BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028H24

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO37773.1|  hypothetical protein CISIN_1g028408mg                   264   1e-85   Citrus sinensis [apfelsine]
ref|XP_006477977.1|  PREDICTED: peptide methionine sulfoxide redu...    260   7e-84   Citrus sinensis [apfelsine]
gb|KDO37774.1|  hypothetical protein CISIN_1g028408mg                   259   7e-84   Citrus sinensis [apfelsine]
ref|XP_002285647.1|  PREDICTED: peptide methionine sulfoxide redu...    258   3e-83   Vitis vinifera
emb|CBI20094.3|  unnamed protein product                                255   6e-83   Vitis vinifera
ref|XP_010106737.1|  Peptide methionine sulfoxide reductase             257   9e-83   Morus notabilis
ref|XP_006442225.1|  hypothetical protein CICLE_v10022321mg             256   2e-82   Citrus clementina [clementine]
ref|XP_009625505.1|  PREDICTED: peptide methionine sulfoxide redu...    256   5e-82   Nicotiana tomentosiformis
gb|ABO64857.1|  methionine-R-sulfoxide reductase B4 protein             253   7e-82   Capsicum annuum
ref|XP_010247423.1|  PREDICTED: peptide methionine sulfoxide redu...    254   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006348344.1|  PREDICTED: peptide methionine sulfoxide redu...    253   4e-81   Solanum tuberosum [potatoes]
ref|XP_004244304.2|  PREDICTED: peptide methionine sulfoxide redu...    252   5e-81   Solanum lycopersicum
ref|XP_011082814.1|  PREDICTED: peptide methionine sulfoxide redu...    252   5e-81   Sesamum indicum [beniseed]
gb|AEA72443.1|  chloroplast methionine sulfoxide reductase B1           251   1e-80   Carica papaya [mamon]
ref|XP_011029532.1|  PREDICTED: peptide methionine sulfoxide redu...    251   1e-80   Populus euphratica
ref|XP_007022197.1|  Methionine sulfoxide reductase B 1 isoform 1       251   4e-80   
gb|KDP24711.1|  hypothetical protein JCGZ_25702                         250   5e-80   Jatropha curcas
ref|XP_010060768.1|  PREDICTED: peptide methionine sulfoxide redu...    249   6e-80   Eucalyptus grandis [rose gum]
ref|XP_008452428.1|  PREDICTED: peptide methionine sulfoxide redu...    247   8e-80   
ref|XP_009404405.1|  PREDICTED: peptide methionine sulfoxide redu...    249   9e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008452427.1|  PREDICTED: peptide methionine sulfoxide redu...    249   1e-79   Cucumis melo [Oriental melon]
ref|XP_002316875.2|  hypothetical protein POPTR_0011s11490g             246   2e-79   
ref|XP_009794646.1|  PREDICTED: peptide methionine sulfoxide redu...    248   3e-79   Nicotiana sylvestris
gb|ABU49227.1|  chloroplast methionine sulfoxide reductase B1 pre...    247   4e-79   Nicotiana tabacum [American tobacco]
ref|XP_007133364.1|  hypothetical protein PHAVU_011G173000g             248   4e-79   Phaseolus vulgaris [French bean]
gb|EYU38232.1|  hypothetical protein MIMGU_mgv1a021016mg                245   4e-79   Erythranthe guttata [common monkey flower]
emb|CDP06068.1|  unnamed protein product                                245   6e-79   Coffea canephora [robusta coffee]
ref|XP_004291795.1|  PREDICTED: peptide methionine sulfoxide redu...    247   7e-79   Fragaria vesca subsp. vesca
gb|KGN55021.1|  hypothetical protein Csa_4G622800                       247   8e-79   Cucumis sativus [cucumbers]
ref|XP_009147587.1|  PREDICTED: peptide methionine sulfoxide redu...    247   9e-79   Brassica rapa
emb|CDY45127.1|  BnaC06g06480D                                          246   1e-78   Brassica napus [oilseed rape]
gb|KCW67623.1|  hypothetical protein EUGRSUZ_F01375                     246   1e-78   Eucalyptus grandis [rose gum]
gb|KJB26990.1|  hypothetical protein B456_004G270500                    246   2e-78   Gossypium raimondii
ref|XP_010916095.1|  PREDICTED: peptide methionine sulfoxide redu...    246   2e-78   Elaeis guineensis
ref|XP_008784388.1|  PREDICTED: peptide methionine sulfoxide redu...    246   2e-78   Phoenix dactylifera
ref|XP_008784389.1|  PREDICTED: peptide methionine sulfoxide redu...    246   2e-78   Phoenix dactylifera
ref|XP_010534997.1|  PREDICTED: peptide methionine sulfoxide redu...    245   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_010916096.1|  PREDICTED: peptide methionine sulfoxide redu...    245   3e-78   Elaeis guineensis
gb|ABK95006.1|  unknown                                                 243   3e-78   Populus trichocarpa [western balsam poplar]
ref|XP_004146010.1|  PREDICTED: peptide methionine sulfoxide redu...    243   4e-78   
ref|XP_007212100.1|  hypothetical protein PRUPE_ppa011768mg             244   5e-78   Prunus persica
ref|XP_010479944.1|  PREDICTED: peptide methionine sulfoxide redu...    244   7e-78   Camelina sativa [gold-of-pleasure]
ref|XP_008226361.1|  PREDICTED: peptide methionine sulfoxide redu...    244   8e-78   Prunus mume [ume]
ref|XP_006392767.1|  hypothetical protein EUTSA_v10012040mg             246   9e-78   
gb|KFK35681.1|  hypothetical protein AALP_AA4G023400                    242   1e-77   Arabis alpina [alpine rockcress]
ref|XP_010694740.1|  PREDICTED: peptide methionine sulfoxide redu...    244   1e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010462273.1|  PREDICTED: peptide methionine sulfoxide redu...    244   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002436788.1|  hypothetical protein SORBIDRAFT_10g008790          244   2e-77   Sorghum bicolor [broomcorn]
gb|KHG14488.1|  Peptide methionine sulfoxide reductase B1, chloro...    243   3e-77   Gossypium arboreum [tree cotton]
gb|KCW67626.1|  hypothetical protein EUGRSUZ_F01375                     242   4e-77   Eucalyptus grandis [rose gum]
ref|NP_001239824.1|  uncharacterized protein LOC100798757               242   5e-77   Glycine max [soybeans]
ref|XP_002891765.1|  hypothetical protein ARALYDRAFT_892417             242   5e-77   Arabidopsis lyrata subsp. lyrata
ref|NP_564640.2|  peptide methionine sulfoxide reductase B1             242   6e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65202.1|  transcriptional regulator, putative                     240   8e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44288.1|  unknown                                                 241   9e-77   Lotus japonicus
ref|XP_004987307.1|  PREDICTED: peptide methionine sulfoxide redu...    243   1e-76   
gb|AFK39115.1|  unknown                                                 241   2e-76   Medicago truncatula
ref|XP_006377756.1|  hypothetical protein POPTR_0011s11490g             239   2e-76   
ref|XP_010501027.1|  PREDICTED: peptide methionine sulfoxide redu...    241   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_004513790.1|  PREDICTED: peptide methionine sulfoxide redu...    239   7e-76   Cicer arietinum [garbanzo]
gb|KJB26991.1|  hypothetical protein B456_004G270500                    239   1e-75   Gossypium raimondii
ref|NP_001148408.1|  peptide methionine sulfoxide reductase msrB        239   1e-75   Zea mays [maize]
ref|XP_009344620.1|  PREDICTED: peptide methionine sulfoxide redu...    238   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_008368465.1|  PREDICTED: peptide methionine sulfoxide redu...    237   4e-75   
sp|Q0DC89.2|MSRB1_ORYSJ  RecName: Full=Peptide methionine sulfoxi...    237   7e-75   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD35399.1|  putative methionine sulfoxide reductase B              235   8e-75   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057620.1|  Os06g0472000                                       237   9e-75   
gb|EEC80596.1|  hypothetical protein OsI_22943                          237   1e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_003563853.1|  PREDICTED: peptide methionine sulfoxide redu...    235   2e-74   Brachypodium distachyon [annual false brome]
gb|AJL35125.1|  methionine sulfoxide reductase MSRB1.1                  233   3e-74   Triticum aestivum x Thinopyrum elongatum
dbj|BAJ89329.1|  predicted protein                                      233   3e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AJL35126.1|  methionine sulfoxide reductase MSRB1.2                  231   2e-73   Triticum aestivum x Thinopyrum elongatum
ref|XP_007022198.1|  Methionine sulfoxide reductase B 1 isoform 2       229   4e-72   
gb|EPS58912.1|  hypothetical protein M569_15901                         225   5e-71   Genlisea aurea
gb|ACN40208.1|  unknown                                                 225   5e-71   Picea sitchensis
gb|ABK22433.1|  unknown                                                 226   2e-70   Picea sitchensis
ref|NP_001117484.1|  peptide methionine sulfoxide reductase B1          223   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002985120.1|  hypothetical protein SELMODRAFT_424211             207   6e-64   
ref|XP_001782030.1|  predicted protein                                  204   3e-63   
ref|XP_002969788.1|  hypothetical protein SELMODRAFT_92187              200   1e-61   
ref|XP_006477976.1|  PREDICTED: peptide methionine sulfoxide redu...    188   4e-57   Citrus sinensis [apfelsine]
ref|WP_015226259.1|  methionine-R-sulfoxide reductase                   180   1e-53   Halothece sp. PCC 7418
ref|WP_042250600.1|  methionine sulfoxide reductase B                   178   7e-53   Nitrospina gracilis
emb|CCQ90372.1|  Peptide methionine sulfoxide reductase MsrB            178   7e-53   Nitrospina gracilis 3/211
ref|WP_038682717.1|  peptide methionine sulfoxide reductase             177   2e-52   Rubrobacter radiotolerans
ref|WP_015230176.1|  methionine-R-sulfoxide reductase                   177   3e-52   Dactylococcopsis salina
ref|WP_027451971.1|  peptide methionine sulfoxide reductase             177   3e-52   
ref|WP_011244217.1|  MULTISPECIES: methionine sulfoxide reductase B     175   1e-51   Synechococcus
ref|WP_015126202.1|  methionine-R-sulfoxide reductase                   175   1e-51   Synechococcus sp. PCC 6312
ref|WP_028666014.1|  methionine sulfoxide reductase B                   173   6e-51   
ref|WP_026788276.1|  MULTISPECIES: peptide methionine sulfoxide r...    173   6e-51   Planktothrix
gb|AEI50934.1|  Peptide methionine sulfoxide reductase msrB             174   7e-51   Runella slithyformis DSM 19594
ref|WP_027249836.1|  peptide methionine sulfoxide reductase             173   7e-51   Planktothrix agardhii
ref|WP_008735653.1|  methionine sulfoxide reductase B                   172   9e-51   Alcanivorax pacificus
ref|WP_006632094.1|  methionine sulfoxide reductase B                   172   1e-50   Microcoleus vaginatus
ref|WP_024124516.1|  methionine-R-sulfoxide reductase MsrB              172   1e-50   Thermosynechococcus sp. NK55a
ref|WP_011144007.1|  methionine sulfoxide reductase B                   173   1e-50   Gloeobacter violaceus
ref|WP_015179581.1|  Peptide methionine sulfoxide reductase msrB        172   2e-50   Oscillatoria nigro-viridis
ref|WP_041343781.1|  methionine sulfoxide reductase B                   172   2e-50   
ref|WP_011057056.1|  methionine sulfoxide reductase B                   172   2e-50   Thermosynechococcus elongatus
ref|WP_022609192.1|  methionine-R-sulfoxide reductase                   171   5e-50   Rubidibacter lacunae
ref|WP_028525553.1|  hypothetical protein                               170   7e-50   
ref|WP_042155102.1|  peptide methionine sulfoxide reductase             170   8e-50   Planktothrix agardhii
ref|WP_026796798.1|  peptide methionine sulfoxide reductase             170   8e-50   Planktothrix
ref|WP_025770426.1|  hypothetical protein                               170   9e-50   Thioalkalivibrio sp. HK1
ref|WP_015172795.1|  methionine-R-sulfoxide reductase                   170   1e-49   Geitlerinema sp. PCC 7407
ref|WP_036481793.1|  methionine sulfoxide reductase B                   169   2e-49   Nitratireductor basaltis
ref|WP_006101300.1|  methionine sulfoxide reductase B                   170   2e-49   Coleofasciculus chthonoplastes
ref|WP_041858792.1|  hypothetical protein                               169   2e-49   
