|XP_002531053.1|  conserved hypothetical protein                     196   1e-54   
gb|KDO75373.1|  hypothetical protein CISIN_1g004795mg                   190   1e-54   Citrus sinensis [apfelsine]
gb|EYU19152.1|  hypothetical protein MIMGU_mgv1a001965mg                194   4e-54   Erythranthe guttata [common monkey flower]
gb|EYU19153.1|  hypothetical protein MIMGU_mgv1a001965mg                194   8e-54   Erythranthe guttata [common monkey flower]
gb|KDO75370.1|  hypothetical protein CISIN_1g004795mg                   191   1e-53   Citrus sinensis [apfelsine]
gb|KDO75369.1|  hypothetical protein CISIN_1g004795mg                   190   1e-52   Citrus sinensis [apfelsine]
gb|KJB57183.1|  hypothetical protein B456_009G152500                    188   1e-52   Gossypium raimondii
ref|XP_010245168.1|  PREDICTED: CSC1-like protein ERD4                  190   2e-52   Nelumbo nucifera [Indian lotus]
gb|KDO75368.1|  hypothetical protein CISIN_1g004795mg                   190   2e-52   Citrus sinensis [apfelsine]
ref|XP_007024954.1|  Early-responsive to dehydration stress prote...    189   2e-52   
ref|XP_006468078.1|  PREDICTED: uncharacterized membrane protein ...    190   2e-52   Citrus sinensis [apfelsine]
gb|KHG13189.1|  putative membrane C2G11.09                              190   3e-52   Gossypium arboreum [tree cotton]
gb|KDO75367.1|  hypothetical protein CISIN_1g004795mg                   190   3e-52   Citrus sinensis [apfelsine]
ref|XP_007024953.1|  Early-responsive to dehydration stress prote...    189   4e-52   
gb|KCW75872.1|  hypothetical protein EUGRSUZ_D00261                     188   8e-52   Eucalyptus grandis [rose gum]
ref|XP_010052016.1|  PREDICTED: CSC1-like protein ERD4                  188   8e-52   Eucalyptus grandis [rose gum]
gb|KJB57182.1|  hypothetical protein B456_009G152500                    187   8e-52   Gossypium raimondii
gb|KJB57184.1|  hypothetical protein B456_009G152500                    187   8e-52   Gossypium raimondii
ref|XP_009377481.1|  PREDICTED: CSC1-like protein ERD4                  188   1e-51   Pyrus x bretschneideri [bai li]
gb|KJB57185.1|  hypothetical protein B456_009G152500                    188   1e-51   Gossypium raimondii
emb|CAN64310.1|  hypothetical protein VITISV_037471                     186   6e-51   Vitis vinifera
ref|XP_002280109.1|  PREDICTED: CSC1-like protein ERD4                  186   6e-51   Vitis vinifera
ref|XP_010687077.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       186   8e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010052015.1|  PREDICTED: CSC1-like protein ERD4                  183   7e-50   Eucalyptus grandis [rose gum]
ref|XP_010687100.1|  PREDICTED: CSC1-like protein ERD4                  182   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009377479.1|  PREDICTED: CSC1-like protein ERD4                  180   9e-49   Pyrus x bretschneideri [bai li]
ref|XP_008371649.1|  PREDICTED: uncharacterized membrane protein ...    179   1e-48   Malus domestica [apple tree]
gb|KCW75871.1|  hypothetical protein EUGRSUZ_D00260                     176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_009408546.1|  PREDICTED: CSC1-like protein ERD4                  176   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010478422.1|  PREDICTED: CSC1-like protein ERD4                  175   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008784823.1|  PREDICTED: CSC1-like protein ERD4                  175   4e-47   Phoenix dactylifera
ref|XP_010907974.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    175   5e-47   
ref|XP_007147944.1|  hypothetical protein PHAVU_006G167700g             172   4e-46   Phaseolus vulgaris [French bean]
gb|AGV54368.1|  early-responsive to dehydration                         170   5e-46   Phaseolus vulgaris [French bean]
ref|XP_010540605.1|  PREDICTED: CSC1-like protein ERD4                  172   6e-46   Tarenaya hassleriana [spider flower]
ref|XP_004485983.1|  PREDICTED: uncharacterized membrane protein ...    171   1e-45   Cicer arietinum [garbanzo]
ref|XP_006836313.1|  hypothetical protein AMTR_s00092p00051600          171   1e-45   Amborella trichopoda
gb|KHN06954.1|  Putative membrane protein C24H6.13                      171   1e-45   Glycine soja [wild soybean]
ref|XP_003546071.1|  PREDICTED: uncharacterized membrane protein ...    171   1e-45   Glycine max [soybeans]
ref|XP_008439583.1|  PREDICTED: uncharacterized membrane protein ...    169   7e-45   Cucumis melo [Oriental melon]
ref|XP_003593877.1|  Early-responsive to dehydration                    169   8e-45   Medicago truncatula
emb|CDP05663.1|  unnamed protein product                                168   1e-44   Coffea canephora [robusta coffee]
ref|XP_006415483.1|  hypothetical protein EUTSA_v10006933mg             168   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_004158645.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   2e-44   
ref|XP_004134564.1|  PREDICTED: uncharacterized membrane protein ...    167   2e-44   Cucumis sativus [cucumbers]
ref|XP_009362276.1|  PREDICTED: CSC1-like protein ERD4                  166   5e-44   Pyrus x bretschneideri [bai li]
emb|CBI30957.3|  unnamed protein product                                166   6e-44   Vitis vinifera
gb|KHG16289.1|  putative membrane C2G11.09                              164   2e-43   Gossypium arboreum [tree cotton]
gb|KJB66976.1|  hypothetical protein B456_010G168400                    165   2e-43   Gossypium raimondii
gb|EPS64315.1|  hypothetical protein M569_10465                         164   2e-43   Genlisea aurea
ref|XP_006306879.1|  hypothetical protein CARUB_v10008433mg             164   3e-43   Capsella rubella
ref|XP_011012269.1|  PREDICTED: CSC1-like protein ERD4                  164   3e-43   Populus euphratica
ref|XP_008371799.1|  PREDICTED: uncharacterized membrane protein ...    164   4e-43   Malus domestica [apple tree]
ref|XP_007211358.1|  hypothetical protein PRUPE_ppa002050mg             163   9e-43   Prunus persica
ref|XP_010499567.1|  PREDICTED: CSC1-like protein ERD4                  162   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_011014082.1|  PREDICTED: CSC1-like protein ERD4                  162   1e-42   Populus euphratica
ref|XP_008225537.1|  PREDICTED: uncharacterized membrane protein ...    162   1e-42   Prunus mume [ume]
gb|KHN47349.1|  Putative membrane protein C24H6.13                      161   4e-42   Glycine soja [wild soybean]
ref|XP_003542948.1|  PREDICTED: uncharacterized membrane protein ...    160   6e-42   Glycine max [soybeans]
ref|XP_011096640.1|  PREDICTED: CSC1-like protein ERD4                  160   7e-42   Sesamum indicum [beniseed]
ref|XP_002300337.1|  early-responsive to dehydration stress famil...    160   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002890865.1|  early-responsive to dehydration 4                  157   9e-41   
ref|XP_010460826.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       157   1e-40   Camelina sativa [gold-of-pleasure]
emb|CDY02286.1|  BnaA09g26160D                                          156   3e-40   
ref|XP_009115162.1|  PREDICTED: CSC1-like protein ERD4                  156   3e-40   Brassica rapa
ref|XP_004293515.1|  PREDICTED: CSC1-like protein ERD4                  155   4e-40   Fragaria vesca subsp. vesca
emb|CDY12050.1|  BnaC03g59660D                                          155   8e-40   Brassica napus [oilseed rape]
sp|A9LIW2.2|CSC1L_BRAJU  RecName: Full=CSC1-like protein ERD4; Al...    154   2e-39   Brassica juncea [brown mustard]
emb|CDX90246.1|  BnaA08g17380D                                          154   2e-39   
ref|XP_010275905.1|  PREDICTED: CSC1-like protein ERD4                  153   3e-39   
gb|ABV89627.1|  early-responsive to dehydration 4                       152   6e-39   Brassica rapa
gb|AAK68752.1|  Unknown protein                                         150   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564354.1|  Early-responsive to dehydration stress protein ...    149   9e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38019.1|  hypothetical protein JCGZ_04662                         147   4e-37   Jatropha curcas
ref|NP_001058898.1|  Os07g0150100                                       146   1e-36   
gb|EAZ02783.1|  hypothetical protein OsI_24908                          146   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_009398321.1|  PREDICTED: CSC1-like protein ERD4                  146   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004955452.1|  PREDICTED: uncharacterized membrane protein ...    145   3e-36   Setaria italica
gb|EAZ38704.1|  hypothetical protein OsJ_23104                          146   5e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EMT14399.1|  Putative membrane protein                               143   1e-35   
gb|KFK44850.1|  hypothetical protein AALP_AA1G310500                    142   3e-35   Arabis alpina [alpine rockcress]
dbj|BAJ93282.1|  predicted protein                                      142   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001108122.1|  early responsive to dehydration protein            140   3e-34   
ref|XP_002461460.1|  hypothetical protein SORBIDRAFT_02g003010          139   3e-34   Sorghum bicolor [broomcorn]
ref|NP_001288888.1|  CSC1-like protein ERD4                             132   9e-32   Brassica rapa
ref|XP_006657447.1|  PREDICTED: uncharacterized membrane protein ...    130   5e-31   Oryza brachyantha
gb|EMT14905.1|  Putative membrane protein                               129   1e-30   
ref|XP_009611468.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       126   1e-29   Nicotiana tomentosiformis
gb|EMS45497.1|  Uncharacterized membrane protein C24H6.13               125   3e-29   Triticum urartu
ref|XP_003557644.1|  PREDICTED: CSC1-like protein ERD4                  125   5e-29   Brachypodium distachyon [annual false brome]
ref|XP_010687078.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       120   9e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001776984.1|  predicted protein                                  110   9e-24   
ref|XP_001766634.1|  predicted protein                                  108   4e-23   
ref|XP_006448975.1|  hypothetical protein CICLE_v100144071mg            103   2e-22   
ref|XP_001766729.1|  predicted protein                                  104   8e-22   
ref|XP_008657915.1|  PREDICTED: uncharacterized membrane protein ...  97.8    1e-21   
ref|XP_006448976.1|  hypothetical protein CICLE_v100144071mg            103   2e-21   
ref|XP_001754029.1|  predicted protein                                  101   7e-21   
ref|XP_001762227.1|  predicted protein                                  101   8e-21   
ref|XP_006448973.1|  hypothetical protein CICLE_v100144072mg          92.8    2e-20   
ref|XP_001770612.1|  predicted protein                                99.0    5e-20   
ref|XP_001761096.1|  predicted protein                                94.7    1e-18   
ref|XP_002990725.1|  hypothetical protein SELMODRAFT_41467            88.6    1e-16   
ref|XP_002986705.1|  hypothetical protein SELMODRAFT_41460            86.7    7e-16   
gb|AGV54580.1|  early-responsive to dehydration 4                     86.3    8e-16   Phaseolus vulgaris [French bean]
dbj|BAB63915.1|  ERD4 protein                                         78.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010086875.1|  Uncharacterized membrane protein                 75.5    3e-12   
ref|XP_001754358.1|  predicted protein                                65.5    5e-09   
ref|XP_001782141.1|  predicted protein                                63.5    2e-08   
ref|XP_010099166.1|  Uncharacterized membrane protein                 62.4    6e-08   Morus notabilis
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...  61.6    1e-07   Cucumis melo [Oriental melon]
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...  61.2    1e-07   Cucumis sativus [cucumbers]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.2    1e-07   
ref|XP_001757556.1|  predicted protein                                60.8    2e-07   
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...  60.5    3e-07   Populus euphratica
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...  60.1    3e-07   Eucalyptus grandis [rose gum]
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...  60.1    4e-07   Populus euphratica
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...  59.3    5e-07   Fragaria vesca subsp. vesca
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...  59.3    5e-07   Fragaria vesca subsp. vesca
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177           58.9    7e-07   Selaginella moellendorffii
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725           58.9    7e-07   Selaginella moellendorffii
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683           58.9    7e-07   
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711            58.9    8e-07   
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  58.9    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  58.9    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...  58.5    9e-07   Sesamum indicum [beniseed]
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...  58.5    1e-06   Nelumbo nucifera [Indian lotus]
gb|EPS60017.1|  hypothetical protein M569_14787                       58.2    1e-06   Genlisea aurea
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg           58.2    2e-06   
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg           57.8    2e-06   
dbj|BAF02109.1|  hypothetical protein                                 54.3    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...  57.4    3e-06   Populus euphratica
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...  57.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...  57.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430           57.0    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340        57.0    4e-06   Amborella trichopoda
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    4e-06   
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...  56.6    5e-06   Populus euphratica
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    5e-06   
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  56.6    5e-06   Nelumbo nucifera [Indian lotus]
ref|NP_172660.5|  putative ERD4 protein                               55.8    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...  55.8    8e-06   Pyrus x bretschneideri [bai li]
gb|KDO78340.1|  hypothetical protein CISIN_1g004125mg                 55.8    8e-06   Citrus sinensis [apfelsine]
gb|EPS71959.1|  hypothetical protein M569_02795                       55.8    9e-06   Genlisea aurea
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                    55.5    1e-05   Camelina sativa [gold-of-pleasure]
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                 55.5    1e-05   Citrus sinensis [apfelsine]
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346           55.5    1e-05   
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg           55.5    1e-05   
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg           55.5    1e-05   
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...  55.1    1e-05   Citrus sinensis [apfelsine]
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...  55.1    2e-05   
ref|XP_003551746.1|  PREDICTED: uncharacterized membrane protein ...  55.1    2e-05   Glycine max [soybeans]
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...  54.7    2e-05   Fragaria vesca subsp. vesca
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...  54.7    2e-05   Populus euphratica
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg           54.7    2e-05   Eutrema salsugineum [saltwater cress]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620           54.7    2e-05   Nicotiana sylvestris
gb|KIW64298.1|  hypothetical protein PV04_09243                       54.7    2e-05   Phialophora americana
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...  54.3    2e-05   
ref|XP_011116375.1|  hypothetical protein H072_10986                  54.7    2e-05   
gb|KJB69243.1|  hypothetical protein B456_011G012200                  54.3    3e-05   Gossypium raimondii
ref|XP_007026163.1|  ERD (early-responsive to dehydration stress)...  54.3    3e-05   
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...  54.3    3e-05   
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...  54.3    3e-05   Populus euphratica
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...  54.3    3e-05   Theobroma cacao [chocolate]
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1  54.3    3e-05   Populus euphratica
ref|XP_002529341.1|  conserved hypothetical protein                   54.3    3e-05   
ref|XP_007760845.1|  hypothetical protein A1O7_08665                  54.3    3e-05   Cladophialophora yegresii CBS 114405
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g           54.3    3e-05   Phaseolus vulgaris [French bean]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg           54.3    3e-05   Prunus persica
emb|CDY12941.1|  BnaA09g13330D                                        54.3    3e-05   Brassica napus [oilseed rape]
emb|CDP11354.1|  unnamed protein product                              53.9    3e-05   Coffea canephora [robusta coffee]
ref|XP_002317144.2|  early-responsive to dehydration family protein   53.9    3e-05   
emb|CEI90788.1|  hypothetical protein RMCBS344292_05099               54.3    3e-05   Rhizopus microsporus
gb|KJB10673.1|  hypothetical protein B456_001G215500                  53.9    3e-05   Gossypium raimondii
emb|CEG80743.1|  hypothetical protein RMATCC62417_15039               53.9    4e-05   Rhizopus microsporus
ref|XP_007139547.1|  hypothetical protein PHAVU_008G039200g           53.9    4e-05   Phaseolus vulgaris [French bean]
emb|CEG70654.1|  hypothetical protein RMATCC62417_06513               53.9    4e-05   Rhizopus microsporus
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320           53.9    4e-05   Brassica rapa
ref|XP_003009380.1|  conserved hypothetical protein                   53.5    4e-05   Verticillium alfalfae VaMs.102
ref|XP_010044468.1|  PREDICTED: CSC1-like protein At1g69450           53.9    4e-05   Eucalyptus grandis [rose gum]
ref|XP_010108715.1|  Uncharacterized membrane protein                 53.9    4e-05   Morus notabilis
gb|KJB80261.1|  hypothetical protein B456_013G089300                  53.9    4e-05   Gossypium raimondii
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...  53.9    4e-05   Prunus mume [ume]
emb|CEI96129.1|  hypothetical protein RMCBS344292_10297               53.9    4e-05   Rhizopus microsporus
gb|KHN38468.1|  Putative membrane protein C2G11.09                    53.9    4e-05   Glycine soja [wild soybean]
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...  53.5    4e-05   
gb|KJB80259.1|  hypothetical protein B456_013G089300                  53.5    4e-05   Gossypium raimondii
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...  53.5    4e-05   Glycine max [soybeans]
ref|XP_008730175.1|  hypothetical protein G647_07640                  53.9    5e-05   Cladophialophora carrionii CBS 160.54
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...  53.5    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g           53.5    5e-05   Phaseolus vulgaris [French bean]
gb|KJB80260.1|  hypothetical protein B456_013G089300                  53.5    5e-05   Gossypium raimondii
ref|XP_001770572.1|  predicted protein                                53.1    6e-05   
ref|XP_008339854.1|  PREDICTED: uncharacterized membrane protein ...  53.1    6e-05   
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg           53.1    6e-05   
ref|XP_009650349.1|  hypothetical protein VDAG_00677                  53.1    6e-05   Verticillium dahliae VdLs.17
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...  53.1    6e-05   Sesamum indicum [beniseed]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  53.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  53.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  53.1    7e-05   Tarenaya hassleriana [spider flower]
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010        53.1    7e-05   Sorghum bicolor [broomcorn]
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg           53.1    7e-05   Capsella rubella
ref|XP_006383870.1|  early-responsive to dehydration family protein   53.1    7e-05   
ref|XP_003610472.1|  Membrane protein, putative                       53.1    8e-05   Medicago truncatula
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...  52.8    8e-05   Glycine max [soybeans]
emb|CDY19541.1|  BnaC09g13620D                                        52.8    8e-05   Brassica napus [oilseed rape]
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...  52.8    9e-05   Phoenix dactylifera
gb|KJB69237.1|  hypothetical protein B456_011G012200                  52.8    9e-05   Gossypium raimondii
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...  52.8    9e-05   Nicotiana sylvestris
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620           52.8    9e-05   Nicotiana tomentosiformis
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900           52.8    9e-05   Solanum lycopersicum
ref|XP_002955034.1|  ERD4-related membrane protein                    52.8    9e-05   Volvox carteri f. nagariensis
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg              52.8    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620           52.8    1e-04   Vitis vinifera
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960           52.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like     52.4    1e-04   Setaria italica
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...  52.4    1e-04   Glycine max [soybeans]
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697           52.4    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...  52.4    1e-04   Populus euphratica
gb|KIV93973.1|  hypothetical protein PV10_05141                       52.4    1e-04   Exophiala mesophila
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...  52.4    1e-04   Nicotiana tomentosiformis
gb|KJB69239.1|  hypothetical protein B456_011G012200                  52.4    1e-04   Gossypium raimondii
gb|KJB69236.1|  hypothetical protein B456_011G012200                  52.4    1e-04   Gossypium raimondii
gb|AAL07154.1|  unknown protein                                       52.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960116.1|  hypothetical protein SELMODRAFT_450821           52.4    1e-04   Selaginella moellendorffii
ref|NP_192343.1|  early-responsive to dehydration stress-related ...  52.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...  52.4    1e-04   Prunus mume [ume]
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620           52.4    1e-04   Solanum lycopersicum
ref|XP_007226980.1|  hypothetical protein PRUPE_ppa002249mg           52.4    1e-04   
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...  52.4    1e-04   
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...  52.4    1e-04   Phoenix dactylifera
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                  52.0    1e-04   
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    2e-04   Elaeis guineensis
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    2e-04   
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    2e-04   
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg              52.0    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    2e-04   Elaeis guineensis
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6         52.0    2e-04   
emb|CDY48898.1|  BnaA03g36370D                                        52.0    2e-04   Brassica napus [oilseed rape]
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620           52.0    2e-04   Eucalyptus grandis [rose gum]
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g           52.0    2e-04   
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...  52.0    2e-04   Elaeis guineensis
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620           52.0    2e-04   Brassica rapa
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268           52.0    2e-04   Selaginella moellendorffii
emb|CDP04437.1|  unnamed protein product                              52.0    2e-04   Coffea canephora [robusta coffee]
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg           52.0    2e-04   Capsella rubella
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g           51.6    2e-04   Phaseolus vulgaris [French bean]
ref|XP_011123034.1|  hypothetical protein AOL_s00080g357              51.6    2e-04   Arthrobotrys oligospora ATCC 24927
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...  51.6    2e-04   Brassica rapa
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  51.6    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002340930.1|  DUF221 domain protein, putative                  51.6    2e-04   Talaromyces stipitatus ATCC 10500
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...  51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82907.1|  BnaC01g13570D                                        51.6    2e-04   
ref|XP_639288.1|  hypothetical protein DDB_G0282971                   51.6    2e-04   Dictyostelium discoideum AX4
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960           51.6    2e-04   Tarenaya hassleriana [spider flower]
emb|CDX79125.1|  BnaA01g11920D                                        51.6    2e-04   
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620           51.6    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312           51.6    2e-04   Arabidopsis lyrata subsp. lyrata
dbj|BAD94445.1|  hypothetical protein                                 51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg           51.6    3e-04   Capsella rubella
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  51.6    3e-04   
ref|NP_188799.1|  early-responsive to dehydration stress-related ...  51.6    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CEI90709.1|  hypothetical protein RMCBS344292_05024               51.6    3e-04   Rhizopus microsporus
emb|CDY32438.1|  BnaC03g42220D                                        51.2    3e-04   Brassica napus [oilseed rape]
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...  51.2    3e-04   Solanum tuberosum [potatoes]
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960           51.2    3e-04   Brassica rapa
ref|XP_002518432.1|  conserved hypothetical protein                   51.2    3e-04   
emb|CDX98089.1|  BnaA06g08400D                                        51.2    3e-04   
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg           51.2    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620           51.2    3e-04   Tarenaya hassleriana [spider flower]
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340           51.2    3e-04   Brassica rapa
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430           51.2    3e-04   Brassica rapa
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...  51.2    3e-04   
emb|CDX90856.1|  BnaA03g25360D                                        51.2    3e-04   
gb|KDO75374.1|  hypothetical protein CISIN_1g004795mg                 51.2    3e-04   
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg           51.2    3e-04   
emb|CDY21297.1|  BnaC03g29810D                                        51.2    3e-04   
ref|XP_002886475.1|  F24O1.4                                          51.2    3e-04   
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...  51.2    3e-04   
ref|XP_004491850.1|  PREDICTED: uncharacterized membrane protein ...  51.2    3e-04   
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...  51.2    3e-04   
emb|CEJ03713.1|  hypothetical protein RMCBS344292_17692               50.4    3e-04   
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...  50.8    4e-04   
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg           50.8    4e-04   
gb|KIW33717.1|  hypothetical protein PV07_00545                       50.8    4e-04   
emb|CEG69880.1|  hypothetical protein RMATCC62417_05873               50.8    4e-04   
gb|KIY03809.1|  hypothetical protein Z520_00500                       50.8    4e-04   
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...  50.8    4e-04   
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg           50.8    4e-04   
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535           50.8    5e-04   
gb|KHG01808.1|  putative membrane C2G11.09                            50.8    5e-04   
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...  50.4    5e-04   
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960           50.4    5e-04   
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...  50.4    5e-04   
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900           50.4    5e-04   
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...  50.4    5e-04   
gb|EAY97938.1|  hypothetical protein OsI_19855                        50.4    5e-04   
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg           50.4    5e-04   
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...  50.4    5e-04   
ref|NP_001055457.1|  Os05g0393800                                     50.4    5e-04   
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                  50.4    6e-04   
gb|KHG30770.1|  putative membrane C2G11.09                            50.4    6e-04   
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...  50.4    6e-04   
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.4    6e-04   
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...  50.4    6e-04   
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900           50.4    6e-04   
emb|CDY30043.1|  BnaC05g09770D                                        50.4    6e-04   
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.1    6e-04   
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970        50.1    7e-04   
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.1    7e-04   
gb|KJB57786.1|  hypothetical protein B456_009G181100                  50.1    7e-04   
emb|CBJ30591.1|  early-responsive to dehydration protein-related      50.1    7e-04   
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...  50.1    7e-04   
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...  50.1    7e-04   
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.1    7e-04   
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320    50.1    7e-04   
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...  50.1    7e-04   
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.1    8e-04   
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900           50.1    8e-04   
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900           50.1    8e-04   
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg           50.1    8e-04   
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...  50.1    8e-04   
ref|XP_009356342.1|  PREDICTED: CSC1-like protein At1g69450           50.1    8e-04   
dbj|BAF98597.1|  CM0545.360.nc                                        50.1    8e-04   
emb|CDP03600.1|  unnamed protein product                              50.1    8e-04   
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...  50.1    9e-04   
ref|XP_001826372.2|  hypothetical protein AOR_1_1328054               50.1    9e-04   
ref|XP_003616997.1|  Transmembrane protein                            49.7    9e-04   
dbj|BAE65239.1|  unnamed protein product                              50.1    9e-04   
gb|EIT78590.1|  hypothetical protein Ao3042_04955                     50.1    9e-04   
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...  49.7    0.001   
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900           49.7    0.001   
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g           49.7    0.001   
ref|XP_006287198.1|  hypothetical protein CARUB_v10000374mg           49.7    0.001   
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658           49.7    0.001   