ref|WP_011563648.1|  methionine sulfoxide reductase B                   169   2e-49   Rubrobacter xylanophilus
ref|WP_017661733.1|  methionine sulfoxide reductase B                   169   3e-49   Geitlerinema sp. PCC 7105
ref|WP_007355453.1|  MULTISPECIES: methionine sulfoxide reductase B     168   4e-49   Kamptonema
ref|WP_018399410.1|  methionine sulfoxide reductase B                   168   5e-49   filamentous cyanobacterium ESFC-1
ref|WP_015181317.1|  methionine-R-sulfoxide reductase                   168   6e-49   Microcoleus sp. PCC 7113
ref|WP_010477409.1|  methionine sulfoxide reductase B                   168   7e-49   Acaryochloris sp. CCMEE 5410
ref|WP_026210568.1|  peptide methionine sulfoxide reductase             168   7e-49   
gb|ABJ81183.1|  methionine-R-sulfoxide reductase                        169   9e-49   Candidatus Solibacter usitatus Ellin6076
ref|WP_017305061.1|  methionine sulfoxide reductase B                   167   1e-48   Spirulina subsalsa
ref|WP_017712709.1|  hypothetical protein                               167   1e-48   Prochlorothrix hollandica
ref|XP_005537862.1|  similar to transcriptional regulator               169   1e-48   Cyanidioschyzon merolae strain 10D
ref|WP_008182689.1|  methionine sulfoxide reductase B                   167   2e-48   Moorea producens
gb|EMS62105.1|  Peptide methionine sulfoxide reductase B1, chloro...    167   2e-48   Triticum urartu
ref|WP_015955025.1|  methionine sulfoxide reductase B                   166   2e-48   Cyanothece sp. PCC 7424
ref|WP_035272482.1|  methionine sulfoxide reductase B                   166   3e-48   Alcaligenes faecalis
ref|WP_012162617.1|  methionine sulfoxide reductase B                   166   4e-48   Acaryochloris marina
ref|WP_008308363.1|  methionine-R-sulfoxide reductase                   165   8e-48   Leptolyngbya sp. PCC 6406
ref|WP_013322045.1|  methionine sulfoxide reductase B                   165   8e-48   Cyanothece sp. PCC 7822
gb|EMT32969.1|  hypothetical protein F775_44018                         166   9e-48   
ref|WP_002686084.1|  methionine sulfoxide reductase B                   165   1e-47   Beggiatoa alba
ref|WP_023173225.1|  methionine-R-sulfoxide reductase                   165   1e-47   Gloeobacter kilaueensis
ref|WP_008056400.1|  methionine sulfoxide reductase B                   164   1e-47   Arthrospira sp. PCC 8005
ref|WP_006622461.1|  MULTISPECIES: methionine sulfoxide reductase B     164   1e-47   Arthrospira
ref|WP_011381412.1|  methionine sulfoxide reductase B                   165   1e-47   Nitrosospira multiformis
ref|WP_006618845.1|  methionine sulfoxide reductase B                   164   1e-47   Arthrospira platensis
ref|WP_023066822.1|  peptide methionine sulfoxide reductase MsrB        164   3e-47   Lyngbya aestuarii
ref|WP_017324412.1|  hypothetical protein                               164   3e-47   Synechococcus sp. PCC 7336
ref|WP_041102217.1|  methionine sulfoxide reductase B                   164   3e-47   
ref|WP_011934016.1|  methionine sulfoxide reductase B                   164   3e-47   Synechococcus sp. WH 7803
ref|WP_009456637.1|  MULTISPECIES: methionine sulfoxide reductase B     163   3e-47   Alcaligenes
ref|WP_007098957.1|  methionine sulfoxide reductase B                   164   4e-47   Synechococcus sp. RS9916
ref|WP_009782903.1|  methionine sulfoxide reductase B                   163   4e-47   Lyngbya sp. PCC 8106
ref|WP_011613411.1|  methionine sulfoxide reductase B                   163   5e-47   Trichodesmium erythraeum
ref|WP_040934081.1|  peptide methionine sulfoxide reductase             163   5e-47   
gb|EDN65272.1|  Protein-methionine-S-oxide reductase                    162   8e-47   Beggiatoa sp. PS
ref|WP_028465220.1|  hypothetical protein                               162   8e-47   Nisaea denitrificans
ref|WP_006043154.1|  methionine sulfoxide reductase B                   162   9e-47   Synechococcus sp. WH 7805
ref|WP_015223778.1|  methionine-R-sulfoxide reductase                   162   9e-47   
dbj|BAO30010.1|  protein-methionine-S-oxide reductase                   163   9e-47   Sulfuritalea hydrogenivorans sk43H
ref|WP_015218866.1|  Peptide methionine sulfoxide reductase msrB        162   1e-46   Cyanobacterium aponinum
ref|WP_015151356.1|  methionine-R-sulfoxide reductase                   162   1e-46   Oscillatoria acuminata
ref|WP_012306301.1|  MULTISPECIES: methionine sulfoxide reductase B     162   1e-46   Synechococcus
ref|WP_008595193.1|  methionine sulfoxide reductase B                   162   1e-46   Nitratireductor pacificus
emb|CCI20814.1|  peptide methionine sulfoxide reductase msrB            162   2e-46   Microcystis aeruginosa PCC 9808
ref|WP_015133444.1|  Peptide methionine sulfoxide reductase msrB        162   2e-46   Leptolyngbya sp. PCC 7376
ref|WP_039724873.1|  MULTISPECIES: peptide methionine sulfoxide r...    161   2e-46   Lyngbya confervoides
ref|WP_037583245.1|  peptide methionine sulfoxide reductase             161   2e-46   
ref|WP_013564995.1|  methionine sulfoxide reductase B                   161   3e-46   Isosphaera pallida
gb|ADO71391.1|  Peptide methionine sulfoxide reductase MsrB             162   3e-46   Stigmatella aurantiaca DW4/3-1
ref|WP_002739419.1|  peptide methionine sulfoxide reductase MsrB        161   3e-46   
ref|WP_039730591.1|  methionine sulfoxide reductase B                   161   3e-46   Lyngbya confervoides
ref|WP_042482482.1|  methionine sulfoxide reductase B                   161   3e-46   Alcaligenes faecalis
ref|WP_023072593.1|  methionine sulfoxide reductase b                   161   4e-46   Leptolyngbya sp. Heron Island J
ref|WP_015477845.1|  methionine sulfoxide reductase B                   160   4e-46   Pseudomonas sp. ATCC 13867
ref|WP_011396194.1|  methionine sulfoxide reductase B                   161   4e-46   Hahella chejuensis
ref|WP_004784131.1|  MULTISPECIES: peptide methionine sulfoxide r...    161   4e-46   Acinetobacter
ref|WP_009623407.1|  MULTISPECIES: methionine sulfoxide reductase B     160   5e-46   Pseudomonas
ref|WP_025041094.1|  methionine sulfoxide reductase B                   160   5e-46   Nitrosospira briensis
gb|EAU67795.1|  peptide methionine sulfoxide reductase MsrB             162   5e-46   Stigmatella aurantiaca DW4/3-1
ref|WP_017516978.1|  methionine sulfoxide reductase B                   160   5e-46   Pseudomonas nitroreducens
ref|WP_003813871.1|  MULTISPECIES: methionine sulfoxide reductase B     160   5e-46   Bordetella
gb|EEY90813.1|  methionine-R-sulfoxide reductase                        160   5e-46   Acinetobacter lwoffii SH145
ref|WP_004645533.1|  MULTISPECIES: peptide methionine sulfoxide r...    160   5e-46   Proteobacteria [purple bacteria]
ref|WP_027864150.1|  methionine sulfoxide reductase B                   160   6e-46   Massilia alkalitolerans
ref|WP_007196734.1|  methionine sulfoxide reductase B                   160   6e-46   Hoeflea phototrophica
ref|WP_002758329.1|  methionine sulfoxide reductase B                   160   6e-46   Microcystis
ref|WP_025899968.1|  peptide methionine sulfoxide reductase             160   6e-46   Sneathiella glossodoripedis
emb|CCI31716.1|  peptide methionine sulfoxide reductase msrB            160   6e-46   Microcystis sp. T1-4
gb|ACL46530.1|  methionine-R-sulfoxide reductase                        160   6e-46   Cyanothece sp. PCC 7425
emb|CCI29297.1|  peptide methionine sulfoxide reductase msrB            160   7e-46   Microcystis aeruginosa PCC 9809
ref|WP_017295985.1|  hypothetical protein                               160   7e-46   Geminocystis herdmanii
emb|CCI37930.1|  peptide methionine sulfoxide reductase msrB            160   7e-46   Microcystis aeruginosa PCC 9701
ref|WP_043267144.1|  methionine sulfoxide reductase B                   160   8e-46   Pseudomonas
ref|WP_022934414.1|  peptide methionine sulfoxide reductase             160   8e-46   
emb|CCI02637.1|  peptide methionine sulfoxide reductase msrB            160   8e-46   Microcystis aeruginosa PCC 9443
ref|WP_039899783.1|  peptide methionine sulfoxide reductase             160   9e-46   
ref|WP_041237285.1|  peptide methionine sulfoxide reductase             160   1e-45   
ref|WP_012264512.1|  methionine sulfoxide reductase B                   160   1e-45   
ref|WP_043996314.1|  peptide methionine sulfoxide reductase             159   1e-45   
ref|WP_024970986.1|  peptide methionine sulfoxide reductase             160   1e-45   Microcystis aeruginosa
emb|CCI07308.1|  peptide methionine sulfoxide reductase msrB            160   1e-45   Microcystis aeruginosa PCC 7941
ref|WP_016167511.1|  MULTISPECIES: peptide methionine sulfoxide r...    160   1e-45   Acinetobacter
ref|WP_043998091.1|  peptide methionine sulfoxide reductase             159   1e-45   
ref|WP_003801011.1|  methionine sulfoxide reductase B                   159   1e-45   Alcaligenes
ref|WP_015164205.1|  Peptide methionine sulfoxide reductase msrB        159   1e-45   Pseudanabaena sp. PCC 7367
ref|WP_002750849.1|  methionine sulfoxide reductase B                   159   1e-45   Microcystis aeruginosa
ref|WP_027591782.1|  MULTISPECIES: methionine sulfoxide reductase B     159   1e-45   Pseudomonas
emb|CDI01681.1|  methionine sulfoxide reductase B                       159   2e-45   Candidatus Competibacter denitrificans Run_A_D11
ref|WP_036229421.1|  methionine sulfoxide reductase B                   159   2e-45   Massilia sp. JS1662
ref|WP_036395302.1|  peptide methionine sulfoxide reductase             159   2e-45   
ref|WP_012106145.1|  peptide methionine sulfoxide reductase             160   2e-45   Methanoregula boonei
ref|WP_006854465.1|  methionine sulfoxide reductase B                   159   2e-45   Synechococcus sp. WH 8016
ref|WP_033463228.1|  methionine sulfoxide reductase B                   159   2e-45   Bordetella
ref|WP_034431472.1|  hypothetical protein                               159   2e-45   
ref|WP_008931849.1|  methionine sulfoxide reductase B                   159   2e-45   Ectothiorhodospira sp. PHS-1
ref|WP_010931540.1|  methionine sulfoxide reductase B                   159   2e-45   Bordetella pertussis
gb|ELS47740.1|  peptide methionine sulfoxide reductase MsrB             159   2e-45   Microcystis aeruginosa DIANCHI905
ref|WP_028990572.1|  hypothetical protein                               159   2e-45   Thermithiobacillus tepidarius
ref|WP_039743365.1|  hypothetical protein                               159   2e-45   Geobacter pickeringii
ref|WP_044193003.1|  hypothetical protein                               159   3e-45   Hyalangium minutum
ref|WP_024766956.1|  methionine sulfoxide reductase B                   159   3e-45   Pseudomonas nitroreducens
ref|WP_011843871.1|  peptide methionine sulfoxide reductase             159   3e-45   Methanoculleus marisnigri
ref|WP_036206181.1|  methionine sulfoxide reductase B                   159   3e-45   Massilia sp. LC238
gb|KFE66161.1|  Peptide methionine sulfoxide reductase MsrB             159   3e-45   Hyalangium minutum
ref|WP_037014221.1|  methionine sulfoxide reductase B                   159   3e-45   Pseudomonas
ref|WP_043212549.1|  methionine sulfoxide reductase B                   159   3e-45   Bordetella pseudohinzii
ref|WP_005106520.1|  peptide methionine sulfoxide reductase msrB        159   3e-45   Acinetobacter lwoffii
ref|WP_027601226.1|  MULTISPECIES: methionine sulfoxide reductase B     159   3e-45   Pseudomonas
ref|WP_028033320.1|  methionine sulfoxide reductase B                   159   3e-45   Chelativorans sp. J32
gb|ABG62263.1|  methionine-R-sulfoxide reductase                        158   4e-45   Chelativorans sp. BNC1
ref|WP_004866470.1|  peptide methionine sulfoxide reductase msrB        159   4e-45   Acinetobacter gerneri
gb|KDE56182.1|  peptide methionine sulfoxide reductase                  159   4e-45   Methanoculleus sp. MH98A
ref|WP_007162231.1|  MULTISPECIES: methionine sulfoxide reductase B     158   4e-45   Pseudomonas
ref|WP_043401389.1|  hypothetical protein                               158   4e-45   
ref|WP_024546824.1|  peptide methionine sulfoxide reductase             158   4e-45   Synechococcus
ref|WP_002783632.1|  peptide methionine sulfoxide reductase msrB        158   4e-45   Microcystis aeruginosa
ref|WP_025511310.1|  methionine sulfoxide reductase B                   158   4e-45   
ref|WP_041545138.1|  methionine sulfoxide reductase B                   158   4e-45   
dbj|GAL93218.1|  peptide methionine sulfoxide reductase MsrB            158   4e-45   Microcystis aeruginosa NIES-44
ref|WP_011620360.1|  methionine sulfoxide reductase B                   158   5e-45   Synechococcus sp. CC9311
ref|WP_018046828.1|  hypothetical protein                               158   6e-45   
ref|WP_036246971.1|  methionine sulfoxide reductase B                   157   6e-45   Massilia sp. BSC265
ref|WP_004030286.1|  methionine sulfoxide reductase B                   158   6e-45   Methanobacterium formicicum
gb|EEF57343.1|  methionine-R-sulfoxide reductase                        159   6e-45   Pedosphaera parvula Ellin514
ref|WP_004693474.1|  peptide methionine sulfoxide reductase msrB        158   7e-45   Acinetobacter
ref|WP_029578748.1|  methionine sulfoxide reductase B                   157   7e-45   Bordetella hinzii
ref|WP_018049533.1|  hypothetical protein                               157   7e-45   
ref|WP_040550779.1|  hypothetical protein                               157   7e-45   
ref|WP_035266138.1|  methionine sulfoxide reductase B                   158   7e-45   Acinetobacter
gb|KFA90719.1|  hypothetical protein Q664_26760                         159   8e-45   Archangium violaceum Cb vi76
ref|WP_004980125.1|  peptide methionine sulfoxide reductase msrB        157   9e-45   Acinetobacter johnsonii
ref|WP_005097408.1|  MULTISPECIES: peptide methionine sulfoxide r...    157   9e-45   Acinetobacter
ref|WP_003299543.1|  MULTISPECIES: methionine sulfoxide reductase B     157   1e-44   Pseudomonas
ref|WP_036260542.1|  methionine sulfoxide reductase B                   157   1e-44   Methylocapsa aurea
ref|WP_014750326.1|  methionine sulfoxide reductase B                   157   1e-44   Advenella kashmirensis
ref|WP_009452151.1|  methionine sulfoxide reductase B                   157   1e-44   Nitratireductor indicus
ref|WP_009285242.1|  methionine sulfoxide reductase B                   157   1e-44   Fibrisoma limi
ref|WP_017642580.1|  methionine sulfoxide reductase B                   157   1e-44   Pseudomonas
ref|WP_005399615.1|  MULTISPECIES: methionine sulfoxide reductase B     157   1e-44   Acinetobacter
ref|WP_011365194.1|  methionine sulfoxide reductase B                   157   1e-44   Synechococcus sp. CC9605
ref|WP_041399314.1|  hypothetical protein                               162   1e-44   
gb|ELW79075.1|  methionine-R-sulfoxide reductase                        157   1e-44   Acinetobacter sp. WC-743
ref|WP_004831080.1|  MULTISPECIES: peptide methionine sulfoxide r...    157   1e-44   Acinetobacter
ref|WP_010116992.1|  methionine sulfoxide reductase B                   157   2e-44   Acinetobacter sp. P8-3-8
ref|WP_026337264.1|  hypothetical protein                               156   2e-44   
ref|WP_027906470.1|  methionine sulfoxide reductase B                   156   2e-44   Pseudomonas
gb|KFE68514.1|  Peptide methionine sulfoxide reductase MsrB             157   2e-44   Hyalangium minutum
ref|WP_004821128.1|  MULTISPECIES: peptide methionine sulfoxide r...    157   2e-44   Acinetobacter
ref|WP_010547499.1|  methionine sulfoxide reductase B                   156   2e-44   gamma proteobacterium HIMB30
ref|WP_021701610.1|  peptide methionine sulfoxide reductase MsrB        156   2e-44   Pseudomonas alcaligenes
ref|WP_027897469.1|  methionine sulfoxide reductase B                   156   2e-44   Pseudomonas thermotolerans
ref|WP_014597041.1|  methionine sulfoxide reductase B                   156   2e-44   Pseudomonas stutzeri
ref|WP_038142706.1|  peptide methionine sulfoxide reductase             156   2e-44   
ref|WP_013983197.1|  methionine sulfoxide reductase B                   156   2e-44   Pseudomonas
ref|WP_004892617.1|  peptide methionine sulfoxide reductase msrB        156   2e-44   Acinetobacter schindleri
ref|WP_043370080.1|  methionine sulfoxide reductase B                   156   2e-44   
gb|AGY57459.1|  methionine-R-sulfoxide reductase                        157   2e-44   Gloeobacter kilaueensis JS1
gb|ADY59525.1|  Peptide methionine sulfoxide reductase msrA             163   2e-44   Rubinisphaera brasiliensis DSM 5305
ref|WP_004989584.1|  MULTISPECIES: methionine sulfoxide reductase B     156   2e-44   Acinetobacter
ref|WP_013791785.1|  MULTISPECIES: methionine sulfoxide reductase B     156   3e-44   Pseudomonas
ref|WP_038553091.1|  methionine sulfoxide reductase B                   156   3e-44   Synechococcus sp. KORDI-52
ref|WP_038143531.1|  methionine-R-sulfoxide reductase                   156   3e-44   
ref|WP_044171001.1|  hypothetical protein                               157   3e-44   Flectobacillus major
ref|WP_006515008.1|  methionine-R-sulfoxide reductase                   156   3e-44   Leptolyngbya sp. PCC 7375
ref|WP_041244416.1|  hypothetical protein                               156   3e-44   
ref|WP_011523588.1|  methionine sulfoxide reductase B                   156   3e-44   Candidatus Koribacter versatilis
ref|WP_011144322.1|  methionine sulfoxide reductase B                   156   3e-44   Gloeobacter violaceus
ref|WP_044874252.1|  methionine sulfoxide reductase B                   155   3e-44   Pseudomonas sp. LFM046
gb|ACB95274.1|  methionine-R-sulfoxide reductase                        156   3e-44   Beijerinckia indica subsp. indica ATCC 9039
gb|EDY38895.1|  methionine-R-sulfoxide reductase                        156   3e-44   Cyanobium sp. PCC 7001
ref|WP_017940092.1|  methionine sulfoxide reductase B                   156   3e-44   
ref|WP_005671103.1|  peptide methionine sulfoxide reductase msrB        155   4e-44   
gb|EPH34992.1|  Peptide methionine sulfoxide reductase MsrB             156   4e-44   
ref|WP_041246195.1|  hypothetical protein                               155   4e-44   
ref|WP_041778609.1|  methionine sulfoxide reductase B                   156   4e-44   
ref|WP_004720961.1|  peptide methionine sulfoxide reductase msrB        156   4e-44   
ref|WP_041754288.1|  methionine sulfoxide reductase B                   155   4e-44   
ref|WP_018232458.1|  methionine sulfoxide reductase B                   155   4e-44   
ref|WP_044189343.1|  peptide methionine sulfoxide reductase             157   4e-44   
ref|WP_012416760.1|  methionine sulfoxide reductase B                   155   4e-44   
ref|WP_024005497.1|  methionine sulfoxide reductase B                   155   4e-44   
ref|WP_010509628.1|  methionine sulfoxide reductase B                   155   4e-44   
ref|WP_027287749.1|  peptide methionine sulfoxide reductase             155   5e-44   
ref|WP_037051870.1|  methionine sulfoxide reductase B                   155   6e-44   
ref|WP_015109098.1|  methionine-R-sulfoxide reductase                   155   6e-44   
ref|WP_038546722.1|  methionine sulfoxide reductase B                   155   6e-44   
ref|WP_025242350.1|  methionine sulfoxide reductase B                   155   6e-44   
ref|WP_010943090.1|  methionine sulfoxide reductase B                   155   6e-44   
gb|ABQ28216.1|  methionine-R-sulfoxide reductase                        156   6e-44   
ref|WP_040097191.1|  hypothetical protein                               156   6e-44   
ref|WP_004815441.1|  MULTISPECIES: methionine sulfoxide reductase B     155   7e-44   
ref|WP_038658738.1|  methionine sulfoxide reductase B                   155   7e-44   
ref|WP_021442892.1|  methionine sulfoxide reductase B                   155   7e-44   
gb|AHF64664.1|  Methionine sulfoxide reductase B                        155   7e-44   
ref|WP_031805442.1|  methionine sulfoxide reductase B                   155   7e-44   
ref|WP_023502046.1|  conserved domain frequently associated with ...    155   8e-44   
ref|WP_043692892.1|  methionine sulfoxide reductase B                   155   8e-44   
ref|WP_014551827.1|  methionine sulfoxide reductase B                   155   8e-44   
ref|WP_023081428.1|  peptide methionine sulfoxide reductase msrB        155   8e-44   
emb|CBW75185.1|  Peptide methionine sulfoxide reductase msrB (EC ...    155   8e-44   
ref|WP_034024380.1|  methionine sulfoxide reductase B                   155   8e-44   
ref|WP_034583702.1|  methionine sulfoxide reductase B                   155   8e-44   
ref|WP_003296548.1|  PilB-like protein                                  155   8e-44   
ref|WP_020647878.1|  hypothetical protein                               155   8e-44   
ref|WP_003154987.1|  methionine sulfoxide reductase B                   155   9e-44   
gb|ENV70401.1|  peptide methionine sulfoxide reductase msrB             155   9e-44   
ref|WP_004356445.1|  methionine-R-sulfoxide reductase                   155   9e-44   
ref|WP_035832335.1|  methionine sulfoxide reductase B                   155   9e-44   
ref|WP_017451133.1|  MULTISPECIES: methionine sulfoxide reductase B     154   9e-44   
ref|WP_026438319.1|  methionine sulfoxide reductase B                   155   9e-44   
ref|WP_009541059.1|  Peptide methionine sulfoxide reductase MsrB        154   1e-43   
ref|WP_025373142.1|  methionine sulfoxide reductase B                   154   1e-43   
gb|EQC49542.1|  methionine-R-sulfoxide reductase                        156   1e-43   
ref|WP_008145867.1|  methionine sulfoxide reductase B                   154   1e-43   
gb|ABP80186.1|  PilB-related protein                                    156   1e-43   
ref|WP_003448018.1|  Peptide methionine sulfoxide reductase MsrB        154   1e-43   
ref|WP_003090911.1|  MULTISPECIES: methionine sulfoxide reductase B     154   1e-43   
ref|WP_014617000.1|  peptide methionine sulfoxide reductase             154   1e-43   
ref|WP_010461282.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_019140930.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_034049645.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_007943707.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_043680816.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_024917023.1|  methionine sulfoxide reductase B                   154   1e-43   
ref|WP_028816930.1|  methionine sulfoxide reductase B                   154   1e-43   
gb|AAT49625.1|  PA2827                                                  154   1e-43   
ref|WP_013661442.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_025389216.1|  peptide methionine sulfoxide reductase             154   2e-43   
ref|WP_006712619.1|  peptide methionine sulfoxide reductase             154   2e-43   
ref|WP_011629775.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_008249994.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_043085314.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_039805267.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_040728815.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_020596722.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_028356423.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_024644610.1|  peptide methionine sulfoxide reductase             154   2e-43   
ref|WP_021207771.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_004651592.1|  peptide methionine sulfoxide reductase msrB        154   2e-43   
ref|WP_039703586.1|  hypothetical protein                               154   2e-43   
ref|WP_034081864.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_004251912.1|  methionine-R-sulfoxide reductase                   154   2e-43   
ref|WP_034151310.1|  peptide methionine sulfoxide reductase             154   2e-43   