>ref|XP_009611467.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Nicotiana tomentosiformis]
Length=723

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG++PVE GY++RNPFSWIREA+SSSE DII MSGVDTAVYFVFL TALGI V
Sbjct  37   YYPNRILKGMNPVEGGYMTRNPFSWIREAMSSSETDIINMSGVDTAVYFVFLGTALGIFV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG+ILLP LLPVA+TDHS++  +TTS GTFNELDRLSMG +GN+ PRLWAF++ATYWVS
Sbjct  97   FSGIILLPVLLPVASTDHSIKAANTTSKGTFNELDRLSMGQVGNSGPRLWAFIVATYWVS  156

Query  648  VVTYFFLW  671
            VVTY+ LW
Sbjct  157  VVTYYLLW  164



>ref|XP_006364887.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Solanum 
tuberosum]
Length=723

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG++PVE GY++RNPF+W+REAISSSE DII MSGVDTAVYFVFL+TALGI V
Sbjct  37   YYPNRILKGMNPVEGGYMTRNPFAWMREAISSSETDIINMSGVDTAVYFVFLATALGIFV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG++LLP LLPVAATDH++R  +TTS GTFNELD+LSMG +GN+  RLWAF++ATYWVS
Sbjct  97   FSGIVLLPVLLPVAATDHTIRAVNTTSKGTFNELDKLSMGQVGNSGARLWAFIVATYWVS  156

Query  648  VVTYFFLW  671
            +V+YFFLW
Sbjct  157  IVSYFFLW  164



>ref|XP_004244862.1| PREDICTED: CSC1-like protein ERD4 [Solanum lycopersicum]
Length=723

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG++PVE GY++RNPF+W+REAISSSE DII MSGVDTAVYFVFL+TALGI V
Sbjct  37   YYPNRILKGMNPVEGGYMTRNPFAWMREAISSSETDIINMSGVDTAVYFVFLATALGIFV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG++LLP LLPVAATDH++R  +TTS GTFNELD+LSMG +GN+  RLWAF++ATYWVS
Sbjct  97   FSGIVLLPVLLPVAATDHTIRTVNTTSKGTFNELDKLSMGQVGNSGARLWAFIVATYWVS  156

Query  648  VVTYFFLW  671
            +V+Y FLW
Sbjct  157  IVSYLFLW  164



>ref|XP_009781612.1| PREDICTED: CSC1-like protein ERD4 [Nicotiana sylvestris]
Length=723

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG++PVE GY++RNPFSWIREA+SSSE DII MSGVDTAVYFVFL TALGI V
Sbjct  37   YYPNRILKGMNPVEGGYMTRNPFSWIREAMSSSETDIINMSGVDTAVYFVFLGTALGIFV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG++LLP LLPVA+TDHS++  +TTS GTFNELDRLSMGH+GN+ PRLWAF++ATYWVS
Sbjct  97   FSGVVLLPVLLPVASTDHSIKAANTTSKGTFNELDRLSMGHVGNSGPRLWAFIVATYWVS  156

Query  648  VVTYFFLW  671
            VVTYF LW
Sbjct  157  VVTYFLLW  164



>gb|KDO75372.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=379

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>ref|XP_002531053.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31314.1| conserved hypothetical protein [Ricinus communis]
Length=641

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +RNPF+WIREA+SS+E DII MSGVDTAVYFVFLST L ILV
Sbjct  37   YYPNRILKGLEPWEGGSRTRNPFAWIREAMSSTEQDIIDMSGVDTAVYFVFLSTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SG+ILLP LLPVAAT+ +V   ++TS G+FN+LD+LSMGHI   S RLWAFLI+TYWVS
Sbjct  97   LSGIILLPVLLPVAATEKNVTATNSTSEGSFNDLDKLSMGHINEKSSRLWAFLISTYWVS  156

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  157  LVTYFMLW  164



>gb|KDO75373.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=381

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>gb|EYU19152.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=626

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNR+LKGLDP E     RNPF+WIREA+SS+EAD+I MSGVD+AVYFVFLST LGILV
Sbjct  37   YYPNRLLKGLDPYEGLRAPRNPFAWIREALSSTEADVIRMSGVDSAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSV-------RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
             SG+ILLP LLPV+AT H+V         NSTTS G+F++LD+LSMGHI   SPRLWAFL
Sbjct  97   ISGVILLPVLLPVSATAHTVIKAAVAAAANSTTSQGSFDDLDKLSMGHIEEASPRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            I+TYWVS VTY+ LW
Sbjct  157  ISTYWVSFVTYYLLW  171



>gb|EYU19153.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=733

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNR+LKGLDP E     RNPF+WIREA+SS+EAD+I MSGVD+AVYFVFLST LGILV
Sbjct  37   YYPNRLLKGLDPYEGLRAPRNPFAWIREALSSTEADVIRMSGVDSAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSV-------RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
             SG+ILLP LLPV+AT H+V         NSTTS G+F++LD+LSMGHI   SPRLWAFL
Sbjct  97   ISGVILLPVLLPVSATAHTVIKAAVAAAANSTTSQGSFDDLDKLSMGHIEEASPRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            I+TYWVS VTY+ LW
Sbjct  157  ISTYWVSFVTYYLLW  171



>gb|KDO75370.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
 gb|KDO75371.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=515

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>gb|KDO75369.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=615

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>gb|KJB57183.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=515

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KG++P E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRIVKGMEPWEGGSRTRNPFAWIKEALSSSEQDVINMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG++LLP LLP+AATD  V+ N      TSNGTF++LD+LSM +I   SPRLWAFL+AT
Sbjct  97   LSGIVLLPVLLPIAATDDGVKKNEHTSNNTSNGTFSDLDKLSMANIEVKSPRLWAFLVAT  156

Query  636  YWVSVVTYF  662
            YWVSVVTYF
Sbjct  157  YWVSVVTYF  165



>ref|XP_010245168.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=724

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  SRNPF+WIREA++S+EAD+I+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILKGLEPCE-GPRSRNPFTWIREAVTSTEADVISMSGVDTAVYFVFLSTVLGILV  95

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP L+PVAATD SV L  TT NG F+ L++LSMG++   SPRLWAF+I TYWVS
Sbjct  96   LSGLVLLPALVPVAATDDSVGLTQTTGNGNFSSLEKLSMGNVKAKSPRLWAFVIGTYWVS  155

Query  648  VVTYFFLW  671
             VT + LW
Sbjct  156  FVTLYMLW  163



>gb|KDO75368.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=726

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>ref|XP_007024954.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY27576.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
Length=618

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +RNPF+WIREA+SSSE ++I+MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRILKGLEPWEGGSRTRNPFAWIREALSSSEQNVISMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTT-SNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SG++LLP LLPVAATD  V+ +S T SN TF++LD+LSM +I   SPRLWAF+I TYWV
Sbjct  97   LSGIVLLPALLPVAATDDGVKKHSKTASNVTFSDLDKLSMANIEEKSPRLWAFVITTYWV  156

Query  645  SVVTYFFLW  671
            SVVTYF  W
Sbjct  157  SVVTYFLSW  165



>ref|XP_006468078.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
Length=726

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>gb|KHG13189.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=725

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KG++P E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRIVKGMEPWEGGSRTRNPFAWIKEALSSSEQDVINMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG++LLP LLP+AATD  V+ N     TTSNGTF++LD+LSM +I   SPRLWAFL+AT
Sbjct  97   LSGIVLLPVLLPIAATDDGVKKNEHTSNTTSNGTFSDLDKLSMANIEVKSPRLWAFLVAT  156

Query  636  YWVSVVTYF  662
            YWVSVVTYF
Sbjct  157  YWVSVVTYF  165



>gb|KDO75367.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=730

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVF+ST LGI  
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFMSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL+ATYW
Sbjct  97   LSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFLVATYW  156

Query  642  VSVVTYFFLW  671
            VS VTYF LW
Sbjct  157  VSFVTYFLLW  166



>ref|XP_007024953.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY27575.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=724

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +RNPF+WIREA+SSSE ++I+MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRILKGLEPWEGGSRTRNPFAWIREALSSSEQNVISMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTT-SNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SG++LLP LLPVAATD  V+ +S T SN TF++LD+LSM +I   SPRLWAF+I TYWV
Sbjct  97   LSGIVLLPALLPVAATDDGVKKHSKTASNVTFSDLDKLSMANIEEKSPRLWAFVITTYWV  156

Query  645  SVVTYFFLW  671
            SVVTYF  W
Sbjct  157  SVVTYFLSW  165



>gb|KCW75872.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
 gb|KCW75873.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENG-YVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPNR+LKG+DP E G Y SRNPFSWIREA+SSSE D+I +SGVDTAVYFVFLST LGIL
Sbjct  37   YYPNRLLKGMDPFEGGNYASRNPFSWIREALSSSEQDVIAVSGVDTAVYFVFLSTVLGIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNS-TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
            V SG++LLP LLPVA T  +   +S TTSNGTF++LD+LS+G++ + + RLWAFLIATYW
Sbjct  97   VLSGIVLLPVLLPVAVTAKAATTSSNTTSNGTFSDLDKLSLGNVADKNSRLWAFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS+V Y+ LW
Sbjct  157  VSIVAYYLLW  166



>ref|XP_010052016.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
Length=725

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENG-YVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPNR+LKG+DP E G Y SRNPFSWIREA+SSSE D+I +SGVDTAVYFVFLST LGIL
Sbjct  37   YYPNRLLKGMDPFEGGNYASRNPFSWIREALSSSEQDVIAVSGVDTAVYFVFLSTVLGIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNS-TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
            V SG++LLP LLPVA T  +   +S TTSNGTF++LD+LS+G++ + + RLWAFLIATYW
Sbjct  97   VLSGIVLLPVLLPVAVTAKAATTSSNTTSNGTFSDLDKLSLGNVADKNSRLWAFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS+V Y+ LW
Sbjct  157  VSIVAYYLLW  166



>gb|KJB57182.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=610

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KG++P E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRIVKGMEPWEGGSRTRNPFAWIKEALSSSEQDVINMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG++LLP LLP+AATD  V+ N      TSNGTF++LD+LSM +I   SPRLWAFL+AT
Sbjct  97   LSGIVLLPVLLPIAATDDGVKKNEHTSNNTSNGTFSDLDKLSMANIEVKSPRLWAFLVAT  156

Query  636  YWVSVVTYF  662
            YWVSVVTYF
Sbjct  157  YWVSVVTYF  165



>gb|KJB57184.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=622

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KG++P E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRIVKGMEPWEGGSRTRNPFAWIKEALSSSEQDVINMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG++LLP LLP+AATD  V+ N      TSNGTF++LD+LSM +I   SPRLWAFL+AT
Sbjct  97   LSGIVLLPVLLPIAATDDGVKKNEHTSNNTSNGTFSDLDKLSMANIEVKSPRLWAFLVAT  156

Query  636  YWVSVVTYF  662
            YWVSVVTYF
Sbjct  157  YWVSVVTYF  165



>ref|XP_009377481.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G ++RNPF+WI+EA+ S+E +II+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILRGLDPWEGGSMTRNPFAWIKEALYSTEQEIISMSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S ++LLP LLPVAAT+ + +L N+T SNGTF++LD+LSMGH+   SPRLWAFL   YWV
Sbjct  97   LSSIVLLPILLPVAATEEAHKLTNATVSNGTFSDLDQLSMGHLKEKSPRLWAFLFGVYWV  156

Query  645  SVVTYFFLW  671
            S VTY  LW
Sbjct  157  SFVTYVLLW  165



>gb|KJB57185.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=725

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KG++P E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST LGILV
Sbjct  37   YYPNRIVKGMEPWEGGSRTRNPFAWIKEALSSSEQDVINMSGIDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG++LLP LLP+AATD  V+ N      TSNGTF++LD+LSM +I   SPRLWAFL+AT
Sbjct  97   LSGIVLLPVLLPIAATDDGVKKNEHTSNNTSNGTFSDLDKLSMANIEVKSPRLWAFLVAT  156

Query  636  YWVSVVTYF  662
            YWVSVVTYF
Sbjct  157  YWVSVVTYF  165



>emb|CAN64310.1| hypothetical protein VITISV_037471 [Vitis vinifera]
Length=676

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E G  +RNPF+WIREAI+SSE D+I+MSGVD+AVY VFLSTALGIL+
Sbjct  37   YYPNRILKGMDPWEGGKRTRNPFAWIREAITSSEDDVISMSGVDSAVYLVFLSTALGILI  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG++LL  LLPVAATD++++L  NS+TSNGTFN+LD+LSMG++  NS RLWAFLIATYW
Sbjct  97   LSGIVLLLVLLPVAATDNNLKLSANSSTSNGTFNDLDKLSMGNVKANSERLWAFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS VTY+  W
Sbjct  157  VSFVTYYLSW  166



>ref|XP_002280109.1| PREDICTED: CSC1-like protein ERD4 [Vitis vinifera]
Length=724

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E G  +RNPF+WIREAI+SSE D+I+MSGVD+AVY VFLSTALGIL+
Sbjct  37   YYPNRILKGMDPWEGGKRTRNPFAWIREAITSSEDDVISMSGVDSAVYLVFLSTALGILI  96

Query  468  FSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG++LL  LLPVAATD++++L  NS+TSNGTFN+LD+LSMG++  NS RLWAFLIATYW
Sbjct  97   LSGIVLLLVLLPVAATDNNLKLSANSSTSNGTFNDLDKLSMGNVKANSERLWAFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS VTY+  W
Sbjct  157  VSFVTYYLSW  166



>ref|XP_010687077.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=709

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            Y PN I+KGL    +   +RNP SWI+EAISSSE DII++SGVDTAVYFVFL+TAL +L 
Sbjct  37   YSPNLIVKGL---YSSSRTRNPTSWIKEAISSSEDDIISISGVDTAVYFVFLATALAMLF  93

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             +G++LLP+LLPV+ TDHSVRLNSTTSNGTFNELD+ SMGHIG  S RLWA+LIA YWVS
Sbjct  94   LAGIVLLPSLLPVSITDHSVRLNSTTSNGTFNELDKFSMGHIGQKSDRLWAYLIAVYWVS  153

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  154  LVTYFLLW  161



>ref|XP_010052015.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
 gb|KCW75874.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENG-YVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPNR+L+G+DP E G   SRNPF+WIREA+SS+E D++ +SGVDTAVYFVFLST LGIL
Sbjct  37   YYPNRLLRGVDPFEGGNRTSRNPFAWIREALSSTEQDVVAVSGVDTAVYFVFLSTVLGIL  96

Query  465  VFSGLILLPTLLPVAATDHS-VRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
            V SG++LLP LLPVA TD + +  + TTSNGTF++LD+LSMG++   S RLW FLIATYW
Sbjct  97   VLSGIVLLPILLPVAVTDKTPIASSDTTSNGTFSDLDKLSMGNVAEKSSRLWVFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS+V Y+ LW
Sbjct  157  VSIVAYYLLW  166



>ref|XP_010687100.1| PREDICTED: CSC1-like protein ERD4 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 3/128 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLD       +RNP SWI+EA+SSSE DII +SGVDTAVYF+FLSTAL +LV
Sbjct  37   YYPNRILKGLDSSSR---TRNPISWIKEAVSSSEDDIIAVSGVDTAVYFIFLSTALTMLV  93

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             +G++LLP+LLPV+ TDHS++  +TTS  TFNELD+ SMGHIG  S RLWA+LIA YWVS
Sbjct  94   LAGVVLLPSLLPVSITDHSIKSLNTTSADTFNELDKFSMGHIGQKSDRLWAYLIALYWVS  153

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  154  LVTYFLLW  161



>ref|XP_009377479.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=729

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GL+P E    +RNPF+WI+EA+ S+E +II+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILRGLEPWEGESRTRNPFAWIKEALYSTEQEIISMSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S ++LLP LLPVAAT+   +L N T SNGT+++LD+LSMGH+   S RLWAFL   YWV
Sbjct  97   LSSIVLLPILLPVAATEEVTKLTNITVSNGTYSDLDKLSMGHLKEMSSRLWAFLFGVYWV  156

Query  645  SVVTYFFLW  671
            S VTYFFLW
Sbjct  157  SFVTYFFLW  165



>ref|XP_008371649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=725

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G ++RNPF+WI+EA+ S+E +II++SGVDTAVYFVF+ST LGILV
Sbjct  37   YYPNRILRGLDPWEGGSMTRNPFAWIKEALYSTEQEIISVSGVDTAVYFVFMSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S ++LLP LL VAAT+ + +L +++ SNGTF++LD LSMGH+   SPRLWAFL+  YWV
Sbjct  97   LSSIVLLPILLSVAATEEAHKLADASVSNGTFSDLDHLSMGHLKEKSPRLWAFLVGVYWV  156

Query  645  SVVTYFFLW  671
            S VTY  LW
Sbjct  157  SFVTYVLLW  165



>gb|KCW75871.1| hypothetical protein EUGRSUZ_D00260 [Eucalyptus grandis]
Length=710

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENG-YVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPNR+L+G+DP + G + SRNPF+WIREA+SSSE D+I +SGVDTAVYFVFLST LGIL
Sbjct  37   YYPNRLLRGVDPFDGGNHSSRNPFAWIREALSSSEQDVIAVSGVDTAVYFVFLSTVLGIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNS-TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
            V SG++LLP LLPVAAT+ +   +S  TSNG F++L++LSM ++   S RLWAFLIATYW
Sbjct  97   VLSGIVLLPVLLPVAATEKTPNTSSDITSNGIFSDLEKLSMRNVAEKSSRLWAFLIATYW  156

Query  642  VSVVTYFFLW  671
            VS+V Y  LW
Sbjct  157  VSIVAYCLLW  166



>ref|XP_009408546.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP+E   V+RNP +WI+EA+ +SEAD+I ++GVD AVY VFLS+ L ILV
Sbjct  37   YYPNRILRGLDPLEGRTVTRNPLTWIKEAVKASEADVIAVAGVDAAVYLVFLSSVLAILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN-STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
            FSG+ILLP LLPVAATD+  R    + S GTF  LD+L+MGH+   S RLWAFL+  YWV
Sbjct  97   FSGIILLPVLLPVAATDNGTRSTIDSNSQGTFKNLDKLTMGHVKEGSSRLWAFLLGVYWV  156

Query  645  SVVTYFFLW  671
            S VTY+ LW
Sbjct  157  SFVTYYVLW  165



>ref|XP_010478422.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KGL+P E   ++RNP +W+REA +SSE DI+ +SGVDTAV+FVFLST LGI  
Sbjct  37   YYPNRIIKGLEPWEGTSLTRNPLAWMREAFTSSEQDIVDVSGVDTAVHFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS-----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             SGL LLPTLLP+AATD++++  S     TTS GTF+++D LSM +I   SPRLWAFL A
Sbjct  97   CSGLFLLPTLLPIAATDNNLKTRSKNATDTTSKGTFSQIDNLSMANITKKSPRLWAFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YW+S VTYFFLW
Sbjct  157  VYWISFVTYFFLW  169



>ref|XP_008784823.1| PREDICTED: CSC1-like protein ERD4 [Phoenix dactylifera]
Length=723

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNR+L+GLD  E    +RNPF+WI+EA S++EAD++  +GVD AVY +FL + LGILV
Sbjct  37   YYPNRVLRGLDAWEGRRRTRNPFAWIQEAFSATEADVVEAAGVDAAVYLIFLGSVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG++LLP LLPV+ TDH+V+ ++  SNGTFN+LD+LSMG++   SPRLWAFL+ TY +S
Sbjct  97   FSGIVLLPVLLPVSGTDHNVKAHAQNSNGTFNDLDKLSMGNVQEKSPRLWAFLLGTYLIS  156

Query  648  VVTYFFLW  671
             VT++ LW
Sbjct  157  FVTFYMLW  164



>ref|XP_010907974.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein ERD4 [Elaeis 
guineensis]
Length=724

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GL+  E G  +RNP +WI+EA S++EAD++  +GVD AVY VFLS+ LGILV
Sbjct  37   YYPNRILRGLERSEGGRRTRNPVAWIKEAFSATEADVVEAAGVDAAVYLVFLSSVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
            FSG++LLP LLPVA TDH+V+ ++  SNGTFN LD+LSMG++   S RLWAFL+ TY VS
Sbjct  97   FSGIVLLPVLLPVAGTDHNVKAHAENSNGTFNNLDKLSMGNVQEKSSRLWAFLLGTYCVS  156

Query  648  VVTYFFLW  671
             VT++ LW
Sbjct  157  FVTFYVLW  164



>ref|XP_007147944.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
 gb|ESW19938.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
Length=728

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP+E G  SRNPFSWI+EA+SSSE D++TMSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGLDPLEGGSKSRNPFSWIKEAVSSSERDVVTMSGVDTAVYFVFLTTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN----STTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG+ILLP LLP++ATD++++       TTS GTFN+LD+LSM +I   SPRLW FLIA 
Sbjct  97   LSGVILLPVLLPLSATDNAMKRQGAKAQTTSKGTFNQLDKLSMANITAKSPRLWGFLIAC  156

Query  636  YWVSVVTYFFLW  671
            YWVS+VT+  LW
Sbjct  157  YWVSIVTFVLLW  168



>gb|AGV54368.1| early-responsive to dehydration [Phaseolus vulgaris]
Length=515

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 108/132 (82%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP+E G  SRNPFSWI+EA+SSSE D++TMSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGLDPLEGGSKSRNPFSWIKEAVSSSERDVVTMSGVDTAVYFVFLTTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN----STTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             SG+ILLP LLP++ATD++++       TTS GTFN+LD+LSM +I   SPRLW FLIA 
Sbjct  97   LSGVILLPVLLPLSATDNAMKRQGAKAQTTSKGTFNQLDKLSMANITAKSPRLWGFLIAC  156

Query  636  YWVSVVTYFFLW  671
            YWVS+VT+  LW
Sbjct  157  YWVSIVTFVLLW  168



>ref|XP_010540605.1| PREDICTED: CSC1-like protein ERD4 [Tarenaya hassleriana]
Length=718

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIRE++SSSE D+ITMSGVDTAVYFVFL T LGILV
Sbjct  37   YYPNRILKGMDPWEGRSLTRNPFAWIRESLSSSEQDVITMSGVDTAVYFVFLGTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSV-RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SG+ILLP LLP+AATD  + ++  +TSNGTF++LD LSMG+I  +SPRLWAFL A YW+
Sbjct  97   LSGVILLPVLLPLAATDDGIKKITDSTSNGTFSQLDNLSMGNISKSSPRLWAFLAAVYWI  156

Query  645  SVVTYFFLW  671
            SVVTYF LW
Sbjct  157  SVVTYFLLW  165



>ref|XP_004485983.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Cicer 
arietinum]
Length=722

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E+GY +RNPFSWI+EA SSSE D+I MSGVDTAVYFVFLST   IL+
Sbjct  37   YYPNRILKGLDPFEDGYKTRNPFSWIKEAYSSSEKDVIAMSGVDTAVYFVFLSTVFSILI  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SG+ILLP LLPVA TD    + +TTS GTF ELD+LSMGHI   S RLWAF IA YWVS
Sbjct  97   LSGIILLPVLLPVAITDVD-GMTNTTSKGTFEELDKLSMGHITARSARLWAFFIACYWVS  155

Query  648  VVTYFFLW  671
            +V+ F LW
Sbjct  156  LVSLFLLW  163



>ref|XP_006836313.1| hypothetical protein AMTR_s00092p00051600 [Amborella trichopoda]
 gb|ERM99166.1| hypothetical protein AMTR_s00092p00051600 [Amborella trichopoda]
Length=711

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP+ NG+ +RNPFSWI+EAISSSE +II M+GVDTAVYFVFL T LGILV
Sbjct  37   YYPNRILKGLDPM-NGHRTRNPFSWIKEAISSSEENIIDMAGVDTAVYFVFLRTVLGILV  95

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SG++LLP LLPVA TD +  L   T SNGTFN LD+L++G++ N SPRLWAFL+ATYWV
Sbjct  96   ISGILLLPILLPVAVTDINTTLTKETNSNGTFNNLDKLAIGNVQNKSPRLWAFLLATYWV  155

Query  645  SVVTYFFLW  671
            S +T+F LW
Sbjct  156  SFITFFMLW  164



>gb|KHN06954.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=723

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP+E GY SRNPFSWI+EA++SSE D+I MSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGLDPLEGGYKSRNPFSWIKEALTSSERDVIAMSGVDTAVYFVFLTTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SG+ILLP LLP++ TDH ++   TTSNGTF+ELD+LSM +I   S RLW F IA YWVS
Sbjct  97   LSGVILLPVLLPLSVTDHGMK-TQTTSNGTFSELDKLSMANITAKSSRLWGFFIACYWVS  155

Query  648  VVTYFFLW  671
            +VT+  LW
Sbjct  156  IVTFALLW  163



>ref|XP_003546071.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=723

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP+E GY SRNPFSWI+EA++SSE D+I MSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGLDPLEGGYKSRNPFSWIKEALTSSERDVIAMSGVDTAVYFVFLTTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SG+ILLP LLP++ TDH ++   TTSNGTF+ELD+LSM +I   S RLW F IA YWVS
Sbjct  97   LSGVILLPVLLPLSVTDHGMK-TQTTSNGTFSELDKLSMANITAKSSRLWGFFIACYWVS  155

Query  648  VVTYFFLW  671
            +VT+  LW
Sbjct  156  IVTFALLW  163



>ref|XP_008439583.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Cucumis 
melo]
Length=725

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP   G  SR+PF+WI EA+SSSE D+I+MSGVDTAVYFVFL+T LGI V
Sbjct  37   YYPNRILKGLDPTV-GSRSRSPFAWITEALSSSEKDVISMSGVDTAVYFVFLATVLGIFV  95

Query  468  FSGLILLPTLLPVAATDHSV---RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
             S ++LLP L+P+A TD  +   ++N+T S GTF+ELD LSMG+I   S RLWAFL+ATY
Sbjct  96   LSAVVLLPVLIPIAVTDDGIKNAKMNNTQSVGTFSELDNLSMGNINLRSNRLWAFLLATY  155

Query  639  WVSVVTYFFLW  671
            WVS V Y+  W
Sbjct  156  WVSFVVYYLTW  166



>ref|XP_003593877.1| Early-responsive to dehydration [Medicago truncatula]
 gb|AES64128.1| early-responsive to dehydration stress protein (ERD4) [Medicago 
truncatula]
Length=722

 Score =   169 bits (427),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 85/128 (66%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPFSWI+EA SSSE D+I MSG+DTAV+FVFLST   ILV
Sbjct  37   YYPNRILKGLDPFEGGSKTRNPFSWIKEAFSSSEQDVIAMSGLDTAVFFVFLSTVFSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
              G+ILLP LLP+A T  + +   TTS GTFNELD+LSMG+I   S RLWAF IA Y+VS
Sbjct  97   ICGIILLPVLLPIAVTGGAGK-KLTTSEGTFNELDQLSMGNITAKSVRLWAFFIACYFVS  155

Query  648  VVTYFFLW  671
            +V+ F LW
Sbjct  156  LVSLFLLW  163



>emb|CDP05663.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E    +RNPF+WIREA+SS+EAD+I +SGVD+AVYFVF+ST LGILV
Sbjct  37   YYPNRILKGLDPFEGSKRTRNPFAWIREALSSTEADVIRISGVDSAVYFVFMSTILGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN-STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SGL+LLP LLPVAATDHS+ L  + TS GTFN+LD+LSMGH+G NSPRLWAF+ ATY V
Sbjct  97   LSGLVLLPVLLPVAATDHSLHLTVNETSQGTFNDLDKLSMGHVGANSPRLWAFVTATYLV  156

Query  645  SVVTYFFLW  671
            S+V Y  LW
Sbjct  157  SIVAYCLLW  165



>ref|XP_006415483.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
 gb|ESQ33836.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
Length=723

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YY NRILKG++P E   ++RNPF+WIREA +SSE D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYSNRILKGMEPWEGTSLTRNPFAWIREAFTSSEQDVVNISGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS-----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             S +++LPTLLP+AATD S++  S     T S  TF++LD LSM +I   SPRLWAFL A
Sbjct  97   LSSVLILPTLLPLAATDDSLKSKSRNATETVSKVTFSQLDNLSMANITKRSPRLWAFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YWVS+VTYF LW
Sbjct  157  VYWVSLVTYFMLW  169



>ref|XP_004158645.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=725

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP   G  SR+PF+WI EA+SSSE D+I+MSGVD+AVYFVFL+T LGI V
Sbjct  37   YYPNRILKGLDPTV-GSRSRSPFAWITEALSSSEKDVISMSGVDSAVYFVFLATVLGIFV  95

Query  468  FSGLILLPTLLPVAATDHSV---RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
             S ++LLP L+P+A TD  +   ++N+T S GTF+ELD LSMG+I   S RLWAFL+ATY
Sbjct  96   LSAVVLLPVLIPIAVTDDGIKNAKMNNTQSVGTFSELDNLSMGNINLRSNRLWAFLLATY  155

Query  639  WVSVVTYFFLW  671
            WVS V Y+  W
Sbjct  156  WVSFVVYYLTW  166



>ref|XP_004134564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN49436.1| hypothetical protein Csa_6G525220 [Cucumis sativus]
Length=725

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP   G  SR+PF+WI EA+SSSE D+I+MSGVD+AVYFVFL+T LGI V
Sbjct  37   YYPNRILKGLDPTV-GSRSRSPFAWITEALSSSEKDVISMSGVDSAVYFVFLATVLGIFV  95

Query  468  FSGLILLPTLLPVAATDHSV---RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
             S ++LLP L+P+A TD  +   ++N+T S GTF+ELD LSMG+I   S RLWAFL+ATY
Sbjct  96   LSAVVLLPVLIPIAVTDDGIKNAKMNNTQSVGTFSELDNLSMGNINLRSNRLWAFLLATY  155

Query  639  WVSVVTYFFLW  671
            WVS V Y+  W
Sbjct  156  WVSFVVYYLTW  166



>ref|XP_009362276.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G ++RNPF+WI+EA+SS+E ++I+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILRGLDPWEGGSMTRNPFAWIKEALSSTEQEVISMSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S L+LLP LLPVAAT+   +L N+T SNGTF++LD+LSMGH+   SPRLWAFL+  YWV
Sbjct  97   LSSLVLLPILLPVAATEVGQKLTNATISNGTFSDLDKLSMGHLKEKSPRLWAFLLGVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFLLW  165



>emb|CBI30957.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +3

Query  315  LDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPT  494
            +DP E G  +RNPF+WIREAI+SSE D+I+MSGVD+AVY VFLSTALGIL+ SG++LL  
Sbjct  1    MDPWEGGKRTRNPFAWIREAITSSEDDVISMSGVDSAVYLVFLSTALGILILSGIVLLLV  60

Query  495  LLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            LLPVAATD++++L  NS+TSNGTFN+LD+LSMG++  NS RLWAFLIATYWVS VTY+  
Sbjct  61   LLPVAATDNNLKLSANSSTSNGTFNDLDKLSMGNVKANSERLWAFLIATYWVSFVTYYLS  120

Query  669  W  671
            W
Sbjct  121  W  121



>gb|KHG16289.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +RNP +WIREA+SS+E DII MSG+DTAVYFVFL T LGILV
Sbjct  17   YYPNRILKGLEPWEGGLKTRNPLAWIREALSSTEQDIINMSGIDTAVYFVFLGTVLGILV  76

Query  468  FSGLILLPTLLPVAATDHSVRLN--STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG++LL  LLP A+TD  V+ N  STTS GTFN+LD+LSM +I   SPRLWAFLIA YW
Sbjct  77   LSGVVLLLVLLPTASTDDEVKKNAKSTTSKGTFNDLDKLSMANIEERSPRLWAFLIAVYW  136

Query  642  VSVVTYFFLW  671
            VS+VTY   W
Sbjct  137  VSLVTYVLSW  146



>gb|KJB66976.1| hypothetical protein B456_010G168400 [Gossypium raimondii]
Length=725

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +RNP +WIREA+SS+E DII MSG+DTAVYFVFL T LGILV
Sbjct  37   YYPNRILKGLEPWEGGLKTRNPLAWIREALSSTEQDIINMSGIDTAVYFVFLGTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN--STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SG++LL  LLP A+TD  V+ N  STTS GTFN+LD+LSM +I   SPRLWAFLIA YW
Sbjct  97   LSGVVLLLVLLPTASTDDEVKKNAKSTTSKGTFNDLDKLSMANIEERSPRLWAFLIAVYW  156

Query  642  VSVVTYFFLW  671
            VS+VTY   W
Sbjct  157  VSLVTYVLSW  166



>gb|EPS64315.1| hypothetical protein M569_10465, partial [Genlisea aurea]
Length=717

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL GLDP +    +RNPF+WIREA+SS+EADI+ +SGVD+AVYFVFL+T LGILV
Sbjct  37   YYPNRILHGLDPYDGLRRTRNPFAWIREALSSTEADIVRISGVDSAVYFVFLTTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHS-VRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SGL LLP LLPVAAT  S +  N TTS G+FN+LD+LSM HI   SPRLWAFLIATYWV
Sbjct  97   LSGLFLLPVLLPVAATARSKIPANETTSQGSFNDLDKLSMAHIQEKSPRLWAFLIATYWV  156

Query  645  SVVTYFFLW  671
            + V+ + LW
Sbjct  157  TFVSLYLLW  165



>ref|XP_006306879.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
 gb|EOA39777.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
Length=725

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 106/133 (80%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KGL+P E   ++RNPF+W+REA +SSE DI+ +SGVDTAV+FVFLST LGI  
Sbjct  37   YYPNRIIKGLEPWEGTSLTRNPFAWMREAFTSSEQDIVNVSGVDTAVHFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLN-----STTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             SGL+LLPTLLP+AATDH+++        TTS GTF++LD LSM +I   SPRLWAFL A
Sbjct  97   CSGLLLLPTLLPIAATDHNIKTRVKNGTDTTSKGTFSQLDNLSMANITKKSPRLWAFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YWVS+VTYFFLW
Sbjct  157  VYWVSLVTYFFLW  169



>ref|XP_011012269.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            Y+PNRILKGLDP + G  SRNPF+WIREA+SSSE D+I MSGVD AVYFVFLSTAL ILV
Sbjct  37   YFPNRILKGLDPWDGGSRSRNPFAWIREALSSSEQDVINMSGVDAAVYFVFLSTALAILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP LLPVAATD +V++     N TF+++D+L MG++   SPRLWAFLIATYWVS
Sbjct  97   LSGLVLLPVLLPVAATDDNVKIQKAKGNQTFSDIDKLLMGNVKGGSPRLWAFLIATYWVS  156

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  157  LVTYFLLW  164



>ref|XP_008371799.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=724

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G ++RNPF+WI+EA+SS+E ++I+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILRGLDPWEGGSMTRNPFAWIKEALSSTEQEVISMSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S L+LLP LLPVAAT+   +L N+T SNGTF++LD+LSMGH+   SPRLWAFL   YWV
Sbjct  97   LSSLVLLPILLPVAATEVGQKLANATISNGTFSDLDKLSMGHLKLKSPRLWAFLFGVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFLLW  165



>ref|XP_007211358.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
 gb|EMJ12557.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
Length=724

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G  +RNPF+WI+EA++S+E ++I+MSGVDTAVYFVFL+T LGILV
Sbjct  37   YYPNRILRGLDPWEGGSKTRNPFAWIKEALTSTEQEVISMSGVDTAVYFVFLTTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN-STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S LILLP LLPVAATD   +L+ + TSNGTFN+LD+LSMGH+   SPRLWAFLI  YWV
Sbjct  97   LSSLILLPVLLPVAATDVGDKLSINATSNGTFNDLDKLSMGHLQEKSPRLWAFLIGVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFLLW  165



>ref|XP_010499567.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 107/133 (80%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KGL+P E   ++RNP +W+REA +SSE DI+ +SGVDTAV+FVFLSTALGI  
Sbjct  37   YYPNRIIKGLEPWEGTSLTRNPLAWMREAFTSSEQDIVNVSGVDTAVHFVFLSTALGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS-----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             SGL+LLPTLLP+AATDH+++  S     TTS GTF+++D LSM +I   SPRLWAFL A
Sbjct  97   CSGLLLLPTLLPIAATDHNLKTRSKNATDTTSKGTFSQIDNLSMANITKKSPRLWAFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YW+S+VTYFFLW
Sbjct  157  VYWISLVTYFFLW  169