ref|WP_008512017.1|  methionine-R-sulfoxide reductase                   154   2e-43   
ref|WP_004904985.1|  peptide methionine sulfoxide reductase msrB        154   2e-43   
ref|WP_013044969.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_028007294.1|  methionine sulfoxide reductase B                   154   2e-43   
ref|WP_013459475.1|  methionine sulfoxide reductase B                   154   3e-43   
ref|WP_015030502.1|  methionine sulfoxide reductase B                   154   3e-43   
ref|WP_040550851.1|  methionine-R-sulfoxide reductase                   153   3e-43   
dbj|BAP79006.1|  methionine sulfoxide reductase B                       154   3e-43   
ref|WP_042589801.1|  methionine sulfoxide reductase B                   153   3e-43   
ref|WP_034727584.1|  hypothetical protein                               154   3e-43   
ref|WP_029601336.1|  methionine sulfoxide reductase                     154   3e-43   
ref|WP_003275462.1|  peptide methionine sulfoxide reductase             153   3e-43   
ref|WP_041014430.1|  methionine sulfoxide reductase B                   153   3e-43   
ref|WP_035528232.1|  methionine sulfoxide reductase B                   154   3e-43   
ref|WP_007101542.1|  methionine sulfoxide reductase B                   154   3e-43   
ref|WP_011765901.1|  methionine sulfoxide reductase B                   154   3e-43   
ref|WP_038126207.1|  hypothetical protein                               154   3e-43   
ref|WP_004639368.1|  MULTISPECIES: methionine sulfoxide reductase B     154   3e-43   
ref|WP_034335690.1|  MULTISPECIES: methionine sulfoxide reductase B     153   3e-43   
ref|WP_020796802.1|  MULTISPECIES: methionine-R-sulfoxide reductase     153   3e-43   
ref|WP_017360766.1|  methionine sulfoxide reductase B                   153   3e-43   
gb|EEF57240.1|  methionine-R-sulfoxide reductase                        155   3e-43   
ref|WP_018618843.1|  methionine sulfoxide reductase B                   153   3e-43   
ref|WP_003267862.1|  peptide methionine sulfoxide reductase             153   3e-43   
ref|WP_013327493.1|  methionine sulfoxide reductase B                   153   3e-43   
ref|WP_039643520.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_037021668.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_043253369.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_037990882.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_038488576.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_013206010.1|  peptide methionine sulfoxide reductase             153   4e-43   
ref|WP_004752329.1|  peptide methionine sulfoxide reductase msrB        153   4e-43   
ref|WP_017676757.1|  MULTISPECIES: methionine sulfoxide reductase B     153   4e-43   
ref|WP_014165238.1|  PilB                                               154   4e-43   
ref|WP_005177175.1|  MULTISPECIES: peptide methionine sulfoxide r...    153   4e-43   
ref|WP_003240879.1|  MULTISPECIES: methionine sulfoxide reductase B     153   4e-43   
gb|EAW31708.1|  Conserved domain frequently associated with pepti...    153   4e-43   
ref|WP_015006968.1|  methionine sulfoxide reductase B                   153   4e-43   
ref|WP_005010896.1|  peptide methionine sulfoxide reductase msrB        153   4e-43   
ref|WP_040822454.1|  methionine sulfoxide reductase B                   153   5e-43   
ref|WP_020605809.1|  methionine sulfoxide reductase B                   153   5e-43   
ref|WP_024586469.1|  hypothetical protein                               153   5e-43   
ref|WP_008249155.1|  methionine sulfoxide reductase B                   153   5e-43   
ref|WP_037062192.1|  methionine sulfoxide reductase B                   153   5e-43   
ref|WP_010152196.1|  methionine sulfoxide reductase B                   153   5e-43   
ref|WP_041148768.1|  methionine sulfoxide reductase B                   152   5e-43   
ref|WP_008570447.1|  methionine sulfoxide reductase B                   152   6e-43   
ref|WP_031690818.1|  methionine sulfoxide reductase B                   152   6e-43   
ref|WP_019340707.1|  methionine sulfoxide reductase B                   152   6e-43   
ref|WP_013234224.1|  methionine sulfoxide reductase B                   152   6e-43   
ref|WP_016493215.1|  peptide methionine sulfoxide reductase MsrB        152   6e-43   
ref|WP_015286541.1|  methionine-R-sulfoxide reductase                   153   6e-43   
ref|WP_023001003.1|  MULTISPECIES: methionine sulfoxide reductase B     153   6e-43   
ref|WP_007983501.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_011127212.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_008002672.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_039621817.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_008059115.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_037042815.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|WP_028446644.1|  methionine sulfoxide reductase B                   152   7e-43   
ref|XP_002157838.1|  PREDICTED: peptide methionine sulfoxide redu...    154   8e-43   
ref|WP_004298623.1|  MULTISPECIES: methionine sulfoxide reductase B     152   8e-43   
ref|WP_002927317.1|  methionine-R-sulfoxide reductase                   152   8e-43   
ref|WP_014006380.1|  methionine sulfoxide reductase B                   152   8e-43   
ref|WP_030132314.1|  peptide methionine sulfoxide reductase             152   8e-43   
ref|WP_028081258.1|  methionine sulfoxide reductase B                   152   8e-43   
ref|WP_011001685.1|  peptide methionine sulfoxide reductase             152   8e-43   
ref|WP_011467647.1|  methionine sulfoxide reductase B                   152   8e-43   
ref|WP_008030359.1|  methionine sulfoxide reductase B                   152   8e-43   
ref|WP_002935528.1|  methionine-R-sulfoxide reductase                   152   8e-43   
ref|WP_020652394.1|  methionine sulfoxide reductase B                   152   8e-43   
ref|WP_015276621.1|  methionine-R-sulfoxide reductase                   152   9e-43   
ref|WP_020409758.1|  hypothetical protein                               152   9e-43   
ref|WP_020904691.1|  methionine-R-sulfoxide reductase                   152   9e-43   
ref|WP_037180537.1|  methionine sulfoxide reductase B                   152   9e-43   
ref|WP_026236210.1|  peptide methionine sulfoxide reductase             154   9e-43   
ref|WP_027999815.1|  methionine sulfoxide reductase B                   152   9e-43   
ref|WP_008049084.1|  methionine sulfoxide reductase B                   152   9e-43   
ref|WP_020175457.1|  hypothetical protein                               152   9e-43   
ref|WP_012700175.1|  methionine sulfoxide reductase B                   152   9e-43   
ref|WP_034257404.1|  hypothetical protein                               152   9e-43   
ref|WP_041468905.1|  peptide methionine sulfoxide reductase             152   1e-42   
ref|WP_015329382.1|  methionine-R-sulfoxide reductase                   152   1e-42   
ref|WP_019936306.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_006223781.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_044511445.1|  PilB                                               152   1e-42   
ref|WP_003280434.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_015421133.1|  methionine-R-sulfoxide reductase                   152   1e-42   
ref|WP_018066638.1|  hypothetical protein                               152   1e-42   
ref|WP_038982222.1|  peptide methionine sulfoxide reductase             152   1e-42   
ref|WP_016780012.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_027925731.1|  peptide methionine sulfoxide reductase             152   1e-42   
ref|WP_019988918.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_038345574.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_013715365.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_008009393.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_008610285.1|  MULTISPECIES: methionine sulfoxide reductase B     152   1e-42   
emb|CEI10717.1|  Peptide methionine sulfoxide reductase MsrB            152   1e-42   
ref|WP_007895036.1|  methionine sulfoxide reductase B                   152   1e-42   
gb|ACF12972.1|  methionine-R-sulfoxide reductase                        153   1e-42   
ref|WP_044617365.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_037000846.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_020748546.1|  methionine sulfoxide reductase                     151   1e-42   
ref|WP_042556664.1|  methionine sulfoxide reductase B                   152   1e-42   
ref|WP_007973511.1|  methionine sulfoxide reductase B                   151   1e-42   
gb|AJQ94950.1|  conserved domain frequently associated with pepti...    152   1e-42   
ref|WP_033973891.1|  methionine sulfoxide reductase B                   151   2e-42   
gb|ELR73742.1|  Peptide methionine sulfoxide reductase MsrB             153   2e-42   
ref|WP_043297300.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_014129806.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_027857665.1|  methionine sulfoxide reductase B                   152   2e-42   
ref|WP_011287637.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_010876350.1|  methionine sulfoxide reductase B                   152   2e-42   
ref|WP_025517979.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_034013392.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_028213104.1|  methionine sulfoxide reductase B                   152   2e-42   
ref|WP_044399717.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_008044361.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_020162746.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_016353668.1|  Peptide methionine sulfoxide reductase msrB        151   2e-42   
ref|WP_003287657.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_033534200.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_038017878.1|  peptide methionine sulfoxide reductase             151   2e-42   
ref|WP_008075667.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_036139751.1|  hypothetical protein                               153   2e-42   
ref|WP_004037981.1|  peptide methionine sulfoxide reductase             152   2e-42   
ref|WP_044530601.1|  methionine sulfoxide reductase B                   151   2e-42   
emb|CAP42050.1|  peptide methionine sulfoxide reductase                 152   2e-42   
ref|WP_028216403.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_004927532.1|  MULTISPECIES: methionine sulfoxide reductase B     151   2e-42   
gb|EDX85999.1|  methionine-R-sulfoxide reductase                        152   2e-42   
ref|WP_008983294.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_025167472.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_008042754.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_041862818.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_004937058.1|  peptide methionine sulfoxide reductase msrB        151   2e-42   
ref|WP_033059242.1|  peptide methionine sulfoxide reductase             151   2e-42   
ref|WP_027814676.1|  methionine sulfoxide reductase B                   151   2e-42   
ref|WP_007940018.1|  MULTISPECIES: methionine sulfoxide reductase B     151   2e-42   
ref|WP_008328575.1|  methionine sulfoxide reductase B                   151   3e-42   
ref|WP_027681409.1|  methionine sulfoxide reductase B                   151   3e-42   
ref|WP_028206993.1|  methionine sulfoxide reductase B                   151   3e-42   
ref|WP_005879439.1|  methionine sulfoxide reductase B                   151   3e-42   
ref|WP_020021820.1|  hypothetical protein                               150   3e-42   
ref|WP_008017189.1|  methionine sulfoxide reductase B                   151   3e-42   
gb|ABK18249.1|  methionine-R-sulfoxide reductase                        152   3e-42   
ref|WP_028939016.1|  peptide methionine sulfoxide reductase             151   3e-42   
ref|WP_011335291.1|  methionine sulfoxide reductase B                   150   3e-42   