>ref|XP_011014082.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            Y+PNRILKGLDP + G  SRNPF+WIREA+SSSE D+I MSGVD AVYFVFLSTA+ ILV
Sbjct  37   YFPNRILKGLDPWDGGSRSRNPFAWIREALSSSEQDVINMSGVDAAVYFVFLSTAVAILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP LLPVAATD +V++     N TF+++D+L MG++   SPRLWAFLIATYWVS
Sbjct  97   LSGLVLLPVLLPVAATDDNVKIQKAKGNQTFSDVDKLLMGNVKGGSPRLWAFLIATYWVS  156

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  157  LVTYFLLW  164



>ref|XP_008225537.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=724

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+GLDP E G  +RNPF+WI+EA++S+E ++I+MSGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILRGLDPWEGGSKTRNPFAWIKEALTSTEQEVISMSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLN-STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S LILLP LLPVAATD   +L+ + TSNGTF++LD+LSMGH+   SPRLWAFLI  YWV
Sbjct  97   LSSLILLPVLLPVAATDVGSKLSINATSNGTFSDLDKLSMGHLQEKSPRLWAFLIGVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFLLW  165



>gb|KHN47349.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=683

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 6/131 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL   E GY SRNPFSWI+EA+SSSE D+I MSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGL---EGGYKSRNPFSWIKEAVSSSERDVIAMSGVDTAVYFVFLTTVLSILV  93

Query  468  FSGLILLPTLLPVAATDHSVRLNS---TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
             SG+ILLP LLP++ TDH ++  S   T+SNGTF+ELD+LSM +I  +S RLW F IA Y
Sbjct  94   LSGVILLPVLLPLSVTDHGMKAQSKTQTSSNGTFSELDKLSMANITASSSRLWGFFIACY  153

Query  639  WVSVVTYFFLW  671
            WVS+VT+  LW
Sbjct  154  WVSIVTFVLLW  164



>ref|XP_003542948.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=724

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 104/131 (79%), Gaps = 6/131 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL   E GY SRNPFSWI+EA+SSSE D+I MSGVDTAVYFVFL+T L ILV
Sbjct  37   YYPNRILKGL---EGGYKSRNPFSWIKEAVSSSERDVIAMSGVDTAVYFVFLTTVLSILV  93

Query  468  FSGLILLPTLLPVAATDHSVRLNS---TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
             SG+ILLP LLP++ TDH ++  S   T+SNGTF+ELD+LSM +I  +S RLW F IA Y
Sbjct  94   LSGVILLPVLLPLSVTDHGMKAQSKTQTSSNGTFSELDKLSMANITASSSRLWGFFIACY  153

Query  639  WVSVVTYFFLW  671
            WVS+VT+  LW
Sbjct  154  WVSIVTFVLLW  164



>ref|XP_011096640.1| PREDICTED: CSC1-like protein ERD4 [Sesamum indicum]
Length=718

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRIL+G+DP E    SRNPF+WIREA+ S+EAD+I MSGVD+AVYFVFL+T LGILV
Sbjct  37   YYPNRILRGMDPYEGLRASRNPFAWIREALVSTEADVIRMSGVDSAVYFVFLTTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSV-RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             SGL+LLP LLPVAAT H V +   TTS G+FN+LD+LSMGH+   S RLWAF+IATYWV
Sbjct  97   LSGLVLLPVLLPVAATAHGVMKAKDTTSEGSFNDLDKLSMGHVEQRSARLWAFVIATYWV  156

Query  645  SVVTYFFLW  671
            S VTY  LW
Sbjct  157  SFVTYGLLW  165



>ref|XP_002300337.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
 gb|EEE85142.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
Length=724

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P +    SRNPF+WIREA SSSE D+I MSGVDTAVYFVFLSTAL ILV
Sbjct  37   YYPNRILKGLEPWDGASRSRNPFAWIREAFSSSEQDVINMSGVDTAVYFVFLSTALAILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP LLPVAATD +V+      N +F+++D+L MG++   SPRLWAFLIATYWVS
Sbjct  97   LSGLVLLPVLLPVAATDDNVKTQKDKGNQSFSDIDKLLMGNVKGGSPRLWAFLIATYWVS  156

Query  648  VVTYFFLW  671
            +VTYF LW
Sbjct  157  LVTYFLLW  164



>ref|XP_002890865.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67124.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
Length=722

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E   ++RNPF+W+REA++SSE D++ +SGVDTAV+FVFL+T LGI  
Sbjct  37   YYPNRILKGLEPWEGTSLTRNPFAWMREALTSSEQDVVNLSGVDTAVHFVFLTTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR--LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYW  641
             SGL+LLPTLLP+AATDH+++     TTS GTF++LD LSM +I   SPRLWAFL A YW
Sbjct  97   CSGLLLLPTLLPLAATDHNLKNTKTETTSKGTFSQLDNLSMANITKKSPRLWAFLGAVYW  156

Query  642  VSVVTYFFLW  671
            +S+VTYFFLW
Sbjct  157  ISLVTYFFLW  166



>ref|XP_010460826.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Camelina sativa]
 ref|XP_010460827.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Camelina sativa]
Length=725

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 106/133 (80%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRI+KGL+P E   ++RNP +W+REA +SSE DI+ +SGVDTAV+FVFLST LGI  
Sbjct  37   YYPNRIIKGLEPWEGTSLTRNPLAWMREAFTSSEQDIVNVSGVDTAVHFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS-----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             SGL+LLPTLLP+AATD++++  S     TTS GTF+++D LSM +I   SPRLWAFL A
Sbjct  97   CSGLLLLPTLLPIAATDNNLKTRSKNATDTTSKGTFSQIDNLSMANITKRSPRLWAFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YW+S+VTYFFLW
Sbjct  157  VYWISLVTYFFLW  169



>emb|CDY02286.1| BnaA09g26160D [Brassica napus]
Length=722

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA++SSE D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREALTSSEQDVVNLSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L++LP LLP+AATD S++    +  TTS GTF++LD LSM +I   S RLWAFL A 
Sbjct  97   LSSLLILPILLPLAATDKSIKNSRDVTDTTSKGTFSQLDNLSMANITRKSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YW+S+VTYF LW
Sbjct  157  YWISLVTYFMLW  168



>ref|XP_009115162.1| PREDICTED: CSC1-like protein ERD4 [Brassica rapa]
Length=722

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA++SSE D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREALTSSEQDVVNLSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L++LP LLP+AATD S++    +  TTS GTF++LD LSM +I   S RLWAFL A 
Sbjct  97   LSSLLILPILLPLAATDKSIKNSRDVTDTTSKGTFSQLDNLSMANITRKSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YW+S+VTYF LW
Sbjct  157  YWISLVTYFMLW  168



>ref|XP_004293515.1| PREDICTED: CSC1-like protein ERD4 [Fragaria vesca subsp. vesca]
Length=726

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGLDP E G  +RNPF+WI+EA++S+E ++I +SGVDTAVYFVFLST LGILV
Sbjct  37   YYPNRILKGLDPWEGGSKTRNPFAWIKEALTSTEQEVIALSGVDTAVYFVFLSTVLGILV  96

Query  468  FSGLILLPTLLPVAATDHSVRL-NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S LILLP LLPV+ATD    + N+TTSNGTF++LD+LS+GH+   SPRLWA+L+  YWV
Sbjct  97   LSSLILLPVLLPVSATDIGDAITNTTTSNGTFSDLDKLSIGHVQAKSPRLWAYLLGVYWV  156

Query  645  SVVTYFFLW  671
            S V+YF LW
Sbjct  157  SFVSYFLLW  165



>emb|CDY12050.1| BnaC03g59660D [Brassica napus]
Length=723

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA +S+E D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREAFTSTEQDVVKLSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP++ATD+S++       TTSNGTF+++D LSM +I   S RLWAFL A 
Sbjct  97   LSALLLLPTLLPISATDNSLKNSRSATDTTSNGTFSQIDNLSMANITKKSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YWVS+VTYF LW
Sbjct  157  YWVSLVTYFMLW  168



>sp|A9LIW2.2|CSC1L_BRAJU RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Brassica juncea]
 gb|ABX56139.2| ERD4 protein [Brassica juncea]
Length=723

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA +S+E D++ +SGVDTAVYFVF ST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREAFTSTEQDVVKLSGVDTAVYFVFQSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLN----STTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP+AATD+++  +     TTSNGTF++LD LSM +I  +S RLWAFL A 
Sbjct  97   LSALLLLPTLLPIAATDNNLETSRSATDTTSNGTFSQLDNLSMANITKSSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YWVSVVTYF LW
Sbjct  157  YWVSVVTYFMLW  168



>emb|CDX90246.1| BnaA08g17380D [Brassica napus]
Length=723

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA +S+E D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREAFTSTEQDVVKLSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP++ATD+S++    +  TTSNGTF++LD LSM +I   S RLWAFL A 
Sbjct  97   LSALLLLPTLLPLSATDNSLKTSRNVTDTTSNGTFSQLDNLSMANITRRSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YWVSVVTYF LW
Sbjct  157  YWVSVVTYFMLW  168



>ref|XP_010275905.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
 ref|XP_010275906.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=722

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E G  +R+PF+WI EA+ S+EADII+MSG+DTAVYFVFL+T LGILV
Sbjct  37   YYPNRILKGLEPYE-GARTRSPFTWIWEALCSTEADIISMSGIDTAVYFVFLNTVLGILV  95

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP LLPVAATD SV  N +TSNGTF+ LD++SMG++   SPRLWAF I TYWVS
Sbjct  96   LSGLVLLPVLLPVAATDDSVS-NQSTSNGTFSNLDKISMGNVKARSPRLWAFFIGTYWVS  154

Query  648  VVTYFFLW  671
             VT++ LW
Sbjct  155  FVTFYMLW  162



>gb|ABV89627.1| early-responsive to dehydration 4 [Brassica rapa]
Length=723

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKG+DP E   ++RNPF+WIREA +S+E D++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKGMDPWEGSSLTRNPFAWIREAFTSTEQDVVKLSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP++ATD+S++    +  TTSNGTF++LD LSM +I   S RLWAFL A 
Sbjct  97   LSALLLLPTLLPLSATDNSLKTSRNVTDTTSNGTFSQLDNLSMANITRRSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YWVS+VTYF LW
Sbjct  157  YWVSLVTYFMLW  168



>gb|AAK68752.1| Unknown protein [Arabidopsis thaliana]
Length=532

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E   ++RNPF+W+REA++SSE D++ +SGVDTAV+FVFLST LGI  
Sbjct  37   YYPNRILKGLEPWEGTSLTRNPFAWMREALTSSEQDVVNLSGVDTAVHFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP+AATD++++       TTS GTF++LD LSM +I   S RLWAFL A 
Sbjct  97   CSSLLLLPTLLPLAATDNNIKNTKNATDTTSKGTFSQLDNLSMANITKKSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YW+S+VTYFFLW
Sbjct  157  YWISLVTYFFLW  168



>ref|NP_564354.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|Q9C8G5.1|CSCLD_ARATH RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Arabidopsis thaliana]
 gb|AAG51102.1|AC025295_10 unknown protein [Arabidopsis thaliana]
 gb|AAK59597.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34230.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31209.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34626.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Arabidopsis 
thaliana]
Length=724

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 105/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILKGL+P E   ++RNPF+W+REA++SSE D++ +SGVDTAV+FVFLST LGI  
Sbjct  37   YYPNRILKGLEPWEGTSLTRNPFAWMREALTSSEQDVVNLSGVDTAVHFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
             S L+LLPTLLP+AATD++++       TTS GTF++LD LSM +I   S RLWAFL A 
Sbjct  97   CSSLLLLPTLLPLAATDNNIKNTKNATDTTSKGTFSQLDNLSMANITKKSSRLWAFLGAV  156

Query  636  YWVSVVTYFFLW  671
            YW+S+VTYFFLW
Sbjct  157  YWISLVTYFFLW  168



>gb|KDP38019.1| hypothetical protein JCGZ_04662 [Jatropha curcas]
Length=724

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYP+RILKGLD  E G  +RNP +WI EA SS+E DII +SGVDTAVYFVFL+T L ILV
Sbjct  37   YYPSRILKGLDAWEGGSRTRNPLAWIWEAFSSTEQDIINVSGVDTAVYFVFLTTVLSILV  96

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
             SGL+LLP LLPVAAT  ++   + TS GTFN+L++LSMGH+   +PRLWAFLIA YWVS
Sbjct  97   LSGLVLLPVLLPVAATARTLTTVNGTSKGTFNDLEKLSMGHVEEKNPRLWAFLIAAYWVS  156

Query  648  VVTYFFLW  671
             V+YF LW
Sbjct  157  FVSYFLLW  164



>ref|NP_001058898.1| Os07g0150100 [Oryza sativa Japonica Group]
 dbj|BAC82906.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF20812.1| Os07g0150100 [Oryza sativa Japonica Group]
 gb|AIU34637.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Oryza sativa]
Length=731

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  W+R+AIS+SE D++   GVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWLRQAISASEGDVVAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTT--SNGT----FNELDRLSMGHIGNNSPRLWAFL  626
            VFSG++LLP LLPVAATD ++ L       NG     F EL++L++G++  +S RLWAFL
Sbjct  97   VFSGIVLLPVLLPVAATDDNLNLERAIGLKNGKTPQNFTELEKLALGNVQEHSRRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            ++ YWVS VTYF LW
Sbjct  157  LSVYWVSFVTYFVLW  171



>gb|EAZ02783.1| hypothetical protein OsI_24908 [Oryza sativa Indica Group]
Length=731

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  W+R+AIS+SE D++   GVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWLRQAISASEGDVVAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTT--SNGT----FNELDRLSMGHIGNNSPRLWAFL  626
            VFSG++LLP LLPVAATD ++ L       NG     F EL++L++G++  +S RLWAFL
Sbjct  97   VFSGIVLLPVLLPVAATDDNLNLERAIGLKNGKTPQNFTELEKLALGNVQEHSRRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            ++ YWVS VTYF LW
Sbjct  157  LSVYWVSFVTYFVLW  171



>ref|XP_009398321.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=724

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYP RIL+GLDP+E    +RNP +WI+EA+ +SEAD++  +GVD AVY VFLS+ L ILV
Sbjct  37   YYPGRILRGLDPLEGRTRTRNPLAWIKEAVGASEADVVAAAGVDAAVYLVFLSSVLAILV  96

Query  468  FSGLILLPTLLPVAATDHSVR-LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
            FSG+ILLP LLPVAATD+  +    + S GTF  LD+L+MG++   SPRLWAFL+  +WV
Sbjct  97   FSGIILLPVLLPVAATDNGAQSTTDSNSGGTFKNLDKLAMGNVQEKSPRLWAFLLGVHWV  156

Query  645  SVVTYFFLW  671
            S VTY+ LW
Sbjct  157  SFVTYYVLW  165



>ref|XP_004955452.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Setaria 
italica]
Length=738

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 12/140 (9%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYV-SRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E     SR+P  WIREA+S+SE D+I   GVD AVY VFLS+ L IL
Sbjct  37   YYPSLLLRGLDPWEGRRRGSRSPVGWIREALSASETDVIAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRL-----------NSTTSNGTFNELDRLSMGHIGNNSPR  611
            VFSG++LLP LLPVA TDH++ L           N   S   F +++RL++G++   S R
Sbjct  97   VFSGIVLLPVLLPVAGTDHALDLHAAAGFKPKTDNKDDSAPDFPQMERLALGNVQPKSMR  156

Query  612  LWAFLIATYWVSVVTYFFLW  671
            LWAFL++ YWVS VTYF LW
Sbjct  157  LWAFLLSVYWVSFVTYFILW  176



>gb|EAZ38704.1| hypothetical protein OsJ_23104 [Oryza sativa Japonica Group]
Length=1280

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  W+R+AIS+SE D++   GVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWLRQAISASEGDVVAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTT--SNGT----FNELDRLSMGHIGNNSPRLWAFL  626
            VFSG++LLP LLPVAATD ++ L       NG     F EL++L++G++  +S RLWAFL
Sbjct  97   VFSGIVLLPVLLPVAATDDNLNLERAIGLKNGKTPQNFTELEKLALGNVQEHSRRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            ++ YWVS VTYF LW
Sbjct  157  LSVYWVSFVTYFVLW  171



>gb|EMT14399.1| Putative membrane protein [Aegilops tauschii]
Length=725

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  WIR+A ++SEAD++  SGVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWIRQAFAASEADVVAASGVDAAVYLVFLSSVLAIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             FS ++LLP LLPVA TDH++  ++        + +RL++G++ + S RLWAF+ A YWV
Sbjct  97   AFSAIVLLPVLLPVAGTDHALEDSTGRVPRNVTDFERLALGNVQDRSARLWAFIFAVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFILW  165



>gb|KFK44850.1| hypothetical protein AALP_AA1G310500 [Arabis alpina]
Length=723

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYPNRILK L+P E   ++R+PF+W REA S+ E +++ +SGVDTAVYFVFLST LGI  
Sbjct  37   YYPNRILKDLEPWEGSSLTRSPFAWFREAFSTPEQEVVNVSGVDTAVYFVFLSTVLGIFA  96

Query  468  FSGLILLPTLLPVAATDHSVRLNS-----TTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             SG++LLP LLP+AATD S++ N+     T S GTF++LD LSM ++   S RLW FL A
Sbjct  97   LSGVLLLPVLLPLAATDDSIKSNARNTTDTVSEGTFSQLDNLSMANVTKRSWRLWVFLGA  156

Query  633  TYWVSVVTYFFLW  671
             YWVSVVTYF LW
Sbjct  157  VYWVSVVTYFMLW  169



>dbj|BAJ93282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  WIR+A ++SE D++   G+D AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWIRQAFAASEPDVVAAGGIDAAVYLVFLSSVLAIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
            VFS ++LLP LLPVA TDH++  ++        + +RL++G++ N S RLWAF+ A YWV
Sbjct  97   VFSAIVLLPVLLPVAGTDHALEDSTGRVPPNVTDFERLALGNVKNGSARLWAFIFAVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFILW  165



>ref|NP_001108122.1| early responsive to dehydration protein [Zea mays]
 gb|ABY60425.1| early responsive to dehydration protein [Zea mays]
Length=732

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDP-VENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPN +L+GLDP    G  +R+P  W+R+AIS+SE D++   GVD AVY VFLS+ L IL
Sbjct  37   YYPNLLLRGLDPWAGRGRGTRSPVGWLRDAISASEPDVVAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRL------NSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
            V+SG++LLP LLPVAAT  ++         S  S   F+ ++RL MG++   S RLWAFL
Sbjct  97   VYSGIVLLPVLLPVAATGGALSTIPIPTNKSAQSAQNFSSIERLGMGNVPEKSMRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            ++ YWVS VTYF LW
Sbjct  157  LSVYWVSFVTYFVLW  171



>ref|XP_002461460.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
 gb|EER97981.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
Length=732

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 95/135 (70%), Gaps = 7/135 (5%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPN +L+G+DP E  G  +R+P  WIR+AIS+SE D++   GVD AVY VFLS+ L IL
Sbjct  37   YYPNLLLRGVDPWEGRGRGTRSPVGWIRDAISASEPDVVAAGGVDAAVYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSV------RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
            V+SG++LLP LLPVAAT  ++        NS+ S   F+ ++RL +G++   S RLWAFL
Sbjct  97   VYSGIVLLPVLLPVAATGGALVGIPPNPNNSSESTQDFSAIERLGVGNVPEGSMRLWAFL  156

Query  627  IATYWVSVVTYFFLW  671
            ++ YWVS VTYF LW
Sbjct  157  LSVYWVSFVTYFVLW  171



>ref|NP_001288888.1| CSC1-like protein ERD4 [Brassica rapa]
 gb|ABV89652.1| early-responsive to dehydration 4 [Brassica rapa]
Length=678

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = +3

Query  315  LDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPT  494
            +DP E   ++RNPF+WIREA +S+E D++ +SGVDTAVYFVFLST LGI   S L+LLPT
Sbjct  1    MDPWEGSSLTRNPFAWIREAFTSTEQDVVKLSGVDTAVYFVFLSTVLGIFALSALLLLPT  60

Query  495  LLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYF  662
            LLP++ATD+S++    +  TTSNGTF++LD LSM +I   S RLWAFL A YWVS+VTYF
Sbjct  61   LLPLSATDNSLKTSRNVTDTTSNGTFSQLDNLSMANITRRSSRLWAFLGAVYWVSLVTYF  120