>gb|KDO37773.1| hypothetical protein CISIN_1g028408mg [Citrus sinensis]
Length=209

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +1

Query  151  FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKK  330
            FV  +P L  P + +L V  ++  S   +    +        AE +  D++S+SDEEWK+
Sbjct  33   FVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNIQGIHLLSSAEANRVDYASISDEEWKR  92

Query  331  RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP  510
            RLTG+Q+YITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P
Sbjct  93   RLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQP  152

Query  511  VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +G+N+KSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  153  IGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLK  205



>ref|XP_006477977.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Citrus sinensis]
Length=201

 Score =   260 bits (664),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 8/173 (5%)
 Frame = +1

Query  151  FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKK  330
            FV  +P L  P + +L V  ++  S   +    +         E +  D++S+SDEEWK+
Sbjct  33   FVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNI--------QEANRVDYASISDEEWKR  84

Query  331  RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP  510
            RLTG+Q+YITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P
Sbjct  85   RLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQP  144

Query  511  VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +G+N+KSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  145  IGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLK  197



>gb|KDO37774.1| hypothetical protein CISIN_1g028408mg [Citrus sinensis]
Length=201

 Score =   259 bits (663),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 8/173 (5%)
 Frame = +1

Query  151  FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKK  330
            FV  +P L  P + +L V  ++  S   +    +         E +  D++S+SDEEWK+
Sbjct  33   FVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNI--------QEANRVDYASISDEEWKR  84

Query  331  RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP  510
            RLTG+Q+YITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P
Sbjct  85   RLTGEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQP  144

Query  511  VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +G+N+KSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  145  IGSNMKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLK  197



>ref|XP_002285647.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Vitis vinifera]
Length=198

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D++S+SDEEWKKRLTG+QFYITRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFE
Sbjct  65   EPGKVDYTSISDEEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTPGAYHCICCDTPLFE  124

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGK
Sbjct  125  SSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGK  184

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  185  RYCINSASLK  194



>emb|CBI20094.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   255 bits (652),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D++S+SDEEWKKRLTG+QFYITRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFE
Sbjct  16   EPGKVDYTSISDEEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTPGAYHCICCDTPLFE  75

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGK
Sbjct  76   SSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGK  135

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  136  RYCINSASLK  145



>ref|XP_010106737.1| Peptide methionine sulfoxide reductase [Morus notabilis]
 gb|EXC11704.1| Peptide methionine sulfoxide reductase [Morus notabilis]
Length=198

 Score =   257 bits (656),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            DF S+SDEEWKKRLTG+QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKF
Sbjct  70   DFKSISDEEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTPGTYHCMCCDTPLFESSTKF  129

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+GNNVKSKLDLSIIFMPR+EVLCAACDAHLGHVFDDGP PTGKRYCIN
Sbjct  130  DSGTGWPSYYQPIGNNVKSKLDLSIIFMPREEVLCAACDAHLGHVFDDGPPPTGKRYCIN  189

Query  655  SAALK  669
            SA+LK
Sbjct  190  SASLK  194



>ref|XP_006442225.1| hypothetical protein CICLE_v10022321mg [Citrus clementina]
 gb|ESR55465.1| hypothetical protein CICLE_v10022321mg [Citrus clementina]
Length=201

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 138/173 (80%), Gaps = 8/173 (5%)
 Frame = +1

Query  151  FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKK  330
            FV  +P L  P + +L V  ++  S   +    +         E +  D++S+SDEEWK 
Sbjct  33   FVSASPSLRRPKRVSLSVIRAMGSSASSQKPDNI--------QEANRVDYASISDEEWKG  84

Query  331  RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP  510
            RLTG+Q+YITRQKGTERAFTGEYW+TKT GTYHC+CCDTPLFESSTKFDSGTGWPSYY+P
Sbjct  85   RLTGEQYYITRQKGTERAFTGEYWNTKTAGTYHCICCDTPLFESSTKFDSGTGWPSYYQP  144

Query  511  VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +G+NVKSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  145  IGSNVKSKLDLSIIFMPRQEVLCAECDAHLGHVFDDGPPPTGKRYCINSASLK  197



>ref|XP_009625505.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Nicotiana tomentosiformis]
Length=223

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
              S  D+SSVSDEEW+K+LT +QF ITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFE
Sbjct  90   RASKVDYSSVSDEEWRKQLTKEQFNITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFE  149

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+PVGNNVKSK+DLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGK
Sbjct  150  SSTKFDSGTGWPSYYQPVGNNVKSKMDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGK  209

Query  640  RYCINSAALK  669
            RYCINSAALK
Sbjct  210  RYCINSAALK  219



>gb|ABO64857.1| methionine-R-sulfoxide reductase B4 protein [Capsicum annuum]
Length=148

 Score =   253 bits (645),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS  465
            S  D+SS+SDEEWKK+LT +QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESS
Sbjct  17   SQIDYSSISDEEWKKQLTNEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESS  76

Query  466  TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY  645
            TKFDSGTGWPSYY+P+GNNVKSK+DLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRY
Sbjct  77   TKFDSGTGWPSYYQPIGNNVKSKMDLSIIFMPRQEVLCAGCDAHLGHVFDDGPPPTGKRY  136

Query  646  CINSAALK  669
            CINSAALK
Sbjct  137  CINSAALK  144



>ref|XP_010247423.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Nelumbo nucifera]
Length=193

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 141/172 (82%), Gaps = 7/172 (4%)
 Frame = +1

Query  175  LHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYA-------EVSNKDFSSVSDEEWKKR  333
            +H  ++  + S+  +L+   R+SH V     +  +       E S+  ++S+S+EEWKKR
Sbjct  18   VHNTRSRSRFSIFPALNKSPRLSHSVRVMGSYASSQKPDNVQEASSIGYASISEEEWKKR  77

Query  334  LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV  513
            LT +QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P+
Sbjct  78   LTKEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPL  137

Query  514  GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            GNNVKSKLDLSIIFMPRQEVLC+ CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  138  GNNVKSKLDLSIIFMPRQEVLCSVCDAHLGHVFDDGPPPTGKRYCINSASLK  189



>ref|XP_006348344.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Solanum tuberosum]
Length=198

 Score =   253 bits (645),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
             S  D+SSVSDEEWKK+LT +QFYITRQKGTERAFTGEYW++KTPGTYHC+CCDTPLFES
Sbjct  66   ASKMDYSSVSDEEWKKKLTNEQFYITRQKGTERAFTGEYWNSKTPGTYHCICCDTPLFES  125

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
            STKFDSGTGWPSYY+P+ NNVKSK+DLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGKR
Sbjct  126  STKFDSGTGWPSYYQPIDNNVKSKMDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGKR  185

Query  643  YCINSAALK  669
            YCINSA+LK
Sbjct  186  YCINSASLK  194



>ref|XP_004244304.2| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Solanum lycopersicum]
Length=192

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS  465
            S  D+SS+SDEEWKK+LT +QFYITRQKGTERAFTGEYW++KTPGTYHC+CCDTPLFESS
Sbjct  61   SKMDYSSISDEEWKKKLTNEQFYITRQKGTERAFTGEYWNSKTPGTYHCICCDTPLFESS  120

Query  466  TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY  645
            TKFDSGTGWPSYY+P+ NNVKSK+DLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGKRY
Sbjct  121  TKFDSGTGWPSYYQPIDNNVKSKMDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGKRY  180

Query  646  CINSAALK  669
            CINSA+LK
Sbjct  181  CINSASLK  188



>ref|XP_011082814.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Sesamum indicum]
Length=200

 Score =   252 bits (644),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +1

Query  289  NKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESST  468
            N ++SSVSDEEW+K+LT QQFY+TRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESST
Sbjct  70   NTNYSSVSDEEWRKQLTDQQFYVTRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESST  129

Query  469  KFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC  648
            KFDSGTGWPSYY+P+ NNVKSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKRYC
Sbjct  130  KFDSGTGWPSYYQPIRNNVKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYC  189

Query  649  INSAALK  669
            INSA+LK
Sbjct  190  INSASLK  196



>gb|AEA72443.1| chloroplast methionine sulfoxide reductase B1, partial [Carica 
papaya]
Length=199

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D++S +D+EWKKRLTG+QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKF
Sbjct  70   DYASWTDDEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKF  129

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PVGNNVKSKLDLSIIFMPRQEVLC+ CDAHLGHVFDDGP PTGKRYCIN
Sbjct  130  DSGTGWPSYYEPVGNNVKSKLDLSIIFMPRQEVLCSVCDAHLGHVFDDGPPPTGKRYCIN  189

Query  655  SAALK  669
            SAAL+
Sbjct  190  SAALR  194



>ref|XP_011029532.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Populus euphratica]
Length=198

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +++SVSDEEWKK+LT ++FYITRQKGTERAF GEYW+TKTPGTYHC+CC+TPLFESSTKF
Sbjct  70   NYASVSDEEWKKKLTAEEFYITRQKGTERAFNGEYWNTKTPGTYHCICCNTPLFESSTKF  129

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGKRYCIN
Sbjct  130  DSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGKRYCIN  189

Query  655  SAALK  669
            SA+LK
Sbjct  190  SASLK  194



>ref|XP_007022197.1| Methionine sulfoxide reductase B 1 isoform 1 [Theobroma cacao]
 gb|EOY13722.1| Methionine sulfoxide reductase B 1 isoform 1 [Theobroma cacao]
Length=224

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  169  LLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQ  348
            +L  P Q +  V    S ++ +R  +           E S  D+ SVSDEEWKK LT +Q
Sbjct  63   VLKKPRQVSFSVRSMGSFASSQRPDNV---------REPSAVDYVSVSDEEWKKMLTPEQ  113

Query  349  FYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVK  528
            FYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P+GNNVK
Sbjct  114  FYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGNNVK  173

Query  529  SKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PT KRYCINSA+LK
Sbjct  174  SKLDLSIIFMPRQEVLCATCDAHLGHVFDDGPRPTRKRYCINSASLK  220



>gb|KDP24711.1| hypothetical protein JCGZ_25702 [Jatropha curcas]
Length=199

 Score =   250 bits (638),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 139/184 (76%), Gaps = 15/184 (8%)
 Frame = +1

Query  151  FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVY-----------DSLHFFYAEVSNKD  297
            F+ W     +P  + L    + +    KR+S  +            D++     E    D
Sbjct  16   FISWKTQFQNPVNSKLLALPAAAFGVPKRVSFSLRAMGSSASSQRPDNIQ----EAGKVD  71

Query  298  FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD  477
            ++SV+D+EWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFES TKFD
Sbjct  72   YTSVADDEWKKRLTAEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESFTKFD  131

Query  478  SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINS  657
            SGTGWPSYY+PVG+NVKSKLDLSIIFMPRQEV+CA CDAHLGHVFDDGP PTGKRYCINS
Sbjct  132  SGTGWPSYYQPVGSNVKSKLDLSIIFMPRQEVVCAVCDAHLGHVFDDGPPPTGKRYCINS  191

Query  658  AALK  669
            A+LK
Sbjct  192  ASLK  195



>ref|XP_010060768.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67624.1| hypothetical protein EUGRSUZ_F01375 [Eucalyptus grandis]
 gb|KCW67625.1| hypothetical protein EUGRSUZ_F01375 [Eucalyptus grandis]
Length=195

 Score =   249 bits (637),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            SVSDEEWKKRLT +Q+Y+ RQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFES+TKFDSG
Sbjct  70   SVSDEEWKKRLTPEQYYVARQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFESNTKFDSG  129

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
            TGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGH+FDDGP PTGKRYCINSA+
Sbjct  130  TGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHIFDDGPPPTGKRYCINSAS  189

Query  664  LK  669
            LK
Sbjct  190  LK  191



>ref|XP_008452428.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X2 [Cucumis melo]
Length=144

 Score =   247 bits (631),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
            AE    D+ S+SD+EWKKRLTG+QFYITRQKGTERAFTGEYW+TKT G YHC+CCDTPLF
Sbjct  9    AEAGTVDYKSLSDDEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTAGLYHCICCDTPLF  68

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
            ESSTKFDSGTGWPSYY+P+G+NVKSKLDLSIIFMPR+EVLCA CDAHLGHVFDDGP PTG
Sbjct  69   ESSTKFDSGTGWPSYYQPIGDNVKSKLDLSIIFMPREEVLCAVCDAHLGHVFDDGPPPTG  128

Query  637  KRYCINSAALK  669
            KRYCINSAALK
Sbjct  129  KRYCINSAALK  139



>ref|XP_009404405.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=199

 Score =   249 bits (636),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E +N + +S+SDEEWKK+LT +Q+YITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFE
Sbjct  66   EPANVNPASLSDEEWKKQLTNEQYYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFE  125

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            S+TKFDSGTGWPSYY+P+GNNVKSKLD+SIIFMPR EVLCAACDAHLGHVFDDGP PTGK
Sbjct  126  SNTKFDSGTGWPSYYEPIGNNVKSKLDMSIIFMPRTEVLCAACDAHLGHVFDDGPPPTGK  185

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  186  RYCINSASLK  195



>ref|XP_008452427.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X1 [Cucumis melo]
Length=203

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D+ S+SD+EWKKRLTG+QFYITRQKGTERAFTGEYW+TKT G YHC+CCDTPLFE
Sbjct  69   EAGTVDYKSLSDDEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTAGLYHCICCDTPLFE  128

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+G+NVKSKLDLSIIFMPR+EVLCA CDAHLGHVFDDGP PTGK
Sbjct  129  SSTKFDSGTGWPSYYQPIGDNVKSKLDLSIIFMPREEVLCAVCDAHLGHVFDDGPPPTGK  188

Query  640  RYCINSAALK  669
            RYCINSAALK
Sbjct  189  RYCINSAALK  198



>ref|XP_002316875.2| hypothetical protein POPTR_0011s11490g [Populus trichocarpa]
 gb|EEE97487.2| hypothetical protein POPTR_0011s11490g [Populus trichocarpa]
Length=150

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  271  FYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTP  450
            F+ E  + +++SVSD EWKK+LT ++FY+TRQKGTERAF+GEYW+TKTPGTYHC+CC+TP
Sbjct  14   FFLETGDVNYASVSDGEWKKKLTAEEFYVTRQKGTERAFSGEYWNTKTPGTYHCICCNTP  73

Query  451  LFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP  630
            LFESSTKFD GTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP P
Sbjct  74   LFESSTKFDRGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPP  133

Query  631  TGKRYCINSAALK  669
            TGKRYCINSA+LK
Sbjct  134  TGKRYCINSASLK  146



>ref|XP_009794646.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Nicotiana sylvestris]
Length=198

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
             S   +SSVSDEEW+K+LT +QFYITRQKGTERAFTGEYW+TKTPGTYHCVCCDT LFES
Sbjct  66   ASKVGYSSVSDEEWRKQLTNEQFYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTLLFES  125

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
            STKFDSGTGWPSYY+PV NNVKSK+DLSIIFMPRQEV+CA CDAHLGHVFDDGP PTGKR
Sbjct  126  STKFDSGTGWPSYYQPVDNNVKSKMDLSIIFMPRQEVVCAVCDAHLGHVFDDGPPPTGKR  185

Query  643  YCINSAALK  669
            YCINSAALK
Sbjct  186  YCINSAALK  194


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  93   LFSLAFGSFNKPRNKVSFLIRGMGSSASSPKPDSAQGLS  209
            L  + FG+ N+PR+++S  IR MGSSASS KPDSAQG S
Sbjct  29   LSCVTFGALNRPRSRISVSIRAMGSSASSQKPDSAQGAS  67



>gb|ABU49227.1| chloroplast methionine sulfoxide reductase B1 precursor [Nicotiana 
tabacum]
Length=195

 Score =   247 bits (631),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  298  FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD  477
            +SSVSDEEW+K+LT +QFYITRQKGTERAFTGEYW+TKTPGTYHCVCCDT LFESSTKFD
Sbjct  68   YSSVSDEEWRKQLTNEQFYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTLLFESSTKFD  127

Query  478  SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINS  657
            SGTGWPSYY+PV NNVKSK+DLSIIFMPRQEV+CA CDAHLGHVFDDGP PTGKRYCINS
Sbjct  128  SGTGWPSYYQPVDNNVKSKMDLSIIFMPRQEVVCAVCDAHLGHVFDDGPPPTGKRYCINS  187

Query  658  AALK  669
            AALK
Sbjct  188  AALK  191


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  93   LFSLAFGSFNKPRNKVSFLIRGMGSSASSPKPDSAQGLS  209
            L  + FG+ N+PR+++S  IR MGSSASS KPDSAQG S
Sbjct  26   LSCVTFGALNRPRSRISVSIRAMGSSASSQKPDSAQGAS  64



>ref|XP_007133364.1| hypothetical protein PHAVU_011G173000g [Phaseolus vulgaris]
 gb|ESW05358.1| hypothetical protein PHAVU_011G173000g [Phaseolus vulgaris]
Length=200

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S+SDEEWKKRLT +QFYITRQKGTERAF+GEYW+TKTPG YHC+CCDTPLFESSTKF
Sbjct  71   DYKSLSDEEWKKRLTNEQFYITRQKGTERAFSGEYWNTKTPGNYHCICCDTPLFESSTKF  130

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            +SGTGWPSYY+P+GNNVKSK+DLSIIFMPRQEVLCAACDAHLGHVF+DGP PTGKRYCIN
Sbjct  131  NSGTGWPSYYQPLGNNVKSKMDLSIIFMPRQEVLCAACDAHLGHVFEDGPPPTGKRYCIN  190

Query  655  SAALK  669
            SA+LK
Sbjct  191  SASLK  195



>gb|EYU38232.1| hypothetical protein MIMGU_mgv1a021016mg, partial [Erythranthe 
guttata]
Length=134

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
            KD+SSVSD+EWKK+LT QQFY+TRQKGTERAFTGEYW+TKTPGTY C+CCDTPLFESSTK
Sbjct  5    KDYSSVSDKEWKKQLTDQQFYVTRQKGTERAFTGEYWNTKTPGTYSCICCDTPLFESSTK  64

Query  472  FDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI  651
            FDSGTGWPSYY+P+GNNVKSKLDLSIIFMPRQEV+CA CDAHLGH+FDDGP PTGKRYCI
Sbjct  65   FDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVVCAVCDAHLGHIFDDGPPPTGKRYCI  124

Query  652  NSAALK  669
            NS +LK
Sbjct  125  NSVSLK  130



>emb|CDP06068.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
             SN D+SS+S+EEWKK+LT +QF+ITRQKGTERAFTGEYW+TKTPGTYHC+CC+TPLFES
Sbjct  16   TSNVDYSSLSEEEWKKQLTEEQFHITRQKGTERAFTGEYWNTKTPGTYHCICCETPLFES  75

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
            STKFDSGTGWPSYYKP+GNNVKSKLDLSIIFMPRQEVLCA C AHLGHVFDDGP PTG R
Sbjct  76   STKFDSGTGWPSYYKPIGNNVKSKLDLSIIFMPRQEVLCAVCGAHLGHVFDDGPPPTGNR  135

Query  643  YCINSAALK  669
            YCINSA+LK
Sbjct  136  YCINSASLK  144



>ref|XP_004291795.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=198

 Score =   247 bits (630),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ SVS++EWKK+LT +QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLFESSTKF
Sbjct  66   DYKSVSNDEWKKKLTKEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFESSTKF  125

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+GNNVKSKLDLSII MPRQEVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  126  DSGTGWPSYYQPIGNNVKSKLDLSIIIMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCIN  185

Query  655  SAALK  669
            SA+LK
Sbjct  186  SASLK  190



>gb|KGN55021.1| hypothetical protein Csa_4G622800 [Cucumis sativus]
Length=204

 Score =   247 bits (630),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    ++ S+SD+EWKKRLTG+QFYITRQKGTERAFTGEYW+TKT G YHC+CCDTPLFE
Sbjct  70   EAGTVNYKSLSDDEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTAGIYHCICCDTPLFE  129

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+PVG+NVKSKLDLSIIFMPR+EVLCA CDAHLGHVF+DGP PTGK
Sbjct  130  SSTKFDSGTGWPSYYQPVGDNVKSKLDLSIIFMPREEVLCAVCDAHLGHVFNDGPPPTGK  189

Query  640  RYCINSAALK  669
            RYCINSAALK
Sbjct  190  RYCINSAALK  199



>ref|XP_009147587.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Brassica rapa]
 emb|CDY24080.1| BnaA06g00780D [Brassica napus]
Length=204

 Score =   247 bits (630),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 6/166 (4%)
 Frame = +1

Query  172  LLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQF  351
            L  P    L V L  S+ ++   S    D++     E +  DF+S+S+ EWKKRLT +Q+
Sbjct  36   LTKPRNLNLSVLLRCSMGSFN--SSQKSDNVQ----EAAKSDFASISEGEWKKRLTPEQY  89

Query  352  YITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKS  531
            YITRQKGTERAFTGEYW+TKTPG Y C+CCDTPLF+SSTKFDSGTGWPSYY+P+GNNVKS
Sbjct  90   YITRQKGTERAFTGEYWNTKTPGVYKCICCDTPLFDSSTKFDSGTGWPSYYQPIGNNVKS  149

Query  532  KLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGKRYC+NSAALK
Sbjct  150  KLDLSIIFMPRQEVICAVCNAHLGHVFDDGPRPTGKRYCLNSAALK  195



>emb|CDY45127.1| BnaC06g06480D [Brassica napus]
Length=204

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 134/166 (81%), Gaps = 6/166 (4%)
 Frame = +1

Query  172  LLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQF  351
            L  P    L V L  S+ ++   S    D++     E +  DF+S+S+ EWKKRLT +Q+
Sbjct  36   LTKPRNLNLSVLLRCSMGSFN--SSQKSDNVQ----EAAKSDFASISEGEWKKRLTPEQY  89

Query  352  YITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKS  531
            YITRQKGTERAFTGEYW+TKTPG Y C+CCDTPLF+SSTKFDSGTGWPSYY+P+GNNVKS
Sbjct  90   YITRQKGTERAFTGEYWNTKTPGVYKCICCDTPLFDSSTKFDSGTGWPSYYQPIGNNVKS  149

Query  532  KLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGKRYC+NSAALK
Sbjct  150  KLDLSIIFMPRQEVICAVCNAHLGHVFDDGPRPTGKRYCLNSAALK  195



>gb|KCW67623.1| hypothetical protein EUGRSUZ_F01375 [Eucalyptus grandis]
Length=195

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            SVSDEEWKKRLT +Q+Y+ RQKGTERAFTG YW+TKTPGTYHCVCCDTPLFES+TKFDSG
Sbjct  70   SVSDEEWKKRLTPEQYYVARQKGTERAFTGYYWNTKTPGTYHCVCCDTPLFESNTKFDSG  129

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
            TGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGH+FDDGP PTGKRYCINSA+
Sbjct  130  TGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHIFDDGPPPTGKRYCINSAS  189

Query  664  LK  669
            LK
Sbjct  190  LK  191



>gb|KJB26990.1| hypothetical protein B456_004G270500 [Gossypium raimondii]
Length=202

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
            AE +  D++S+SDEEWKKRLT +QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLF
Sbjct  68   AETAAVDYTSLSDEEWKKRLTPEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLF  127

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
            +S TKFDSGTGWPSYY+P+G NV+SKLDLSIIFMPR+EVLCA C AHLGHVFDDGP PTG
Sbjct  128  KSLTKFDSGTGWPSYYQPIGKNVQSKLDLSIIFMPREEVLCATCGAHLGHVFDDGPPPTG  187

Query  637  KRYCINSAALK  669
            KRYCINSA+LK
Sbjct  188  KRYCINSASLK  198



>ref|XP_010916095.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=199

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +++S+SDEEWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFE
Sbjct  66   EPGQVNYASLSDEEWKKRLTQEQYYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFE  125

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            S TKFDSGTGWPSYY+P+GNNVKSKLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGK
Sbjct  126  SGTKFDSGTGWPSYYEPIGNNVKSKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPPPTGK  185

Query  640  RYCINSAALK  669
            RYCINSA++K
Sbjct  186  RYCINSASVK  195



>ref|XP_008784388.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=199

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +++S+SDEEWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFE
Sbjct  66   EPGQVNYASLSDEEWKKRLTQEQYYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFE  125

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            S TKFDSGTGWPSYY+P+GNNVKSKLD+SIIFMPR EV+CA CDAHLGHVFDDGP PTGK
Sbjct  126  SRTKFDSGTGWPSYYEPIGNNVKSKLDMSIIFMPRTEVICAVCDAHLGHVFDDGPPPTGK  185