Query  663  FLW  671
             LW
Sbjct  121  MLW  123



>ref|XP_006657447.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Oryza 
brachyantha]
Length=729

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  W+R+A+++SEAD++   GVD AVY VFL + L IL
Sbjct  37   YYPSLLLRGLDPWEGRGRGTRSPAGWLRQALAASEADVVAAGGVDAAVYLVFLYSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDH----SVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
            VFSG++LLP LLPVAATD+    S+ LN+  S   F EL++L++G++   S RLWAFL+A
Sbjct  97   VFSGVVLLPVLLPVAATDNALERSIGLNNGKSPQNFTELEKLALGNVQEGSRRLWAFLLA  156

Query  633  TYWVSVVTYFFLW  671
             YWVS+VTYF LW
Sbjct  157  VYWVSIVTYFVLW  169



>gb|EMT14905.1| Putative membrane protein [Aegilops tauschii]
Length=676

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  WIR+A ++SE D++   GVD AVY VFLS+   IL
Sbjct  37   YYPSLLLRGLDPWEGRGRGTRSPVGWIRQAFTASEPDVVAAGGVDAAVYLVFLSSMFAIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             F+G++LLP LLP+A TD+++  ++          + LS+ +I + S RLWAF+ A YWV
Sbjct  97   AFAGIVLLPVLLPIAGTDNALEDSTGRMPPNVTHFEILSLANIEDRSMRLWAFISAVYWV  156

Query  645  SVVTYFFLW  671
            S VTYF LW
Sbjct  157  SFVTYFILW  165



>ref|XP_009611468.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Nicotiana tomentosiformis]
Length=691

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +3

Query  450  ALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLI  629
            ALGI VFSG+ILLP LLPVA+TDHS++  +TTS GTFNELDRLSMG +GN+ PRLWAF++
Sbjct  59   ALGIFVFSGIILLPVLLPVASTDHSIKAANTTSKGTFNELDRLSMGQVGNSGPRLWAFIV  118

Query  630  ATYWVSVVTYFFLW  671
            ATYWVSVVTY+ LW
Sbjct  119  ATYWVSVVTYYLLW  132



>gb|EMS45497.1| Uncharacterized membrane protein C24H6.13 [Triticum urartu]
Length=729

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  WIR+A ++SEAD++   GVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGRGTRSPVGWIRQAFTASEADVVAAGGVDAAVYLVFLSSVLAIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGT----FNELDRLSMGHIGNNSPRLWAFLIA  632
            V SG++LLP LLP+AATDH++  ++   NG     F  ++RL++G++   S RLWAF+++
Sbjct  97   VVSGIVLLPLLLPLAATDHALENSAGFKNGKEAQNFTIIERLALGNVQKKSMRLWAFILS  156

Query  633  TYWVSVVTYFFLW  671
             YWVS VTY  LW
Sbjct  157  VYWVSFVTYLVLW  169



>ref|XP_003557644.1| PREDICTED: CSC1-like protein ERD4 [Brachypodium distachyon]
Length=729

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 96/133 (72%), Gaps = 5/133 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVE-NGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+ +L+GLDP E  G  +R+P  W+R+A S+ EAD+I   GVD AVY VFLS+ L IL
Sbjct  37   YYPSVLLRGLDPWEGRGKGTRSPVGWVRQAFSAPEADVIAAGGVDAAVYLVFLSSVLAIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGT----FNELDRLSMGHIGNNSPRLWAFLIA  632
            V SG++LLP LLP+AATDH++   S + NG+    F  ++RL++G++   S RLWAF+++
Sbjct  97   VLSGIVLLPVLLPLAATDHALEDPSGSRNGSTSQNFTVIERLALGNVQKKSMRLWAFILS  156

Query  633  TYWVSVVTYFFLW  671
             YWVS VTYF LW
Sbjct  157  VYWVSFVTYFVLW  169



>ref|XP_010687078.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=640

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  435  VFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRL  614
            V +  +L +L  +G++LLP+LLPV+ TDHSVRLNSTTSNGTFNELD+ SMGHIG  S RL
Sbjct  14   VKVPNSLAMLFLAGIVLLPSLLPVSITDHSVRLNSTTSNGTFNELDKFSMGHIGQKSDRL  73

Query  615  WAFLIATYWVSVVTYFFLW  671
            WA+LIA YWVS+VTYF LW
Sbjct  74   WAYLIAVYWVSLVTYFLLW  92



>ref|XP_001776984.1| predicted protein [Physcomitrella patens]
 gb|EDQ58233.1| predicted protein [Physcomitrella patens]
Length=744

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYP R L+G  P       R  F+W +EA  +++ DI+  +G+D  VY    +TAL I+V
Sbjct  38   YYPLRALRGEGPYGK---KRGLFAWAKEAFQATDEDIVAAAGLDAVVYIHLFTTALEIIV  94

Query  468  FSGLILLPTLLPVAAT-DHSVRLNSTTSNGTFNELDRLSMGHIGN-NSPRLWAFLIATYW  641
             S    +P L+P+AAT D++  L  T +N T+++ D L MG+I   +SPRLWAFL+  YW
Sbjct  95   LSAAFCIPILIPIAATSDNNKFLARTQANYTYSDFDNLGMGNIRQASSPRLWAFLLGVYW  154

Query  642  VSVVTYFFLW  671
            VS VTY+ LW
Sbjct  155  VSFVTYYSLW  164



>ref|XP_001766634.1| predicted protein [Physcomitrella patens]
 gb|EDQ68487.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 10/132 (8%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSR-NPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYP+R++ GL P   G+  + NP  W++EAI +SE +++ ++G+D  +Y  F    L I 
Sbjct  38   YYPSRMISGLGP--TGFAKKQNPLEWMKEAIMTSEEELVRIAGLDATIYLNFFVAVLEIF  95

Query  465  VFSGLILLPTLLPVAATDH----SVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIA  632
             +S L  +P L+P+AA  H    + RL+    N T+   D L+MG++   + +LWAFL+ 
Sbjct  96   AYSSLFCIPVLIPIAAKSHHNEEAYRLD---PNQTYAGFDNLAMGNVEEGTTKLWAFLVG  152

Query  633  TYWVSVVTYFFL  668
            TYWVS VTY+ L
Sbjct  153  TYWVSFVTYYVL  164



>ref|XP_006448975.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
 gb|ESR62215.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
Length=424

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +3

Query  453  LGILVFSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
            LGI   SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL
Sbjct  1    LGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFL  60

Query  627  IATYWVSVVTYFFLW  671
            +ATYWVS VTYF LW
Sbjct  61   VATYWVSFVTYFLLW  75



>ref|XP_001766729.1| predicted protein [Physcomitrella patens]
 gb|EDQ68360.1| predicted protein [Physcomitrella patens]
Length=752

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 2/128 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YY  RI  G  P      +RNPF+W+REAI +S+ ++I ++G+D+A+Y  F    L I  
Sbjct  38   YYSARITAGEGPTAAAR-TRNPFAWLREAIFTSDEELIRIAGLDSAIYLNFFVCILEIFG  96

Query  468  FSGLILLPTLLPVAA-TDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
            +S L  +P L+P+AA + ++  + +   N T+   D L+MG++   + +LWAFL+ TYWV
Sbjct  97   YSALFCIPVLVPIAARSRNNEAVFALDPNQTYEGFDNLAMGNVEEGTAKLWAFLVGTYWV  156

Query  645  SVVTYFFL  668
            S VTYF L
Sbjct  157  SFVTYFVL  164



>ref|XP_008657915.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Zea 
mays]
Length=146

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = +3

Query  288  YYPNRILKGLDP-VENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL  464
            YYPN +L+GLDP   +G  +R+P  W+R+AIS+SE D++   GVD   Y VFLS+ L IL
Sbjct  37   YYPNLLLRGLDPWAGHGRGTRSPMGWLRDAISASEPDVVAAGGVDATFYLVFLSSVLSIL  96

Query  465  VFSGLILLPTLLPVAATDHSVRLNSTTSNGT------FNELDRLSMGHI  593
            V+SG++LLP LLPVAAT  ++      +N T      F  ++RL +G++
Sbjct  97   VYSGIVLLPVLLPVAATGGALSTIPIPTNKTAQSAQNFLSIERLGVGNV  145



>ref|XP_006448976.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
 gb|ESR62216.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
Length=635

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +3

Query  453  LGILVFSGLILLPTLLPVAATDHSVRL--NSTTSNGTFNELDRLSMGHIGNNSPRLWAFL  626
            LGI   SG+ILLP LLPVAATD S++    +TTS GTFN+LD+LSMG+I   S RLWAFL
Sbjct  1    LGIFALSGIILLPALLPVAATDDSIQAAGKNTTSIGTFNDLDKLSMGNITAKSSRLWAFL  60

Query  627  IATYWVSVVTYFFLW  671
            +ATYWVS VTYF LW
Sbjct  61   VATYWVSFVTYFLLW  75



>ref|XP_001754029.1| predicted protein [Physcomitrella patens]
 gb|EDQ81351.1| predicted protein [Physcomitrella patens]
Length=751

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 78/128 (61%), Gaps = 2/128 (2%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YY +RI+ G  P      +RNPF+W+ EAI +S+A+++ ++G+D A+Y  F    L I  
Sbjct  38   YYSSRIISGEGPTAAA-STRNPFTWLYEAIFTSDAELVRVAGLDAAIYLNFFVCILEIFG  96

Query  468  FSGLILLPTLLPVAATDHS-VRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
            +S L  +P L+P+AA   S         N T++  D L+MG++   + +LWAFL+ TYWV
Sbjct  97   YSSLFCIPVLIPIAAKSKSNADAFQLDPNMTYDGFDNLAMGNVEEGTKKLWAFLVGTYWV  156

Query  645  SVVTYFFL  668
            S++TY  L
Sbjct  157  SIMTYCVL  164



>ref|XP_001762227.1| predicted protein [Physcomitrella patens]
 gb|EDQ73019.1| predicted protein [Physcomitrella patens]
Length=733

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 8/132 (6%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVS---RNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALG  458
            YYP RIL+G    E+G V+   R PFSWI E+  +++A+I+  +G+D AVY    + A+ 
Sbjct  38   YYPLRILRG----EDGAVAAKRRGPFSWITESYRATDAEIVAAAGLDAAVYIHLFTAAVE  93

Query  459  ILVFSGLILLPTLLPVAAT-DHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIAT  635
            I+  S L  +P L+P+++T  ++ +   TT N T+   D L M ++  NS ++WAFLI  
Sbjct  94   IIGLSALYCIPVLVPLSSTSSYNQQQLRTTGNFTYQNFDNLGMANVEPNSRKIWAFLIGM  153

Query  636  YWVSVVTYFFLW  671
            ++VS+V YF LW
Sbjct  154  FYVSMVVYFVLW  165



>ref|XP_006448973.1| hypothetical protein CICLE_v100144072mg, partial [Citrus clementina]
 ref|XP_006448974.1| hypothetical protein CICLE_v100144072mg, partial [Citrus clementina]
 gb|ESR62213.1| hypothetical protein CICLE_v100144072mg, partial [Citrus clementina]
 gb|ESR62214.1| hypothetical protein CICLE_v100144072mg, partial [Citrus clementina]
Length=90

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLST  449
            YYPNRILKGLDP E G  +RNPF+WI+EA+SSSE D+I MSG+DTAVYFVFLST
Sbjct  37   YYPNRILKGLDPWEGGSRTRNPFTWIKEAMSSSEQDVINMSGLDTAVYFVFLST  90



>ref|XP_001770612.1| predicted protein [Physcomitrella patens]
 gb|EDQ64595.1| predicted protein [Physcomitrella patens]
Length=734

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            YYP R+L+G D           F+W+REA  + E DI+  +G+D AVY    + A  I++
Sbjct  38   YYPLRVLRGEDGPTVAKRRGGAFAWVREAFKAKEDDIVATAGLDAAVYMHLFTAAFQIIL  97

Query  468  FSGLILLPTLLPVAAT-DHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWV  644
             S +  LP LL +A T +++ +      N T+  +D L MG+I   S ++WAF++  +WV
Sbjct  98   ISAIFCLPILLSLAGTSNYNQQQRMMDGNFTYTNIDNLGMGNIEPQSSKIWAFMLGMFWV  157

Query  645  SVVTYFFLW  671
            S+ TY+ LW
Sbjct  158  SLATYYVLW  166



>ref|XP_001761096.1| predicted protein [Physcomitrella patens]
 gb|EDQ74163.1| predicted protein [Physcomitrella patens]
Length=740

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 74/130 (57%), Gaps = 5/130 (4%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            Y+P R L+G  P  N Y    PF W  +A   ++  ++  +G+D  VY    +TAL I V
Sbjct  38   YHPLRALRGEGPFGNKY---GPFQWAIDAFRVTDEQLVAAAGLDAVVYVNLFTTALEITV  94

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFN--ELDRLSMGHIGNNSPRLWAFLIATYW  641
             S +  +  L+P+ AT+++    +   +  FN    D LSM +I + SP++WAFLI  YW
Sbjct  95   LSAVFCIIVLIPICATENNNFEMAKNKSNDFNYSGFDNLSMSNIPSGSPKIWAFLIGVYW  154

Query  642  VSVVTYFFLW  671
            VS+VTY+ LW
Sbjct  155  VSIVTYYSLW  164



>ref|XP_002990725.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
 gb|EFJ08174.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
Length=706

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 78/141 (55%), Gaps = 13/141 (9%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSR--NPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGI  461
            YYP  +++  +   N  V+R   PF W+ EA   +E++I++ +G+D A+Y   L  AL I
Sbjct  37   YYPAVLIREEEGKGNPEVARLRTPFQWLSEAWRVTESEIVSFAGLDAAIYIHLLDAALKI  96

Query  462  LVFSGLILLPTLLPVAA--TDHSVRLNSTT---------SNGTFNELDRLSMGHIGNNSP  608
            L  + L  LP L+ VAA   D++ +   +T         ++ TF+ LD+L+MG+I   + 
Sbjct  97   LSIAALFCLPVLVTVAALSDDYARKARPSTGGSTTATNSTDATFSGLDKLAMGNIPERNS  156

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            ++W F I  YW+S   Y  LW
Sbjct  157  KIWLFAIGAYWLSAAVYIVLW  177



>ref|XP_002986705.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
 gb|EFJ12268.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
Length=706

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 78/141 (55%), Gaps = 13/141 (9%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSR--NPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGI  461
            YYP  +++  +   N  V+R   PF W+ EA   +E++I++ +G+D A+Y   L  AL I
Sbjct  37   YYPAVLIREEEGKGNPEVARLRTPFQWLSEAWRVTESEIVSFAGLDAAIYIHLLDAALKI  96

Query  462  LVFSGLILLPTLLPVAA--TDHSVRLNSTT---------SNGTFNELDRLSMGHIGNNSP  608
            L  + L  LP L+ VAA   D++ +   +T         ++ TF+ L++L+MG+I   + 
Sbjct  97   LSIAALFCLPVLVTVAALSDDYARKARPSTGGSTTATNSTDATFSGLNKLAMGNIPERNA  156

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            ++W F I  YW+S   Y  LW
Sbjct  157  KIWLFAIGAYWLSAAVYIVLW  177



>gb|AGV54580.1| early-responsive to dehydration 4 [Phaseolus vulgaris]
Length=643

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAV  428
            YYPNRILKGLDP+E G  SRNPFSWI+EA+SSSE D++TMSGVDTAV
Sbjct  37   YYPNRILKGLDPLEGGSKSRNPFSWIKEAVSSSERDVVTMSGVDTAV  83



>dbj|BAB63915.1| ERD4 protein [Arabidopsis thaliana]
Length=640

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 4/84 (5%)
 Frame = +3

Query  432  FVFLSTALGILVFSGLILLPTLLPVAATDHSVR----LNSTTSNGTFNELDRLSMGHIGN  599
            FVFLST LGI   S L+LLPTLLP+AATD++++       TTS GTF++LD LSM +I  
Sbjct  1    FVFLSTVLGIFACSSLLLLPTLLPLAATDNNIKNTKNATDTTSKGTFSQLDNLSMANITK  60

Query  600  NSPRLWAFLIATYWVSVVTYFFLW  671
             S RLWAFL A YW+S+VTYFFLW
Sbjct  61   KSSRLWAFLGAVYWISLVTYFFLW  84



>ref|XP_010086875.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB24359.1| Uncharacterized membrane protein [Morus notabilis]
Length=658

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 5/56 (9%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTAL  455
            YYPNRIL+GLDP +NG  S+   SWI  A+SS+E D+I++SGVDTAVYFVFLSTA+
Sbjct  37   YYPNRILRGLDPKDNG--SK---SWIHVALSSTEQDVISISGVDTAVYFVFLSTAV  87



>ref|XP_001754358.1| predicted protein [Physcomitrella patens]
 gb|EDQ80808.1| predicted protein, partial [Physcomitrella patens]
Length=734

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 33/155 (21%)
 Frame = +3

Query  288  YYPNRILKGL------------DPVE-------NGYVSRNPFSWIREAISSSEADIITMS  410
            YYP   +KGL             P+E       N Y     F W++ A+  +E DII  +
Sbjct  38   YYPKLYIKGLRKGRPRATPRQLKPIEKYVNLELNQYTRL--FDWVKSALRKTENDIIQHA  95

Query  411  GVDTAVYFVFLSTALGILVFSGLILLPTLLPV-------AATDHSVRLNSTTSNGTFNEL  569
            G+D+AVY       L I +   ++ +  L+PV       A +   V  N+T +   F+ +
Sbjct  96   GLDSAVYLRIFLVGLKIFIPLMILSMAILVPVNVGAGSLAESGTDVTSNTTDTKFLFSSI  155

Query  570  DRLSMGHIGNNSPR-LWAFLIATY----WVSVVTY  659
            D+LSM ++ N SPR LWA L+ +Y    WV  + +
Sbjct  156  DKLSMSNVPNRSPRWLWAHLVMSYVFTAWVCFILF  190



>ref|XP_001782141.1| predicted protein [Physcomitrella patens]
 gb|EDQ53035.1| predicted protein, partial [Physcomitrella patens]
Length=735

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 72/154 (47%), Gaps = 31/154 (20%)
 Frame = +3

Query  288  YYPNRILKG------------LDPVE---NGYVSR--NPFSWIREAISSSEADIITMSGV  416
            YYP   ++G            L PVE   N  VS       W + A+  +E DII  SG+
Sbjct  38   YYPKLYIRGIRKERPRASPRPLKPVEKYVNLEVSHYMRLLDWAKSALRKTEDDIIQHSGL  97

Query  417  DTAVYFVFLSTALGI----LVFSGLILLPT-----LLPVAATDHSVRLNSTTSNGTFNEL  569
            D+AVY       L I    ++    IL+P       LP   TD+ V  N+T +   F+ +
Sbjct  98   DSAVYLRIFLVGLKIFVPLMILGMAILIPVNVGAGSLPETGTDN-VNANTTDTKFLFSSI  156

Query  570  DRLSMGHIGNNSPRLWAFLIATY----WVSVVTY  659
            D+LSM ++ N S RLWA L+ +Y    WV  + +
Sbjct  157  DKLSMSNVPNGSSRLWAHLVMSYVFTAWVCYILF  190



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 68/141 (48%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +V R             +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRNSPSRSGAFVRRFVNLDSRSYVRFLNWMPAALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++      NGT +++D+LS+ ++ + SP
Sbjct  98   YLRIYLIGLKIFVPIALLAWAILVPVNWTSDHLKFLDQNKNGTSSDIDKLSISNVKDGSP  157

Query  609  RLWAFLIA----TYWVSVVTY  659
            RLW  ++     T+W   V Y
Sbjct  158  RLWTHIVMAYAFTFWTCYVLY  178



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ EAI   E ++I  +G+D+AVY       L I V    +    L+PV  TD +V + 
Sbjct  74   NWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVLVPVNYTDDNVSIA  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
              T+N T +++D+LS+ +I   S R W+ L+  Y  +V T + L
Sbjct  134  VVTANVTASDIDKLSISNIPAKSQRFWSHLVMAYAFTVWTCYVL  177



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ EAI   E ++I  +G+D+AVY       L I V    +    L+PV  TD +V + 
Sbjct  74   NWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVLVPVNYTDDNVSIA  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
              T N T +++D+LS+ +I   S R W+ L+  Y  +V T + L
Sbjct  134  KVTINVTASDIDKLSISNIPAKSQRFWSHLVMAYAFTVWTCYVL  177



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ EAI   E ++I  +G+D+AVY       L I V    +    L+PV  TD +V + 
Sbjct  74   NWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAWAVLVPVNYTDDNVSIA  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
              T N T +++D+LS+ +I   S R W+ L+  Y  +V T + L
Sbjct  134  KVTINVTASDIDKLSISNIPAKSQRFWSHLVMAYAFTVWTCYVL  177



>ref|XP_001757556.1| predicted protein [Physcomitrella patens]
 gb|EDQ77613.1| predicted protein [Physcomitrella patens]
Length=763

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 75/146 (51%), Gaps = 21/146 (14%)
 Frame = +3

Query  288  YYPNRILKGL----DPVENGYVSR----------NPFSWIREAISSSEADIITMSGVDTA  425
            YYP R LKGL    D + N    R          N F WI     ++E + I   G+D+A
Sbjct  39   YYPRRYLKGLVERVDDLVNSEDKRHRGVGWRWCSNLFDWILSTWRTTEMEFIEQYGLDSA  98

Query  426  VYFVFLSTAL-GILVFSGLILLPT--LLPVAATDHSVR-LNSTTSNGTFNELDRLSMGHI  593
            V    L T L G+ +F  L++  +  L+PV  TD  ++   S  SN T++ +D LS+ ++
Sbjct  99   V---LLRTYLFGLKLFVPLMIWGSVVLIPVNTTDTELQNFQSVESNVTYSRVDTLSIANV  155

Query  594  GNNSPRLWAFLIATYWVSVVTYFFLW  671
             + S RLWA L+A+Y  ++ T   L+
Sbjct  156  HDLSERLWAHLLASYLFTIWTIILLY  181



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 67/140 (48%), Gaps = 13/140 (9%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G + R              +W+ EA+   E +++  +G+D AV
Sbjct  38   YFPKWYLKGVRGSPLRSGALVRRVVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T++++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPIAFVALAILVPVNYTNNALEAVKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T + L
Sbjct  158  RFWTHIVMAYAFTFWTCYVL  177



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G  +R              +W+ +A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTSPARGGPFARKFVNLDFRSYIKFLNWMPDALKMPEQELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L + V   L+    L+PV  T++++ L +  +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLLGLKVFVPMALLAWTILVPVNYTNNTLELEAKYNNVTSSDIDKLSISNIPQASN  157

Query  609  RLWAFLIATY  638
            R WA +I  Y
Sbjct  158  RFWAHIIMAY  167



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 37/140 (26%), Positives = 67/140 (48%), Gaps = 13/140 (9%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G + R              +W+ EA+   E +++  +G+D AV
Sbjct  38   YFPKWYLKGVRGSPLRSGALVRRVVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T++++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPIAFVALAILVPVNYTNNALEAVKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T + L
Sbjct  158  RFWTHIVMAYAFTFWTCYVL  177



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 57/95 (60%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A++  E ++I  +G+D+AVY       L I V   L+    L+PV  T++++ +
Sbjct  73   LNWMPAALNMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALVASAILIPVNWTNNTLDI  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
            ++  +N T +++DRLS+ +I +NS RLW  ++  Y
Sbjct  133  DAKINNITSSDIDRLSISNIPDNSERLWTHIVLAY  167



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGVRDSPTRSGAFVRKFVNLDYRSYVRFLNWMPEALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T++++ + +   N T +++DRLS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWAVLVPVNWTNNTLDIAAHLKNVTSSDIDRLSISNIPEKSQ  157

Query  609  RLWAFLIATY  638
            RLW  ++  Y
Sbjct  158  RLWTHIVVAY  167



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYF-VFLSTALGILVFSGLILLP--TLLPVAATDHSV  527
             W+R+A+   E ++I  +G+D+ VY  ++L   LG+ VF  L+LL    L+PV  TD ++
Sbjct  76   DWMRDALRMPEGELIAHAGLDSVVYLRIYL---LGLKVFVPLMLLGFLVLVPVNVTDSNI  132

Query  528  RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
            +       GT  ++D++S+ +I   SPRLWA ++ TY  +  T F L+
Sbjct  133  QTGKIF--GT--DIDKISLTNIREKSPRLWAHVVMTYVFTAWTCFMLF  176



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYF-VFLSTALGILVFSGLILLP--TLLPVAATDHSV  527
             W+R+A+   E ++I  +G+D+ VY  ++L   LG+ VF  L+LL    L+PV  TD ++
Sbjct  76   DWMRDALRMPEGELIAHAGLDSVVYLRIYL---LGLKVFVPLMLLGFLVLVPVNVTDSNI  132

Query  528  RLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
            +       GT  ++D++S+ +I   SPRLWA ++ TY  +  T F L+
Sbjct  133  QTGKIF--GT--DIDKISLTNIREKSPRLWAHVVMTYVFTAWTCFMLF  176



>ref|XP_002986828.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
 gb|EFJ12158.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
Length=657

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 81/142 (57%), Gaps = 21/142 (15%)
 Frame = +3

Query  288  YYPNRILKGLD-----PVENGYVSRNP------FSWIREAISSSEADIITMSGVDTAVYF  434
            YYP   +KG+      P++  +V+ +P        W+ E+I   E ++I  +G+D+A+  
Sbjct  38   YYPKWFIKGVRKSEDRPIKARFVNLDPRAYLHFLDWMWESIRMPELELIDHAGLDSAILL  97

Query  435  -VFLSTALGILVFSGLILLP--TLLPVAATDHSVRLNSTTSNGTFN-ELDRLSMGHIGNN  602
             ++L   LG+ VF  L++L    L+PV ATD ++R    +S   F+ ++D+LS+ ++ + 
Sbjct  98   RIYL---LGLKVFVPLLVLCFLILVPVNATDTNLR---KSSGKLFSADIDKLSVANVQDR  151

Query  603  SPRLWAFLIATYWVSVVTYFFL  668
            S RLWA ++ TY  ++ T + L
Sbjct  152  SDRLWAHMLLTYVFTLWTCYVL  173



>ref|XP_002969287.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
 gb|EFJ29375.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
Length=761

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 81/142 (57%), Gaps = 21/142 (15%)
 Frame = +3

Query  288  YYPNRILKGLD-----PVENGYVSRNP------FSWIREAISSSEADIITMSGVDTAVYF  434
            YYP   +KG+      P++  +V+ +P        W+ E+I   E ++I  +G+D+A+  
Sbjct  38   YYPKWFIKGVRKSEDRPIKARFVNLDPRAYLHFLDWMWESIRMPELELIDHAGLDSAILL  97

Query  435  -VFLSTALGILVFSGLILLP--TLLPVAATDHSVRLNSTTSNGTFN-ELDRLSMGHIGNN  602
             ++L   LG+ VF  L++L    L+PV ATD ++R    +S   F+ ++D+LS+ ++ + 
Sbjct  98   RIYL---LGLKVFVPLLVLCFLILVPVNATDTNLR---KSSGKLFSADIDKLSVANVQDR  151

Query  603  SPRLWAFLIATYWVSVVTYFFL  668
            S RLWA ++ TY  ++ T + L
Sbjct  152  SDRLWAHMLLTYVFTLWTCYVL  173



>ref|XP_010449936.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L A Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWMHLCAAYAITFWTCFIL  176



>ref|XP_010449938.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L A Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWMHLCAAYAITFWTCFIL  176



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 69/130 (53%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  +P ++G +VS+             +W+ +A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSNPAQSGVFVSKFVNLDWRAYIRFLNWVPDALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T++++ ++  T    ++++D+LS+ +I + S 
Sbjct  98   YLRIYLLGLKIFVPVTLLAWAILVPVNWTNNTLAISQATDKVQYSDIDKLSISNIPHGSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+  A+   E ++I  +G+D+AVY       L I V    +    L+PV  T+ ++ L 
Sbjct  74   NWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPITFLAFTILVPVNWTNRTLELE  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
             + SN TF+++D+LS+ +I   S R W  L+  Y  +  T + L
Sbjct  134  LSKSNVTFSDIDKLSISNIPEGSERFWTHLVMAYAFTFWTCYML  177



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 72/139 (52%), Gaps = 17/139 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +VS+             +W+ +A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRGSPSHSGAFVSKFVNIDLVSYTRFLNWVPDALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T++++ ++ T +   ++ +D+LS+ ++ N S 
Sbjct  98   YLRIYLLGLKIFVPVTLLAWAVLVPVNWTNNTLEISQTNNKLQYSNIDKLSISNLPNGSH  157

Query  609  RLWAFLIA----TYWVSVV  653
            R WA ++     T+W+  V
Sbjct  158  RFWAHIVMAYAFTFWICYV  176



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T+H++ L
Sbjct  71   LNWMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAILAWAVLVPVNWTNHTLEL  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                 N T +++D+LS+ +I  +S R WA +I  Y  ++ T + L
Sbjct  131  AKQLKNVTSSDIDKLSVSNIPESSNRFWAHIIMAYAFTIWTCYML  175



>ref|XP_006396699.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38152.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=649

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T+H++ L
Sbjct  71   LNWMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAILAWAVLVPVNWTNHTLEL  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                 N T +++D+LS+ +I  +S R WA +I  Y  ++ T + L
Sbjct  131  AKQLKNVTSSDIDKLSVSNIPESSNRFWAHIIMAYAFTIWTCYML  175



>dbj|BAF02109.1| hypothetical protein [Arabidopsis thaliana]
Length=99

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  523  L*SVAATGRSVGSSIRPEKTNIPKAVERKTK*TAVSTPDIVMISASEEEIASRIHENGFR  344
            L SVAA G  VG   R E+ NIP+ V +KTK TAVSTPD +  S SEE  ASRI   GFR
Sbjct  28   LLSVAARGSRVGRRRRLEQANIPRTVLKKTKWTAVSTPDKLTTSCSEEVKASRIQAKGFR  87

Query  343  ETYPFSTGSNP  311
                 S GS+P
Sbjct  88   VKEVPSHGSSP  98



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (48%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPSRSGAFVRRVVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T++++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPIAFVALAILVPVNYTNNALEAVKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|NP_001154237.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE83603.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34618.1| hyperosmolality-gated Ca2+ permeable channel 1.6 [Arabidopsis 
thaliana]
Length=760

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWVHLCMAYAITFWTCFIL  176



>ref|NP_193278.4| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q8VZM5.1|CSCL3_ARATH RecName: Full=CSC1-like protein At4g15430 [Arabidopsis thaliana]
 gb|AAL36364.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83602.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
Length=761

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWVHLCMAYAITFWTCFIL  176



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWMHLCVAYAITFWTCFIL  176



>ref|XP_010434983.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWMHLCVAYAITFWTCFIL  176



>ref|XP_010440309.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=762

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +   T++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTTMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWMHLCVAYAITFWTCFIL  176



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (51%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +VS+             +W+ E +   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPTHSGVFVSKFVNLDYRSYIRFLNWMPEGLRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    ++PV  TD ++      SN TF+++D+LS+ ++G+ S 
Sbjct  98   YLRIYLLGLKIFVPIMILGFAIIVPVNWTDGTLE----HSNVTFSDIDKLSISNVGDGSK  153

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  S+ T + L
Sbjct  154  RFWTHVVMAYVFSLWTCYVL  173



>ref|XP_010278611.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Nelumbo nucifera]
Length=607

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGLD-------PVENGYVS------RNPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+           N +V+      RN F+W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGMRSRPNCSGAFGNKFVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  TD  +         TF+++D+LS+ ++   S 
Sbjct  98   YIRIYLLGLKIFVPLTVLAFAILVPVNWTDGRL---ENIKGLTFSDIDKLSISNVSTGSK  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R W  L+ +Y  S+ T + L+
Sbjct  155  RFWVHLVMSYIFSIWTCYVLY  175



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (48%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPSRSGAFVRRVVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T++++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPISFLALAILVPVNYTNNALEAVKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGLD-------PVENGYVS------RNPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+           N +V+      RN F+W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGMRSRPNCSGAFGNKFVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  TD  +         TF+++D+LS+ ++   S 
Sbjct  98   YIRIYLLGLKIFVPLTVLAFAILVPVNWTDGRL---ENIKGLTFSDIDKLSISNVSTGSK  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R W  L+ +Y  S+ T + L+
Sbjct  155  RFWVHLVMSYIFSIWTCYVLY  175



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGLDPVEN-------GYVS------RNPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+    N        +V+      RN F+W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGMRSRPNCSGAFGNKFVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  TD  +         TF+++D+LS+ ++   S 
Sbjct  98   YIRIYLLGLKIFVPLTVLAFAILVPVNWTDGRL---ENIKGLTFSDIDKLSISNVSTGSK  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R W  L+ +Y  S+ T + L+
Sbjct  155  RFWVHLVMSYIFSIWTCYVLY  175



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 67/130 (52%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-----YVSRNPFSWIR------EAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G     +V+ N  S++R       A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGIRSSPLHSGALVSKFVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T H ++L +   N T +++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPIALLAWSILVPVNWTSHGLQL-AKLRNVTSSDIDKLSISNIENGSD  156

Query  609  RLWAFLIATY  638
            R W  L+  Y
Sbjct  157  RFWTHLVMAY  166



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 68/140 (49%), Gaps = 14/140 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R              +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRESPTHSGAFVRKFVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ L     N T +++D+LS+ ++ + SP
Sbjct  98   YLRIYLIGLKIFVPIALLAWAVLVPVNYTNITLDLEKI-KNVTSSDIDKLSISNVPDESP  156

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W+ ++  Y  ++ T + L
Sbjct  157  RFWSHIVMAYAFTIWTCYVL  176



>gb|KDO78340.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
 gb|KDO78341.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=505

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ +    SN T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHVVMAY  167



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 62/129 (48%), Gaps = 12/129 (9%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSR----------NPFSWIREAISSSEADIITMSGVDTAVY  431
            Y+P   LKGL   P    +V++             +W+ +AI   E ++I  +G+D+ VY
Sbjct  38   YFPKWYLKGLRGSPRSGTFVAKFVNLDWKSYLRFLNWVPDAIRMPEPELIDHAGLDSVVY  97

Query  432  FVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPR  611
                   L I V   L+    L+PV  T+ ++  ++      ++ +D+LS+ +I N SP+
Sbjct  98   LRIYLLGLKIFVPVALLSWAVLVPVNWTNDALEKSNVADKLQYSNIDKLSISNIPNGSPK  157

Query  612  LWAFLIATY  638
             W  ++  Y
Sbjct  158  FWTHIVMAY  166



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYF-VFLSTALGILVFSGLILL--PTLLPVAATDHSVR  530
            W+ EA+   E ++I  +G+D+ VY  ++L   LG+ +F+ + +L    L+PV  T++++ 
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYL---LGLKIFAPIAILAWAVLVPVHWTNNTLE  131

Query  531  LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            L     N T +++D+LS+ +I  +S R WA ++  Y  ++ T + L
Sbjct  132  LAKHLQNVTSSDIDKLSISNIPQHSLRFWAHIVMAYAFTIWTCYML  177



>gb|KDO78339.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=677

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ +    SN T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHVVMAY  167



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 3/105 (3%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RL  533
            +W+ EA+   E +++  +G+D+ VY       L I      +    ++PV  T+  + RL
Sbjct  74   NWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAFTAMVPVNWTNKGLDRL  133

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN +F+++D+LS+ +I N SPR W  L   Y ++  T F L
Sbjct  134  RH--SNISFSDIDKLSLSNIPNGSPRFWVHLCMAYAITFWTCFIL  176



>ref|XP_006449787.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63027.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=634

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ +    SN T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAIKISNVTASDIDKLSISNVPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHVVMAY  167



>ref|XP_006449786.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63026.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=618

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ +    SN T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAIKISNVTASDIDKLSISNVPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHVVMAY  167



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (47%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P   G   R              +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRDSPTHGGAFVRKFVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T+ ++ +    SN T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALVAWSVLVPVNWTNDTLDVAVKISNVTASDIDKLSISNVPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHVVMAY  167



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYF-VFLSTALGILVFSGLILL--PTLLPVAATDHSVR  530
            W+ EA+   E ++I  +G+D+ VY  ++L   LG+ +F+ + +L    L+PV  T+ ++ 
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYL---LGLKIFAPIAILAWAVLVPVHWTNDTLE  131

Query  531  LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            L     N T +++D+LS+ +I  +S R WA ++  Y  ++ T + L
Sbjct  132  LAKHLKNVTSSDIDKLSISNIPQHSLRFWAHIVMAYAFTIWTCYML  177



>ref|XP_003551746.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Glycine 
max]
 gb|KHN13592.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=713

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 52/104 (50%), Gaps = 3/104 (3%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+R+A  +SE + ++ +G+D  V+      +L I  F G++ L  LLP+  T   +  +S
Sbjct  66   WVRKAWETSEEEFLSTAGLDAFVFMRIFVFSLKIFTFGGIVGLLILLPINCTGSQLHDDS  125

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               N +   LD  S+ ++ N S RLW    A Y  + V    L+
Sbjct  126  DFQNKS---LDSFSISNVNNGSNRLWIHFCAAYVFTGVVCILLY  166



>ref|XP_004293316.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=734

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ EA+   E ++I  +G+D+AVY       L I V    +    L+P+  TD+++ + 
Sbjct  74   NWVPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFVAWVILIPINWTDNTLDIA  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
               +N T   +D+LS+ +I   S RLW  ++  Y
Sbjct  134  GKQANITSTNIDKLSISNIPYRSQRLWTHVVMAY  167



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 63/130 (48%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G + R              +W+ EA+   E +++  +G+D AV
Sbjct  38   YFPKWYLKGVRGSPLRSGALVRRVVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T++++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPLTFLALAILVPVNYTNNALEAVKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 70/140 (50%), Gaps = 16/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-----YVSRNPFSWIR------EAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P+++G     +V+ +  S+IR      +A+   E ++I  +G+D+ V
Sbjct  38   YFPKWYLKGLRSSPIKSGGFASKFVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I      I    ++PV  T+ ++       N TF+++D+LS+ ++ N S 
Sbjct  98   YLRIYLLGLKIFFPIACIAFTVMVPVNWTNTTL---DKLQNLTFSDIDKLSISNVPNGSS  154

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L   Y+++  T F L
Sbjct  155  RFWVHLCMAYFITFWTCFVL  174



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 64/131 (49%), Gaps = 19/131 (15%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNPF------------SWIREAISSSEADIITMSGVDTA  425
            Y+P   LKGL   P+ +G +  N F            +W+  A+   E ++I  +G+D+A
Sbjct  38   YFPKWYLKGLRSSPLHSGTIV-NKFVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSA  96

Query  426  VYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNS  605
            VY       L I V    I    ++PV  T+ ++ L    SN T+++LD+LS+ +I   S
Sbjct  97   VYLRIYLIGLKIFVPIAFIAFSVMVPVNWTNRTLEL----SNLTYSDLDKLSISNIPLGS  152

Query  606  PRLWAFLIATY  638
             R W  L+  Y
Sbjct  153  QRFWTHLVMAY  163



>gb|KIW64298.1| hypothetical protein PV04_09243 [Capronia semiimmersa]
Length=1276

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATD-----  518
            + WI+  IS+S +D +   G+D   +  +L T L I V + L++LP L+P+   D     
Sbjct  79   WKWIKPVISTSNSDFVQKCGLDAYFFLRYLRTLLKIFVPAALVILPILIPLNMVDGRGAQ  138

Query  519  HSVRLNSTTSNGTFNELDRLSMGHIG-NNSPRLWA-FLIATY---WVSVVTY  659
             ++  N   SN T   LD+L+ G++  +++ R WA +L+A +   W+  V++
Sbjct  139  FALGKNENASNVT--GLDQLAWGNVAPDHTGRYWAHWLLALFLIVWICYVSF  188



>ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
Length=618

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 65/140 (46%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R               W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPSGSGAFVRKFVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPIAFLAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIRRGSD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            RLW  ++  Y  +  T++ L
Sbjct  156  RLWTHIVVAYAFTFWTFYVL  175



>ref|XP_011116375.1| hypothetical protein H072_10986 [Dactylellina haptotyla CBS 200.50]
 gb|EPS35608.1| hypothetical protein H072_10986 [Dactylellina haptotyla CBS 200.50]
Length=1212

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/104 (32%), Positives = 52/104 (50%), Gaps = 6/104 (6%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
            F+WI   +++ + + I+ SG+D   +  FL   L I    G+++LP +LP+ AT    + 
Sbjct  140  FAWIPAMLTTRDPEYISKSGLDAFCFLRFLRMMLKICCLQGMLILPIMLPINATGGMDKD  199

Query  534  NSTTSNGTFNELDRLSMGHIGNNSP--RLWAFLIATYWVSVVTY  659
                  G    LDRL  G+I  +    R  A L+A Y + VV Y
Sbjct  200  PEVPVQG----LDRLGWGNISRDKTQRRTAALLMAIYAIGVVLY  239