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  186  RYCINSASLK  195



>ref|XP_008784389.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=197

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +++S+SDEEWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFES TKF
Sbjct  69   NYASLSDEEWKKRLTQEQYYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFESRTKF  128

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+GNNVKSKLD+SIIFMPR EV+CA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  129  DSGTGWPSYYEPIGNNVKSKLDMSIIFMPRTEVICAVCDAHLGHVFDDGPPPTGKRYCIN  188

Query  655  SAALK  669
            SA+LK
Sbjct  189  SASLK  193



>ref|XP_010534997.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Tarenaya hassleriana]
Length=196

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            +    DF+S++++EWKK+LT +Q+YITRQKGTERAFTGEYWDTKTPG YHC+CCDTPLFE
Sbjct  62   DTRKNDFTSLNEDEWKKQLTSEQYYITRQKGTERAFTGEYWDTKTPGVYHCICCDTPLFE  121

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYYKP+G+NVK+KLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGK
Sbjct  122  SSTKFDSGTGWPSYYKPIGDNVKTKLDLSIIFMPRQEVLCAICDAHLGHVFDDGPPPTGK  181

Query  640  RYCINSAALK  669
            R+CINSA+LK
Sbjct  182  RFCINSASLK  191



>ref|XP_010916096.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=197

 Score =   245 bits (626),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +++S+SDEEWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFES TKF
Sbjct  69   NYASLSDEEWKKRLTQEQYYITRQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFESGTKF  128

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+GNNVKSKLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  129  DSGTGWPSYYEPIGNNVKSKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPPPTGKRYCIN  188

Query  655  SAALK  669
            SA++K
Sbjct  189  SASVK  193



>gb|ABK95006.1| unknown [Populus trichocarpa]
Length=147

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +++SVSD EWKK+LT ++FY+TRQKGTERAF+GEYW+TKTPGTYHC+CC+TPLFESSTKF
Sbjct  19   NYASVSDGEWKKKLTAEEFYVTRQKGTERAFSGEYWNTKTPGTYHCICCNTPLFESSTKF  78

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            D GTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGKRYCIN
Sbjct  79   DRGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGKRYCIN  138

Query  655  SAALK  669
            SA+LK
Sbjct  139  SASLK  143



>ref|XP_004146010.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004173106.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Cucumis sativus]
Length=150

 Score =   243 bits (620),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    ++ S+SD+EWKKRLTG+QFYITRQKGTERAFTGEYW+TKT G YHC+CCDTPLFE
Sbjct  16   EAGTVNYKSLSDDEWKKRLTGEQFYITRQKGTERAFTGEYWNTKTAGIYHCICCDTPLFE  75

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+PVG+NVKSKLDLSIIFMPR+EVLCA CDAHLGHVF+DGP PTGK
Sbjct  76   SSTKFDSGTGWPSYYQPVGDNVKSKLDLSIIFMPREEVLCAVCDAHLGHVFNDGPPPTGK  135

Query  640  RYCINSAALK  669
            RYCINSAALK
Sbjct  136  RYCINSAALK  145



>ref|XP_007212100.1| hypothetical protein PRUPE_ppa011768mg [Prunus persica]
 gb|EMJ13299.1| hypothetical protein PRUPE_ppa011768mg [Prunus persica]
Length=197

 Score =   244 bits (624),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D+ SVSD+EWKKRLT +QFYITR+KGTERAFTGEYW+TKT GTYHC+CCDTPLFE
Sbjct  64   ETGVVDYKSVSDQEWKKRLTQEQFYITRKKGTERAFTGEYWNTKTQGTYHCICCDTPLFE  123

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVKSKLDLSII MPR EVLCAACDAHLGHVFDDGP PTGK
Sbjct  124  SSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIIMPRTEVLCAACDAHLGHVFDDGPPPTGK  183

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  184  RYCINSASLK  193



>ref|XP_010479944.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Camelina sativa]
Length=201

 Score =   244 bits (624),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    DF+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+C+CCDTPLF+
Sbjct  63   EAEKSDFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCICCDTPLFD  122

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  123  SSTKFDSGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  182

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  183  RYCLNSAALK  192



>ref|XP_008226361.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Prunus mume]
Length=198

 Score =   244 bits (623),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    ++ S+SD+EWKKRLT +QFYITRQKGTERAFTGEYW+TKT GTYHC+CCDTPLFE
Sbjct  65   ETGVVEYKSLSDQEWKKRLTQEQFYITRQKGTERAFTGEYWNTKTQGTYHCICCDTPLFE  124

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVKSKLDLSII MPR EVLCAACDAHLGHVFDDGP PTGK
Sbjct  125  SSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIIMPRTEVLCAACDAHLGHVFDDGPPPTGK  184

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  185  RYCINSASLK  194



>ref|XP_006392767.1| hypothetical protein EUTSA_v10012040mg [Eutrema salsugineum]
 gb|ESQ30053.1| hypothetical protein EUTSA_v10012040mg [Eutrema salsugineum]
Length=266

 Score =   246 bits (629),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    DF+S+S++EWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPG Y CVCCDTPLF+
Sbjct  128  EAEKSDFASLSEDEWKKRLTPEQYYITRQKGTERAFTGEYWNTKTPGVYKCVCCDTPLFD  187

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKF+SGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEVLCA C+AHLGHVFDDGP PTGK
Sbjct  188  SSTKFESGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVLCAVCNAHLGHVFDDGPRPTGK  247

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  248  RYCLNSAALK  257



>gb|KFK35681.1| hypothetical protein AALP_AA4G023400 [Arabis alpina]
Length=154

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    DF+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW+TKTPG Y+CVCCDTPLF+
Sbjct  16   EAEKSDFASLSENEWKKRLTQEQYYITRQKGTERAFTGEYWNTKTPGVYNCVCCDTPLFD  75

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKF+SGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  76   SSTKFESGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  135

Query  640  RYCINSAALK  669
            RYC+NSAAL+
Sbjct  136  RYCLNSAALR  145



>ref|XP_010694740.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=200

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E S  D+SS+++E+WK RLT QQFYI RQKGTERAFTGEYW+TKTPG YHCV CDTPLFE
Sbjct  63   EASKTDYSSLTEEDWKTRLTPQQFYICRQKGTERAFTGEYWNTKTPGIYHCVGCDTPLFE  122

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+ +GNNVK+KLDLSIIFMPRQEVLCAACDAHLGHVFDDGP PTGK
Sbjct  123  SSTKFDSGTGWPSYYETIGNNVKTKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPPTGK  182

Query  640  RYCINSAALK  669
            RYCINSAALK
Sbjct  183  RYCINSAALK  192



>ref|XP_010462273.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Camelina sativa]
Length=201

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    DF+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+C+CCDTPLF+
Sbjct  63   EAEKSDFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCICCDTPLFD  122

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  123  SSTKFDSGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  182

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  183  RYCLNSAALK  192



>ref|XP_002436788.1| hypothetical protein SORBIDRAFT_10g008790 [Sorghum bicolor]
 gb|EER88155.1| hypothetical protein SORBIDRAFT_10g008790 [Sorghum bicolor]
Length=221

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D++S+S+EEWKKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKF
Sbjct  85   DYTSLSEEEWKKRLTKEQYYVTRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKF  144

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYYKP+G NVKSKLD+SIIFMPR EVLCAACDAHLGHVFDDGP PTG+RYCIN
Sbjct  145  DSGTGWPSYYKPIGENVKSKLDMSIIFMPRTEVLCAACDAHLGHVFDDGPPPTGQRYCIN  204

Query  655  SAALK  669
            SA+LK
Sbjct  205  SASLK  209



>gb|KHG14488.1| Peptide methionine sulfoxide reductase B1, chloroplastic [Gossypium 
arboreum]
Length=202

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
            AE +  D++S+SDEEWK RLT +QFYITRQKGTERAFTGEYW+TKT GTYHC+CCDTPLF
Sbjct  68   AETAAVDYTSLSDEEWKNRLTPEQFYITRQKGTERAFTGEYWNTKTLGTYHCICCDTPLF  127

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
            ES TKFDSGTGWPSYY+P+G NVKSKLDLSIIFMPR+EVLCA C AHLGHVFDDGP PTG
Sbjct  128  ESFTKFDSGTGWPSYYQPIGKNVKSKLDLSIIFMPREEVLCATCGAHLGHVFDDGPPPTG  187

Query  637  KRYCINSAALK  669
            KRYCINSA+LK
Sbjct  188  KRYCINSASLK  198



>gb|KCW67626.1| hypothetical protein EUGRSUZ_F01375 [Eucalyptus grandis]
Length=187

 Score =   242 bits (618),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            SVSDEEWKKRLT +Q+Y+ RQKGTERAFTGEYW+TKTPGTYHCVCCDTPLFES+TKFDSG
Sbjct  70   SVSDEEWKKRLTPEQYYVARQKGTERAFTGEYWNTKTPGTYHCVCCDTPLFESNTKFDSG  129

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            TGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGH+FDDGP PTGKRYCIN
Sbjct  130  TGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHIFDDGPPPTGKRYCIN  186



>ref|NP_001239824.1| uncharacterized protein LOC100798757 [Glycine max]
 gb|ACU20540.1| unknown [Glycine max]
 gb|KHM98858.1| Peptide methionine sulfoxide reductase B1, chloroplastic [Glycine 
soja]
Length=202

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S++DEEWKKRLT +QFYITRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFESSTKF
Sbjct  73   DYKSLTDEEWKKRLTNEQFYITRQKGTERAFTGEYWNTKTPGIYHCICCDTPLFESSTKF  132

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            +SGTGWPSYY+ +G NVKSKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PTGKR+CIN
Sbjct  133  NSGTGWPSYYQTIGKNVKSKLDLSIIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRFCIN  192

Query  655  SAALK  669
            SAALK
Sbjct  193  SAALK  197



>ref|XP_002891765.1| hypothetical protein ARALYDRAFT_892417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68024.1| hypothetical protein ARALYDRAFT_892417 [Arabidopsis lyrata subsp. 
lyrata]
Length=201

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D++S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct  63   EAEKSDYASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD  122

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  123  SSTKFDSGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  182

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  183  RYCLNSAALK  192



>ref|NP_564640.2| peptide methionine sulfoxide reductase B1 [Arabidopsis thaliana]
 sp|Q9C8M2.1|MSRB1_ARATH RecName: Full=Peptide methionine sulfoxide reductase B1, chloroplastic; 
Short=AtMSRB1; AltName: Full=Peptide-methionine (R)-S-oxide 
reductase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51964.1|AC024260_2 transcriptional regulator, putative; 35498-34111 [Arabidopsis 
thaliana]
 gb|AEE32979.1| peptide methionine sulfoxide reductase B1 [Arabidopsis thaliana]
Length=202

 Score =   242 bits (618),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct  64   EAEKNEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD  123

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  124  SSTKFDSGTGWPSYYQPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  183

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  184  RYCLNSAALK  193



>gb|AAM65202.1| transcriptional regulator, putative [Arabidopsis thaliana]
 dbj|BAC41985.1| putative transcriptional regulator [Arabidopsis thaliana]
Length=153

 Score =   240 bits (612),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct  15   EAEKNEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD  74

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYY+P+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  75   SSTKFDSGTGWPSYYQPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  134

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  135  RYCLNSAALK  144



>gb|AFK44288.1| unknown [Lotus japonicus]
Length=201

 Score =   241 bits (616),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S+S++EWKKRLT +QFY+TRQKGTERAFTGEYW+TKTPGTY+C+CCDTPLFESS+KF
Sbjct  72   DYKSLSNDEWKKRLTNEQFYVTRQKGTERAFTGEYWNTKTPGTYNCICCDTPLFESSSKF  131

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            +SGTGWPSY +P+GNNVKSKLDLS+IFMPRQEVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  132  NSGTGWPSYDQPIGNNVKSKLDLSVIFMPRQEVLCAVCDAHLGHVFDDGPPPTGKRYCIN  191

Query  655  SAALK  669
            SA+LK
Sbjct  192  SASLK  196



>ref|XP_004987307.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Setaria italica]
Length=254