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +V +             +W+ EA+   E ++I  +G+D+AV
Sbjct  30   YFPKWYLKGLRTSPASSGAFVKKFVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAV  89

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  90   YLRIYLIGLKIFVPITIVAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIALESD  147

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T F L
Sbjct  148  RFWTHIVMAYAFTFWTCFVL  167



>ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
 gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
Length=521

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 65/140 (46%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R               W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPSGSGAFVRKFVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPIAFLAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIRRGSD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            RLW  ++  Y  +  T++ L
Sbjct  156  RLWTHIVVAYAFTFWTFYVL  175



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 65/140 (46%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G   R               W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPSGSGAFVRKFVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPIAFLAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIRRGSD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            RLW  ++  Y  +  T++ L
Sbjct  156  RLWTHIVVAYAFTFWTFYVL  175



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+AVY       L I V    +    L+PV  T+ ++  
Sbjct  73   LNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAILVPVNYTNDTLEA  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
                SN T +++D+LS+ ++   S R WA ++  Y
Sbjct  133  AQLVSNVTASDIDKLSISNVPLKSQRFWAHIVMAY  167



>ref|XP_007045993.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 ref|XP_007045994.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01825.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY01826.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=715

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   SE D+++ SG+D  V+   ++ +L + +F+G+I +  LLPV  T    +LN 
Sbjct  64   WVKRAWKLSEDDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPVNCTGD--QLND  121

Query  540  TT-SNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               ++ + N LD  ++ ++ + S RLWA   A Y V+    + L+
Sbjct  122  IDFADLSNNSLDLFTISNLESGSKRLWAHFSAVYLVTAFVCYLLY  166



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ EA+   E ++I  +G+D+AVY       L I V    +    L+PV  T+ ++   
Sbjct  74   NWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAILVPVNYTNDTLEAA  133

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
               SN T +++D+LS+ ++   S R WA ++  Y
Sbjct  134  QLVSNVTASDIDKLSISNVPLKSQRFWAHIVMAY  167



>ref|XP_002529341.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33058.1| conserved hypothetical protein [Ricinus communis]
Length=726

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY     T L I V    +    L+PV  T+ +++ 
Sbjct  73   LNWMPAALQMPEPELIDHAGLDSAVYLRIYLTGLKIFVPIAFVAFTVLVPVNWTNSTLK-  131

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                SN T+++LD+LS+ +I   S R W  L+  Y  S  T + L
Sbjct  132  ---RSNLTYSDLDKLSISNIPMGSSRFWTHLVMAYAFSFWTCYVL  173



>ref|XP_007760845.1| hypothetical protein A1O7_08665 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ55735.1| hypothetical protein A1O7_08665 [Cladophialophora yegresii CBS 
114405]
Length=1281

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATD-----  518
            ++WI+  +S+S +D +   G+D   +  +L T L I V + L++LP L+P+   D     
Sbjct  79   WAWIKPVVSTSNSDFVQKCGLDAYFFLRYLRTLLKIFVPAALVILPILIPLNMVDGRGAR  138

Query  519  HSVRLNSTTSNGTFNELDRLSMGHIG-NNSPRLWA-FLIATY---WVSVVTY  659
             ++  N   SN T   LD+L+ G++  +++ R WA +L+A +   W+  V++
Sbjct  139  FALGRNENASNVT--GLDQLAWGNVAPDHTGRYWAHWLLALFLIVWICYVSF  188



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 14/140 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  DPV  G   R              +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTDPVHGGAFVRKFVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV +T   +   +   N T +++D+LS+ ++ + S 
Sbjct  98   YLRIYLIGLKIFVPIAFLAWAVLVPVNSTSTGLE-GAKLDNITSSDIDKLSISNVHSESQ  156

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R WA ++  Y  +  T + L
Sbjct  157  RFWAHIVVAYAFTFWTCYIL  176



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 70/141 (50%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G +V +             +W+  A+   E ++I  +G+D+A 
Sbjct  38   YFPKWYLKGIRGSPTSSGAFVKKFVNLDAKTYIKFLNWMPAALRMPEPELIDHAGLDSAA  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T +++     T   TF+++D+LS+ +I + SP
Sbjct  98   YIRIYILGLKIFVPITALALIVLVPVNYTGNTL---GKTREVTFSDIDKLSISNIPSGSP  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            + WA ++ +Y  S  T F L+
Sbjct  155  KFWAHMVMSYVFSFWTCFVLY  175



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   PV +G +V++             +WI  A+   EA++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPVTSGAFVTKIANFDFGSYLRFLNWIPAALKMPEAELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++L +   N T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALLSWSVLVPVNWTSDGLQL-AQLRNVTSSDIDKLSISNVEYGSD  156

Query  609  RLWAFLIATY  638
            R WA L+  Y
Sbjct  157  RFWAHLVMEY  166



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 17/130 (13%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-----YVSRNPFSWIR------EAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P+++G     +V+ +  S++R       A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPLQSGAFVHKFVNLDFHSYLRFLNWMPAAMRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y     T L I V   +I    ++PV  T+ ++      SN TF+ +D+LS+ +I + S 
Sbjct  98   YLRIYLTGLKIFVPIAVIAFTVMVPVNWTNSTLE----HSNLTFSNIDKLSISNIPHGSK  153

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  154  RFWTHIVMAY  163



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+AVY       L I V    +    L+PV  T+ ++  
Sbjct  73   LNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAWAILVPVNYTNDTLEK  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
                SN T +++D+LS+ ++   S R WA ++  Y
Sbjct  133  AQLVSNVTASDIDKLSISNVPLKSQRFWAHIVMAY  167



>emb|CEI90788.1| hypothetical protein RMCBS344292_05099 [Rhizopus microsporus]
Length=1210

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (52%), Gaps = 10/127 (8%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            + P + +K   P E   +S + F WI   + +S  +++   G+D  +   FL  A+ I  
Sbjct  115  FAPRKNMKRHKPPE---LSNSFFGWIIPVLKASTEEMLLNVGLDAVLMLHFLVMAMKIFG  171

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
               +     L+P++AT       +  +  + ++++++S+ H  +   RL AFL+ TY+V+
Sbjct  172  LCSIFGAIILIPISAT-------AKNNEKSMSDIEKISITHTEDGDLRLIAFLVFTYFVT  224

Query  648  VVTYFFL  668
            +VT ++L
Sbjct  225  IVTLYYL  231



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 17/130 (13%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P+ NG +VS+             +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRCSPLANGAFVSKFVNLDFRSYARFLNWMPAALQMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    ++PV  T++++      S  TF+++D+LS+ +I N S 
Sbjct  98   YLRIYLLGLKIFVPIAFLAFTIMVPVNWTNNTLE----HSGLTFSDIDKLSISNIPNGSL  153

Query  609  RLWAFLIATY  638
            R W  L+  Y
Sbjct  154  RFWTHLVMAY  163



>emb|CEG80743.1| hypothetical protein RMATCC62417_15039 [Rhizopus microsporus]
Length=1821

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (52%), Gaps = 10/127 (8%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            + P + +K   P E   +S + F WI   + +S  +++   G+D  +   FL  A+ I  
Sbjct  115  FAPRKNMKRHKPPE---LSNSFFGWIIPVLKASTEEMLLNVGLDAVLMLHFLVMAMKIFG  171

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
               +  +  L+P++AT       +  +  + ++++++S+ H  +   RL AFL+ TY+V+
Sbjct  172  LCSIFGVIILIPISAT-------AKNNEKSMSDIEKISITHTEDGDLRLIAFLVFTYFVT  224

Query  648  VVTYFFL  668
            +VT + L
Sbjct  225  IVTLYHL  231



>ref|XP_007139547.1| hypothetical protein PHAVU_008G039200g [Phaseolus vulgaris]
 gb|ESW11541.1| hypothetical protein PHAVU_008G039200g [Phaseolus vulgaris]
Length=714

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 50/104 (48%), Gaps = 3/104 (3%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W REA  ++E + ++ +G+D  V+      +L I  F G++ L  LLP+      +R  S
Sbjct  64   WAREAWETTEEEFLSTAGLDAFVFMRIFVFSLKIFTFGGIVGLLILLPINCMGSQLRDES  123

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               N +   LD  S+ ++ N S RLW    A Y  + V    L+
Sbjct  124  DFQNKS---LDSFSISNVNNGSNRLWIHFCAAYVFTGVVCILLY  164



>emb|CEG70654.1| hypothetical protein RMATCC62417_06513 [Rhizopus microsporus]
Length=1212

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (52%), Gaps = 10/127 (8%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            + P + +K   P E   +S + F WI   + +S  +++   G+D  +   FL  A+ I  
Sbjct  115  FAPRKNMKRHKPPE---LSNSFFGWIIPVLKASTEEMLLNVGLDAVLMLHFLVMAMKIFG  171

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
               +     L+P++AT       +  +  + ++++++S+ H  +   RL AFL+ TY+V+
Sbjct  172  LCSIFGAIILIPISAT-------AKNNEKSMSDIEKISITHTEDGDLRLIAFLVFTYFVT  224

Query  648  VVTYFFL  668
            +VT ++L
Sbjct  225  IVTLYYL  231



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   PV +G +V++             +WI  A+   EA++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPVTSGAFVTKIANFDFGSYLRFLNWIPAALKMPEAELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++L +   N T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALLSWSVLVPVNWTSDGLQL-AQLRNVTSSDIDKLSISNVEYGSD  156

Query  609  RLWAFLIATY  638
            R WA L+  Y
Sbjct  157  RFWAHLVMEY  166



>ref|XP_003009380.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102]
 gb|EEY14954.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102]
Length=336

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 58/126 (46%), Gaps = 18/126 (14%)
 Frame = +3

Query  345  RNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPV-----A  509
            RNP   I+   + S+ DII   G+D   +  FL T L I V    IL+P L+P+      
Sbjct  71   RNPVQLIKTLWTFSDRDIIRRCGLDAYFFLRFLKTLLIIFVPMMCILIPILVPINYIGGE  130

Query  510  ATD----HSVRLNSTTSN----GTFNELDRLSMGHIG-NNSPRLWAFLIATY----WVSV  650
              D         NST+SN    G    LD L+M +I   NS R WA LI       WV V
Sbjct  131  GQDVIGGRPKGQNSTSSNNRQTGPPRGLDTLTMSNISRENSSRYWAHLIMAILVISWVCV  190

Query  651  VTYFFL  668
            V YF L
Sbjct  191  VFYFEL  196



>ref|XP_010044468.1| PREDICTED: CSC1-like protein At1g69450 [Eucalyptus grandis]
Length=716

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+++A   SE +++++SG+D  V+   +  +L +  F+G+I +  LLP+  T   +  + 
Sbjct  64   WVKKAWKLSEEELLSISGLDAVVFMRIIIFSLRVFAFAGVIGVFILLPLNCTGDQLE-DI  122

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               + + N LD  ++ ++ N S RLW    A Y V++   F L+
Sbjct  123  DFVDFSNNSLDVFTISNVNNGSNRLWVHFCAVYVVTIFVCFLLY  166



>ref|XP_010108715.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXC20026.1| Uncharacterized membrane protein [Morus notabilis]
Length=717

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A S SE D++  SG+D  V+   ++ +L + VF+G+I +  LLPV  +   +  N 
Sbjct  64   WLKNAWSLSEDDLLASSGLDAVVFMRVITFSLKVFVFAGIIGIFVLLPVNCSGDKLD-NI  122

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               N + N LD  ++ ++   S  LW    A Y V++   + L+
Sbjct  123  DLDNLSNNSLDVFTISNVNKGSKSLWIHFSAVYVVTIFVCYLLY  166



>gb|KJB80261.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=645

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   SE D+++ SG+D  V+   ++ +L + +F+G+I +  LLPV  +   +  + 
Sbjct  64   WVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPVNCSGDQLH-DI  122

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
              ++ + N LD  ++ ++ + S RLWA   A Y V+    + L+
Sbjct  123  DFADLSNNSLDVFTISNLSSGSKRLWAHFSAVYLVTAFVCYLLY  166



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G + +              +W+  A+   E ++I  +G+D+A 
Sbjct  38   YFPKWYLKGIRGSPTSSGALVKKFVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAA  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T +++     T   TF+ +D+LS+ +I + SP
Sbjct  98   YIRIYILGLKIFVPITALALIVLVPVNYTGNTL---GKTREVTFSNIDKLSISNIPSGSP  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            + WA ++ +Y  S  T F L+
Sbjct  155  KFWAHMVMSYVFSFWTCFVLY  175



>emb|CEI96129.1| hypothetical protein RMCBS344292_10297 [Rhizopus microsporus]
Length=1214

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (52%), Gaps = 10/127 (8%)
 Frame = +3

Query  288  YYPNRILKGLDPVENGYVSRNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILV  467
            + P + +K   P E   +S + F WI   + +S  +++   G+D  +   FL  A+ I  
Sbjct  115  FAPRKNMKRHKPPE---LSNSFFGWIIPVLKASTEEMLLNVGLDAVLMLHFLVMAMKIFG  171

Query  468  FSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVS  647
               +     L+P++AT       +  +  + ++++++S+ H  +   RL AFL+ TY+V+
Sbjct  172  LCSVFGAIILIPISAT-------AKNNEKSMSDIEKISITHTEDGDLRLIAFLVFTYFVT  224

Query  648  VVTYFFL  668
            +VT ++L
Sbjct  225  IVTLYYL  231



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 69/140 (49%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P++ G +VS+             SW+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPLQAGIFVSKFVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    ++PV  T+ ++      SN T++++D+LS+ +I   S 
Sbjct  98   YLRIYLLGLKIFVPIAVLAFSVMVPVNWTNSTLE----RSNLTYSQIDKLSISNIPTGSN  153

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L+  Y  +  T + L
Sbjct  154  RFWTHLVMAYAFTFWTCYIL  173



>ref|XP_008234908.1| PREDICTED: uncharacterized protein RSN1 isoform X2 [Prunus mume]
Length=749

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G + +              +W+  A+   E ++I  +G+D+A 
Sbjct  38   YFPKWYLKGIRGSPTSSGALVKKFVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAA  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    + L  L+PV  T +++     T   TF+ +D+LS+ +I + SP
Sbjct  98   YIRIYILGLKIFVPITALALIVLVPVNYTGNTL---GKTREVTFSNIDKLSISNIPSGSP  154

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            + WA ++ +Y  S  T F L+
Sbjct  155  KFWAHMVMSYVFSFWTCFVLY  175



>gb|KJB80259.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80262.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80263.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80264.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80265.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80266.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
 gb|KJB80267.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=715

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   SE D+++ SG+D  V+   ++ +L + +F+G+I +  LLPV  +   +  + 
Sbjct  64   WVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPVNCSGDQLH-DI  122

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
              ++ + N LD  ++ ++ + S RLWA   A Y V+    + L+
Sbjct  123  DFADLSNNSLDVFTISNLSSGSKRLWAHFSAVYLVTAFVCYLLY  166



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 69/140 (49%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P++ G +VS+             SW+  A+   E ++I  +G+D+AV
Sbjct  40   YFPKWYLKGLRSSPLQAGIFVSKFVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAV  99

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    ++PV  T+ ++      SN T++++D+LS+ +I   S 
Sbjct  100  YLRIYLLGLKIFVPIAVLAFSVMVPVNWTNSTLE----RSNLTYSQIDKLSISNIPTGSN  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L+  Y  +  T + L
Sbjct  156  RFWTHLVMAYAFTFWTCYIL  175



>ref|XP_008730175.1| hypothetical protein G647_07640 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21294.1| hypothetical protein G647_07640 [Cladophialophora carrionii CBS 
160.54]
Length=1278

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 62/112 (55%), Gaps = 12/112 (11%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATD-----  518
            + WI+  +S+S +D +   G+D   +  +L T L I V + L++LP L+P+   D     
Sbjct  79   WKWIKPVVSTSNSDFVQKCGLDAYFFLRYLRTLLKIFVPAALVILPILIPLNMVDGRGAR  138

Query  519  HSVRLNSTTSNGTFNELDRLSMGHIG-NNSPRLWA-FLIATY---WVSVVTY  659
             ++  N   SN T   LD+L+ G++  +++ R WA +L+A +   W+  V++
Sbjct  139  FALGRNENASNVT--GLDQLAWGNVAPDHTGRYWAHWLLALFLIVWICYVSF  188



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+ VY       L I     L+    L+PV  T+++++L
Sbjct  73   LNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIALVAWAILVPVNWTNNTLQL  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                 N T +++D+LS+ +I   S R W  ++  Y  +  T + L
Sbjct  133  AKELKNVTSSDIDKLSISNIAEGSDRFWTHIVMAYAFTFWTCYML  177



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 69/140 (49%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P++ G +VS+          +  SW+  A+   E ++I  +G+D+AV
Sbjct  40   YFPKWYLKGLRSSPLQAGLFVSKFVNLDFKSYISFLSWMPSALQMPEPELIDHAGLDSAV  99

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            +       L I V    +    ++PV  T+ ++      SN T++E+D+LS+ +I   S 
Sbjct  100  FLRIYLLGLKIFVPIAFLAFSVMVPVNWTNSTLE----RSNLTYSEIDKLSISNIPTGSN  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L+  Y  +  T + L
Sbjct  156  RFWTHLVMAYAFTFWTCYIL  175



>gb|KJB80260.1| hypothetical protein B456_013G089300 [Gossypium raimondii]
Length=673

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   SE D+++ SG+D  V+   ++ +L + +F+G+I +  LLPV  +   +  + 
Sbjct  64   WVKRAWKLSEEDLLSTSGLDAVVFMRVITFSLRVFLFAGVIGIFVLLPVNCSGDQLH-DI  122

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
              ++ + N LD  ++ ++ + S RLWA   A Y V+    + L+
Sbjct  123  DFADLSNNSLDVFTISNLSSGSKRLWAHFSAVYLVTAFVCYLLY  166



>ref|XP_001770572.1| predicted protein [Physcomitrella patens]
 gb|EDQ64555.1| predicted protein, partial [Physcomitrella patens]
Length=732

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 63/112 (56%), Gaps = 11/112 (10%)
 Frame = +3

Query  348  NPFSWIREAISSSEADIITMSGVDTAVYF-VFLSTALGILVFSGLIL--LPTLLPVAATD  518
            N F+WI  ++  +E ++I + G+D+ V+  +FL    G+ VF  ++L     L+PV  TD
Sbjct  80   NGFNWIWFSLRKTEEELIELVGLDSTVFVRIFL---FGLKVFVPMLLWGCAVLIPVNKTD  136

Query  519  HSVR-LNSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY----WVSVVTY  659
              ++ L     N T+   + LS+ ++ +++ RLWA L+A+Y    W  ++ Y
Sbjct  137  GYLKVLQEQHQNLTYGAPESLSIANVEDSAKRLWAHLVASYLFTGWTCLMLY  188



>ref|XP_008339854.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=717

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   +E D+++ SG+D  V+   ++ +L + +F+G+I +  LLPV  + + +    
Sbjct  64   WVKRAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFMFAGVIGIFVLLPVNCSGNQLEYXD  123

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
             T     N LD  ++ ++ N S +LW    A Y V++     L+
Sbjct  124  FTDLSN-NSLDVFTISNVNNGSSKLWIHFAAVYLVTIFVCCLLY  166



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 65/130 (50%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  +PV +G +VS+             +WI  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSNPVTSGAFVSKIVNFDFRSYIRFLNWIPGALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++L +   N T + +D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALLSWSILVPVNWTSDGLQL-AKIRNVTSSNIDKLSISNVERGSD  156

Query  609  RLWAFLIATY  638
            R WA L+  Y
Sbjct  157  RFWAHLVMEY  166



>ref|XP_009650349.1| hypothetical protein VDAG_00677 [Verticillium dahliae VdLs.17]
 gb|EGY13995.1| hypothetical protein VDAG_00677 [Verticillium dahliae VdLs.17]
Length=1260

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 57/126 (45%), Gaps = 18/126 (14%)
 Frame = +3

Query  345  RNPFSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHS  524
            RNP   I+   + S+ DII   G+D   +  FL T L I V    +L+P L+P+      
Sbjct  68   RNPVQLIKTLWTFSDRDIIRRCGLDAYFFLRFLKTLLIIFVPMMCVLIPILVPINYIGGE  127

Query  525  VR---------LNSTTSN----GTFNELDRLSMGHIG-NNSPRLWAFLIATY----WVSV  650
             +          NST+ N    G    LD L+M ++   NS R WA LI       WV V
Sbjct  128  GQDVIGGRPRGQNSTSGNNRQAGPPRGLDTLTMSNVSRENSSRYWAHLIMAILVISWVCV  187

Query  651  VTYFFL  668
            V YF L
Sbjct  188  VFYFEL  193



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 66/130 (51%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P+ +G +VS+             +W+ +A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPMHSGSFVSKFVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I +   L+    L+PV  T++++  +  T    F+++D+LS+ ++   S 
Sbjct  98   YLRIYLLGLKIFIPIALLSWAILVPVNWTNNTLAKSEATDKLQFSDIDKLSISNVPYGSL  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L + V   ++    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVLVPVNWTGGTL--  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                 + TF+ +D+LS+ ++   SPR WA LI TY  S+ T + L+
Sbjct  131  -ENIKDLTFSNVDKLSISNVPPGSPRFWAHLIMTYVFSIWTCYTLY  175



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L + V   ++    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVLVPVNWTGGTL--  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                 + TF+ +D+LS+ ++   SPR WA LI TY  S+ T + L+
Sbjct  131  -ENIKDLTFSNVDKLSISNVPPGSPRFWAHLIMTYVFSIWTCYTLY  175



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L + V   ++    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAFGVLVPVNWTGGTL--  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                 + TF+ +D+LS+ ++   SPR WA LI TY  S+ T + L+
Sbjct  131  -ENIKDLTFSNVDKLSISNVPPGSPRFWAHLIMTYVFSIWTCYTLY  175



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L I V   L+    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFSVLVPVNWTSGTLEN  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                S   ++E+D+LS+ ++G  S R WA +  +Y  +  T+F L+
Sbjct  133  EKGLS---YDEIDKLSISNLGKGSKRFWAHIAMSYVFTFWTFFVLY  175



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T++++ L +
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAILAWAVLVPVHWTNNTLELAN  134

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
               + T +++D+LS+ +I  +SPR W+ ++  Y  ++ T + L
Sbjct  135  HLKHVTSSDIDKLSISNIPLSSPRFWSHIVMAYAFTIWTCYML  177



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ +A+   E ++I  +G+D+AVY       L I V   ++    L+PV  T++++  
Sbjct  73   LNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAWVVLVPVNYTNNALEA  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
                +N T +++D+LS+ ++   S R WA ++  Y
Sbjct  133  EKMAANVTASDIDKLSISNVPLKSQRFWAHIVMAY  167



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 60/130 (46%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  DPV  G   R              +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTDPVHGGAFMRKIVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV  T   +  N+   N T +++D++S+ ++   S 
Sbjct  98   YLRIYLLGLKIFVPIAFLAWAVLVPVNWTSSGLE-NAGIKNITSSDIDKISISNVQRGSE  156

Query  609  RLWAFLIATY  638
            R W+ ++  Y
Sbjct  157  RFWSHIVVAY  166



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 14/140 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  DPV  G   R              +W+  A+   E ++I  +G+D+ V
Sbjct  38   YFPKWYLKGLRTDPVHGGAFVRKFVNLDWRSYLRFLNWMPAALRMPEPELIDHAGLDSVV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV AT   +  ++   N T +++D+LS+ ++ + S 
Sbjct  98   YLRIYLIGLKIFVPIAFLAWAVLVPVNATSTGLE-SAGRDNITSSDIDKLSISNVHSRSE  156

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R WA ++  Y  +  T + L
Sbjct  157  RFWAHILVAYAFTFWTCYIL  176



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSRNP----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   PV +G +V++             +WI  A+   EA++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPVTSGAFVTKVANFDFGSYIRFLNWIPAALKMPEAELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++L +   N T +++D+LS+ ++   S 
Sbjct  98   YLRIYLIGLKIFVPIALLSWSILVPVNWTSDGLQL-AQLRNVTSSDIDKLSISNVIYGSD  156

Query  609  RLWAFLIATY  638
            R WA L+  Y
Sbjct  157  RFWAHLVMEY  166



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 8/105 (8%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+  A+   E ++I  +G+D+AVY       L I V   ++    L+PV  T      NS
Sbjct  75   WMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAFAVLVPVNWT------NS  128

Query  540  TTSNGT--FNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            T  N    ++++D+LS+ +I N S R WA L+  Y  S  T + L
Sbjct  129  TLENSKVVYSDIDKLSISNIPNESQRFWAHLVMAYVFSFWTCYVL  173



>gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=612

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +V +             +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTSPASSGAFVKKFVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPITIVAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIALESD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T F L
Sbjct  156  RFWTHIVMAYAFTFWTCFVL  175



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ +A+   E ++I  +G+D+AVY       L I V   L+    L+PV  T+ ++R 
Sbjct  73   LNWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFVPITLLAFTVLVPVHWTNSTLR-  131

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
                S  T++++D+LS+ ++   S R W  +I  Y ++V T + L
Sbjct  132  ---KSGFTYSDVDKLSISNVPLGSQRFWTHIIMAYAITVWTCYVL  173



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 63/131 (48%), Gaps = 19/131 (15%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNPF------------SWIREAISSSEADIITMSGVDTA  425
            Y+P   LKGL   P+ +G +  N F            +W+  A+   E ++I  +G+D+A
Sbjct  38   YFPKWYLKGLRSSPLHSGTIV-NKFVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSA  96

Query  426  VYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNS  605
            VY       L I V    I    ++PV  T+ ++      SN T+++LD+LS+ +I   S
Sbjct  97   VYLRIYLIGLKIFVPIAFIAFSVMVPVNWTNRTLE----HSNLTYSDLDKLSISNIPLGS  152

Query  606  PRLWAFLIATY  638
             R W  L+  Y
Sbjct  153  QRFWTHLVMAY  163



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L I V   L+    L+PV  +  S+  
Sbjct  73   LNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLALLSFAVLVPVNWSGKSL--  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
               T   TF+ +D+LS+ ++ + S R WA L+  Y V+  T + L+
Sbjct  131  -EKTEGLTFSAIDKLSISNVPDASKRFWAHLVVAYVVTFWTCYVLY  175



>ref|XP_002955034.1| ERD4-related membrane protein [Volvox carteri f. nagariensis]
 gb|EFJ43788.1| ERD4-related membrane protein [Volvox carteri f. nagariensis]
Length=1172

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 16/121 (13%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGIL----VFSGLILLP---------T  494
             SWI   I+  E DII  +G+D A+Y   L   + +     +F  +++LP          
Sbjct  20   LSWIYPVITYPEGDIIDEAGLDCAMYLRILRFGVYLFFPLTIFCIIVVLPPNMKSNGIEA  79

Query  495  LLPVAATDHSVRLNSTTSNG--TFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            +L   A  ++ + N T+  G   F++ D  S+ ++   SP++WA L A Y V + T + L
Sbjct  80   ILAEQALRNAGK-NQTSGKGDLEFSDFDHYSLSNVEAASPKMWAHLFAVYCVVLYTLWLL  138

Query  669  W  671
            W
Sbjct  139  W  139



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (49%), Gaps = 14/131 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   PV  G V                +W+ +A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRSSPVNAGSVVGKFVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RLNSTTSNGTFNELDRLSMGHIGNNS  605
            Y       L I V   L+    L+PV  T++++ +  +   N  ++++D+LS+ ++   S
Sbjct  98   YLRIYLLGLKIFVPVALLSWAVLVPVNWTNNTLAKSQAADHNLQYSDIDKLSISNVPFGS  157

Query  606  PRLWAFLIATY  638
            PR W  ++  Y
Sbjct  158  PRFWTHIVMAY  168



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 68/140 (49%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P+ +G +V R             +W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRNSPLSSGVFVKRFVNLDFRSYLRFLNWMLAALQMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y     T L I V   L+    ++PV  ++ ++      S  T++ +D+LS+ ++   SP
Sbjct  98   YLRIYWTGLKIFVPIALLAFSIMVPVNWSNGTLE----HSGLTYSNIDKLSISNVPTGSP  153

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L+  Y  S  T + L
Sbjct  154  RFWTHLVMAYVFSFWTCYVL  173



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 66/130 (51%), Gaps = 14/130 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-----YVSRNPFSWIR------EAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G     +V+ N  S++R       A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGIRSSPLHSGALVSKFVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   L+    L+PV  T   ++L +   N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPIALLAWSILVPVNWTSEGLQL-AKLRNVTSSDIDKLSISNIERGSD  156

Query  609  RLWAFLIATY  638
            R WA L+  Y
Sbjct  157  RFWAHLVMAY  166



>ref|XP_004962175.1| PREDICTED: uncharacterized protein RSN1-like [Setaria italica]
Length=767

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L I V   L+    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPITLLAFAVLVPVNWTSGTL--  130

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
              +    +++++D+LS+ ++G  S R WA +   Y  ++ T+F L+
Sbjct  131  -ESEKGLSYDQIDKLSISNLGKGSKRFWAHIAMCYVFTIWTFFVLF  175



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 14/140 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL  DPV  G   R              +W+  A+   E ++I  +G+D+ V
Sbjct  38   YFPKWYLKGLRTDPVHGGAFVRKFVNLDWRSYLRFLNWMPAALRMPELELIDHAGLDSVV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV AT   +  ++   N T +++D+LS+ ++ + S 
Sbjct  98   YLRIYLVGLKIFVPIAFLAWAVLVPVNATSTGLE-SAGLDNITSSDIDKLSISNVHSTSE  156

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R WA ++  Y  +  T + L
Sbjct  157  RFWAHILVAYAFTFWTCYIL  176



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T++ + L  
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAMLAWAILVPVNWTNNELELAK  134

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
               N T +++D+L++ +I  +S R WA ++  Y  ++ T + L
Sbjct  135  HLKNVTSSDIDKLTISNIPESSHRFWAHIVMAYAFTIWTCYML  177



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ +A+   E ++I  +G+D+AVY       L I V   ++    L+PV  T+ ++  
Sbjct  73   LNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAWVVLVPVNYTNDALEA  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
                +N T +++D+LS+ ++   S R WA ++  Y
Sbjct  133  EKMAANVTASDIDKLSISNVPLKSQRFWAHIVMAY  167



>gb|KIV93973.1| hypothetical protein PV10_05141 [Exophiala mesophila]
Length=1285

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 12/111 (11%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPV-----AATDH  521
            +WI   IS+S ++ +   G+D   +  +L T L I V + L++LP L+P+       TD+
Sbjct  81   AWIAPVISTSNSEFVQKCGLDAYFFLRYLRTLLKIFVPAALVILPILIPINLVNGRGTDY  140

Query  522  SVRLNSTTSNGTFNELDRLSMGHIG-NNSPRLWAF----LIATYWVSVVTY  659
            +V     TSN T   LD+L+ G++  N++ R WA     L    W+S V +
Sbjct  141  AVGGQENTSNVTG--LDQLAWGNVAPNHTGRYWAHWILALALVIWISFVAF  189



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 57/104 (55%), Gaps = 4/104 (4%)
 Frame = +3

Query  357  SWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLN  536
            +W+ +A+   E ++I  +G+D+AVY       L I +   L+    L+PV  T+ ++R  
Sbjct  74   NWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAFTVLVPVHWTNSTLR--  131

Query  537  STTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
               S  T++++D+LS+ ++   S R W  +I  Y ++V T + L
Sbjct  132  --KSRFTYSDVDKLSISNVPLGSQRFWTHIIMAYAITVWTCYVL  173



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +V +             +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTSPASSGAFVKKFVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPITIVAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIALESD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T F L
Sbjct  156  RFWTHIVMAYAFTFWTCFVL  175



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 15/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENG-YVSR----------NPFSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P  +G +V +             +W+ EA+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGLRTSPASSGAFVKKFVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++ L     N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFVPITIVAWAVLVPVNYTNKTLELQ--LKNVTSSDIDKLSISNIALESD  155

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  ++  Y  +  T F L
Sbjct  156  RFWTHIVMAYAFTFWTCFVL  175



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T++ + L  
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAMLAWAVLVPVNWTNNELELAK  134

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
               N T +++D+L++ +I   S R WA +I  Y  ++ T + L
Sbjct  135  HFKNVTSSDIDKLTISNIPEGSNRFWAHIIMAYAFTIWTCYML  177



>ref|XP_002960116.1| hypothetical protein SELMODRAFT_450821 [Selaginella moellendorffii]
 gb|EFJ37655.1| hypothetical protein SELMODRAFT_450821 [Selaginella moellendorffii]
Length=723

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            WI+ A+  SE +II   G+D AV       ++       LI +  L P+  TD+ V  ++
Sbjct  65   WIQRALQPSEEEIIASCGLDAAVLLRIFIFSMRFFAICTLIGVGILAPLNYTDNQVS-HA  123

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
            +     F+ LD  ++ +I N S RLW  L A Y +S   Y+ L
Sbjct  124  SQIGLLFDSLDLFTISNISNGSNRLWIHLAALYVISFSAYWLL  166



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W+ EA+   E ++I  +G+D+ VY       L I     ++    L+PV  T++ + L  
Sbjct  75   WMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAMLAWAVLVPVNWTNNELELAK  134

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFL  668
               N T +++D+L++ +I   S R WA +I  Y  ++ T + L
Sbjct  135  HFKNVTSSDIDKLTISNIPEGSNRFWAHIIMAYAFTIWTCYML  177



>ref|XP_008221566.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
 ref|XP_008221567.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=719

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   +E D+++ SG+D  V+   ++ +L + +F+G+I +  LLP+  + + +    
Sbjct  64   WVKTAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPINCSGNQLEYVD  123

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
             T     N LD  ++ ++ N S +LW   +A Y V++     L+
Sbjct  124  FTDLSN-NSLDVFTISNVNNGSSKLWIHFVAVYLVTIFVCCLLY  166



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 65/132 (49%), Gaps = 21/132 (16%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNPF------------SWIREAISSSEADIITMSGVDTA  425
            Y+P   LKGL   P+ +G +  N F            +W+  A+   E ++I  +G+D+A
Sbjct  38   YFPKWYLKGLRGSPLHSGTIV-NKFVNLDFRAYLKFLNWMPAALQMPEPELIEHAGLDSA  96

Query  426  VYFVFLSTALGILVFSGLILLPTLLPVAATDHSV-RLNSTTSNGTFNELDRLSMGHIGNN  602
            VY       L I V    I    ++PV  T+H++ RL+       +++LD+LS+ +I + 
Sbjct  97   VYLRIYLIGLKIFVPIAFIAFSVMVPVNWTNHTLERLDL-----AYSDLDKLSISNIPSG  151

Query  603  SPRLWAFLIATY  638
            S R W  L+  Y
Sbjct  152  SQRFWTHLVMAY  163



>ref|XP_007226980.1| hypothetical protein PRUPE_ppa002249mg [Prunus persica]
 gb|EMJ28179.1| hypothetical protein PRUPE_ppa002249mg [Prunus persica]
Length=695

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +3

Query  360  WIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNS  539
            W++ A   +E D+++ SG+D  V+   ++ +L + +F+G+I +  LLP+  + + +    
Sbjct  64   WVKTAWQLTEDDLLSSSGLDAVVFMRLINFSLRVFLFAGVIGVFVLLPINCSGNQLEYVD  123

Query  540  TTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
             T     N LD  ++ ++ N S +LW   +A Y V++     L+
Sbjct  124  FTDLSN-NSLDVFTISNVNNGSSKLWIHFVAVYLVTIFVCCLLY  166



>ref|XP_008649660.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Zea mays]
Length=768

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L I V   L+    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFAVLVPVNWTSGTLEN  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                S   ++++D+LS+ ++G  S R WA +  +Y  +  T+F L+
Sbjct  133  EKGLS---YDQIDKLSISNLGKGSKRFWAHIAMSYVFTFWTFFVLY  175



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (46%), Gaps = 17/140 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G   R               W+  A+   E ++I  +G+D+AV
Sbjct  38   YFPKWYLKGVRSSPTHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIDHAGLDSAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I +   ++    L+PV  T+ ++      SN  ++++D+LS+ +I   S 
Sbjct  98   YLRIYLIGLKIFIPIAILAFAVLVPVNWTNATLE----NSNVEYSDIDKLSISNIPKRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R WA L+  Y  S  T + L
Sbjct  154  RFWAHLVMAYIFSFWTCYVL  173



>gb|AFW78070.1| hypothetical protein ZEAMMB73_829601 [Zea mays]
Length=748

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (52%), Gaps = 3/106 (3%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+  A+   E ++I  +G+D+AVY       L I V   L+    L+PV  T  ++  
Sbjct  73   LNWMPAALKMPEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAFAVLVPVNWTSGTLEN  132

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATYWVSVVTYFFLW  671
                S   ++++D+LS+ ++G  S R WA +  +Y  +  T+F L+
Sbjct  133  EKGLS---YDQIDKLSISNLGKGSKRFWAHIAMSYVFTFWTFFVLY  175



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNPF------------SWIREAISSSEADIITMSGVDTA  425
            Y+P   LKGL   P ++G  + N F            +W+ EA+   E ++I  +G+D+A
Sbjct  38   YFPKWYLKGLRTSPTQSGAFA-NKFVNLDWRSYIRFLTWVPEALKMPEQELIDHAGLDSA  96

Query  426  VYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNS  605
            VY       L I V   L+    L+PV  T+++  L  +     F+ +D+LS+ +I   S
Sbjct  97   VYLRIYLLGLKIFVPVTLLAWAILVPVNWTNNT--LAQSADKLEFSNIDKLSISNIPLAS  154

Query  606  PRLWAFLIATYWVSVVTYFFL  668
             R W  ++  Y  +V T + L
Sbjct  155  QRFWTHVVMAYAFAVWTCYTL  175



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 65/140 (46%), Gaps = 16/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P++ G ++               +W+ +A+   E ++I  +G+D+ V
Sbjct  38   YFPKWYLKGLRSSPIKTGGLASKFVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I      +    ++PV  T+ ++       N TF+++D+LS+ +I N S 
Sbjct  98   YLRIYLLGLKIFFPIACLAFTVMVPVNWTNTTL---DKLQNLTFSDIDKLSISNIPNGSS  154

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L   Y ++  T F L
Sbjct  155  RFWVHLCMAYVITFWTCFVL  174



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 50/95 (53%), Gaps = 4/95 (4%)
 Frame = +3

Query  354  FSWIREAISSSEADIITMSGVDTAVYFVFLSTALGILVFSGLILLPTLLPVAATDHSVRL  533
             +W+ EA+   E ++I  +G+D+AVY       L I V   ++    ++PV  T+ S+  
Sbjct  73   LNWMPEALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITILAFSVMVPVNWTNGSLE-  131

Query  534  NSTTSNGTFNELDRLSMGHIGNNSPRLWAFLIATY  638
                S  + + +D+LS+ +I N SPR W  L+  Y
Sbjct  132  ---HSKFSHSNIDKLSISNIPNGSPRFWTHLVMAY  163



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 60/130 (46%), Gaps = 13/130 (10%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P  +G + R              +W+ EA+   E ++I  +G+D AV
Sbjct  38   YFPKWYLKGVRGSPSRSGALVRRVVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDYAV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V    +    L+PV  T+ ++      +N T +++D+LS+ +I   S 
Sbjct  98   YLRIYLMGLKIFVPITFLAWAILVPVNYTNDALEAAKMVANVTASDIDKLSISNIPLKSQ  157

Query  609  RLWAFLIATY  638
            R W  ++  Y
Sbjct  158  RFWTHIVMAY  167



>ref|XP_010924082.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X5 [Elaeis guineensis]
Length=688

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 17/141 (12%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKG+   P+ +G   R               W+  A+   E ++I  +G+D++V
Sbjct  38   YFPKWYLKGVRSSPIHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I V   ++    L+PV  T+ ++      S   ++++D+LS+ +I N S 
Sbjct  98   YLRIYLIGLKIFVPITILAFAVLVPVNWTNTTLE----NSKVEYSDIDKLSISNIPNRSQ  153

Query  609  RLWAFLIATYWVSVVTYFFLW  671
            R WA L+  Y  S  T + L+
Sbjct  154  RFWAHLVMAYVFSFWTCYVLF  174



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 65/140 (46%), Gaps = 16/140 (11%)
 Frame = +3

Query  288  YYPNRILKGL--DPVENGYVSRNP-----------FSWIREAISSSEADIITMSGVDTAV  428
            Y+P   LKGL   P++ G ++               +W+ +A+   E ++I  +G+D+ V
Sbjct  38   YFPKWYLKGLRSSPIKTGGLASKFVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVV  97

Query  429  YFVFLSTALGILVFSGLILLPTLLPVAATDHSVRLNSTTSNGTFNELDRLSMGHIGNNSP  608
            Y       L I      +    ++PV  T+ ++       N TF+++D+LS+ +I N S 
Sbjct  98   YLRIYLLGLKIFFPIACLAFTVMVPVNWTNTTL---DKLQNLTFSDIDKLSISNIPNGSS  154

Query  609  RLWAFLIATYWVSVVTYFFL  668
            R W  L   Y ++  T F L
Sbjct  155  RFWVHLCMAYVITFWTCFVL  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600