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
             +   K  +S+++EEWKKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHCVCCDTPLF
Sbjct  120  GQAQEKANTSLTEEEWKKRLTKEQYYVTRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLF  179

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
            ESSTKFDSGTGWPSYYKP+G+NVKSKLD+SIIFMPR EVLCAACDAHLGHVFDDGP PTG
Sbjct  180  ESSTKFDSGTGWPSYYKPIGDNVKSKLDMSIIFMPRTEVLCAACDAHLGHVFDDGPPPTG  239

Query  637  KRYCINSAALK  669
            KRYCINSA+LK
Sbjct  240  KRYCINSASLK  250



>gb|AFK39115.1| unknown [Medicago truncatula]
 gb|AFK41720.1| unknown [Medicago truncatula]
 gb|KEH19470.1| methionine sulfoxide reductase B 2 [Medicago truncatula]
Length=204

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = +1

Query  118  LTNQEI-KFPS*FVVWAPLLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNK  294
            L N +I KF S  ++W P  LH   T  K+S S+        S+    +     +  S  
Sbjct  17   LPNTQIQKFDSKLLLW-PSRLHTKPTT-KLSSSIRAMGSSASSNSNNPNTTEIQSGSSPV  74

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S+SD EWKK+LT +QFY+TR+KGTERAFTGEYW+TKT GTYHC+CCDTPLFESSTKF
Sbjct  75   DYKSLSDAEWKKQLTDEQFYVTRKKGTERAFTGEYWNTKTEGTYHCICCDTPLFESSTKF  134

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            +SGTGWPSYY+P+G NVKSKLDLSIIFMPRQEVLCA CDAHLGH+FDDGP PTGKRYCIN
Sbjct  135  NSGTGWPSYYQPIGKNVKSKLDLSIIFMPRQEVLCAVCDAHLGHIFDDGPPPTGKRYCIN  194

Query  655  SAALK  669
            SA+LK
Sbjct  195  SASLK  199



>ref|XP_006377756.1| hypothetical protein POPTR_0011s11490g [Populus trichocarpa]
 gb|ERP55553.1| hypothetical protein POPTR_0011s11490g [Populus trichocarpa]
Length=142

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +1

Query  271  FYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTP  450
            F+ E  + +++SVSD EWKK+LT ++FY+TRQKGTERAF+GEYW+TKTPGTYHC+CC+TP
Sbjct  14   FFLETGDVNYASVSDGEWKKKLTAEEFYVTRQKGTERAFSGEYWNTKTPGTYHCICCNTP  73

Query  451  LFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP  630
            LFESSTKFD GTGWPSYY+P+GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP P
Sbjct  74   LFESSTKFDRGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPPP  133

Query  631  TGKRYCIN  654
            TGKRYCIN
Sbjct  134  TGKRYCIN  141



>ref|XP_010501027.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Camelina sativa]
Length=201

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++K PG Y+C+CCDTPLF+
Sbjct  63   EAEKSEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKIPGVYNCICCDTPLFD  122

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKFDSGTGWPSYYKP+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  123  SSTKFDSGTGWPSYYKPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  182

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  183  RYCLNSAALK  192



>ref|XP_004513790.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Cicer arietinum]
Length=206

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  298  FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD  477
            + S+SDEEWKKRLT +QFY+TR+KGTERAFTGEYW+TKT G+Y+C+CCDTPLFESSTKF+
Sbjct  78   YKSLSDEEWKKRLTDEQFYVTRKKGTERAFTGEYWNTKTEGSYNCICCDTPLFESSTKFN  137

Query  478  SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINS  657
            SGTGWPSYYKP+GNNVKSKLDLSIIFMPRQEV+CA CDAHLGH+FDDGP PTGKRYCINS
Sbjct  138  SGTGWPSYYKPIGNNVKSKLDLSIIFMPRQEVVCAVCDAHLGHMFDDGPPPTGKRYCINS  197

Query  658  AALK  669
            A+LK
Sbjct  198  ASLK  201



>gb|KJB26991.1| hypothetical protein B456_004G270500 [Gossypium raimondii]
Length=194

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
            AE +  D++S+SDEEWKKRLT +QFYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLF
Sbjct  68   AETAAVDYTSLSDEEWKKRLTPEQFYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLF  127

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
            +S TKFDSGTGWPSYY+P+G NV+SKLDLSIIFMPR+EVLCA C AHLGHVFDDGP PTG
Sbjct  128  KSLTKFDSGTGWPSYYQPIGKNVQSKLDLSIIFMPREEVLCATCGAHLGHVFDDGPPPTG  187

Query  637  KRYCIN  654
            KRYCIN
Sbjct  188  KRYCIN  193



>ref|NP_001148408.1| peptide methionine sulfoxide reductase msrB [Zea mays]
 gb|ACG31366.1| peptide methionine sulfoxide reductase msrB [Zea mays]
 gb|AFW76862.1| peptide methionine sulfoxide reductase msrB [Zea mays]
Length=209

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S+S+EEWKKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG Y CVCCDTPLF+SSTKF
Sbjct  81   DYKSLSEEEWKKRLTEEQYYVTRQKGTERAFTGEYWNTKTPGIYQCVCCDTPLFQSSTKF  140

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYYKP+G NVKSKLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  141  DSGTGWPSYYKPIGENVKSKLDMSIIFMPRTEVLCATCDAHLGHVFDDGPPPTGKRYCIN  200

Query  655  SAALK  669
            SA+LK
Sbjct  201  SASLK  205



>ref|XP_009344620.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Pyrus x bretschneideri]
Length=198

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ SVSD+EWK++LT +QFY+TR+KGTERAFTGEYW+TKT GTYHC+CCDTPLFESSTKF
Sbjct  70   DYKSVSDQEWKEKLTEEQFYVTRKKGTERAFTGEYWNTKTKGTYHCICCDTPLFESSTKF  129

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+P+G+NVKSKLDLSI  MPR EVLCAACDAHLGHVFDDGP PTGKRYCIN
Sbjct  130  DSGTGWPSYYQPIGDNVKSKLDLSIFIMPRTEVLCAACDAHLGHVFDDGPPPTGKRYCIN  189

Query  655  SAALK  669
            SA+LK
Sbjct  190  SASLK  194



>ref|XP_008368465.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Malus domestica]
Length=198

 Score =   237 bits (605),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    D+ SVSD+EWK++LT +QFY+TR+KGTERAFTGEYW+TKT GTYHC+CCDTPLFE
Sbjct  65   ETGVGDYKSVSDQEWKEKLTEEQFYVTRKKGTERAFTGEYWNTKTKGTYHCICCDTPLFE  124

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            SSTKF+SGTGWPSYY+P+G+NVKSKLDLSI  MPR EVLCAACDAHLGHVFDDGP PTGK
Sbjct  125  SSTKFNSGTGWPSYYQPIGDNVKSKLDLSIFMMPRTEVLCAACDAHLGHVFDDGPPPTGK  184

Query  640  RYCINSAALK  669
            RYCINSA+LK
Sbjct  185  RYCINSASLK  194



>sp|Q0DC89.2|MSRB1_ORYSJ RecName: Full=Peptide methionine sulfoxide reductase B1, chloroplastic; 
Short=OsMSRB1; AltName: Full=Peptide-methionine (R)-S-oxide 
reductase; Flags: Precursor [Oryza sativa Japonica 
Group]
Length=214

 Score =   237 bits (605),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  301  SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS  480
            +S++DEEW+KRLT  Q+YITRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKFDS
Sbjct  87   TSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDS  146

Query  481  GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA  660
            GTGWPSYY+P+G+NVK KLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCINSA
Sbjct  147  GTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSA  206

Query  661  ALK  669
            +LK
Sbjct  207  SLK  209



>dbj|BAD35399.1| putative methionine sulfoxide reductase B [Oryza sativa Japonica 
Group]
Length=160

 Score =   235 bits (600),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  301  SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS  480
            +S++DEEW+KRLT  Q+YITRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKFDS
Sbjct  33   TSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDS  92

Query  481  GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA  660
            GTGWPSYY+P+G+NVK KLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCINSA
Sbjct  93   GTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSA  152

Query  661  ALK  669
            +LK
Sbjct  153  SLK  155



>ref|NP_001057620.1| Os06g0472000 [Oryza sativa Japonica Group]
 dbj|BAF19534.1| Os06g0472000 [Oryza sativa Japonica Group]
 gb|EEE65699.1| hypothetical protein OsJ_21331 [Oryza sativa Japonica Group]
Length=212

 Score =   237 bits (604),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  301  SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS  480
            +S++DEEW+KRLT  Q+YITRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKFDS
Sbjct  85   TSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDS  144

Query  481  GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA  660
            GTGWPSYY+P+G+NVK KLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCINSA
Sbjct  145  GTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSA  204

Query  661  ALK  669
            +LK
Sbjct  205  SLK  207



>gb|EEC80596.1| hypothetical protein OsI_22943 [Oryza sativa Indica Group]
Length=213

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  301  SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS  480
            +S++DEEW+KRLT  Q+YITRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKFDS
Sbjct  86   TSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDS  145

Query  481  GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA  660
            GTGWPSYY+P+G+NVK KLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCINSA
Sbjct  146  GTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSA  205

Query  661  ALK  669
            +LK
Sbjct  206  SLK  208



>ref|XP_003563853.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic 
[Brachypodium distachyon]
Length=190

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS  465
            +  D +S+SDE+ K+RLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFESS
Sbjct  59   AKADKASMSDEDLKERLTKEQYYVTRQKGTERAFTGEYWNTKTPGIYHCICCDTPLFESS  118

Query  466  TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY  645
            TKFDSGTGWPSYY+PVG+NVK+KLD+SIIFMPR E LCA CDAHLGHVFDDGP PTGKRY
Sbjct  119  TKFDSGTGWPSYYRPVGDNVKNKLDMSIIFMPRTEALCAVCDAHLGHVFDDGPPPTGKRY  178

Query  646  CINSAALK  669
            CINSA+LK
Sbjct  179  CINSASLK  186



>gb|AJL35125.1| methionine sulfoxide reductase MSRB1.1 [Triticum aestivum x Lophopyrum 
elongatum]
Length=147

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D +S+SDEE KKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFESSTKF
Sbjct  19   DNASLSDEELKKRLTKEQYYVTRQKGTERAFTGEYWNTKTPGIYHCICCDTPLFESSTKF  78

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PVG+NVKSKLD+SI FMPR E LCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  79   DSGTGWPSYYQPVGDNVKSKLDMSIFFMPRTESLCAVCDAHLGHVFDDGPPPTGKRYCIN  138

Query  655  SAALK  669
            SA+LK
Sbjct  139  SASLK  143



>dbj|BAJ89329.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D +S+SDEE KKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFESSTKF
Sbjct  19   DNASLSDEELKKRLTKEQYYVTRQKGTERAFTGEYWNTKTPGVYHCICCDTPLFESSTKF  78

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PVG+NVKSKLD+SI FMPR E LCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  79   DSGTGWPSYYQPVGDNVKSKLDMSIFFMPRTESLCAVCDAHLGHVFDDGPPPTGKRYCIN  138

Query  655  SAALK  669
            SA+LK
Sbjct  139  SASLK  143



>gb|AJL35126.1| methionine sulfoxide reductase MSRB1.2 [Triticum aestivum x Lophopyrum 
elongatum]
Length=147

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D +S+SDEE KKRLT +Q+Y+TRQKGTERAFTGEYW+TKTPG YHC+CCDTPLFESSTKF
Sbjct  19   DNASLSDEELKKRLTKEQYYVTRQKGTERAFTGEYWNTKTPGIYHCICCDTPLFESSTKF  78

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PV +NVKSKLD+SI FMPR E LCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  79   DSGTGWPSYYQPVSDNVKSKLDMSIFFMPRTESLCAVCDAHLGHVFDDGPPPTGKRYCIN  138

Query  655  SAALK  669
            SA+LK
Sbjct  139  SASLK  143



>ref|XP_007022198.1| Methionine sulfoxide reductase B 1 isoform 2 [Theobroma cacao]
 gb|EOY13723.1| Methionine sulfoxide reductase B 1 isoform 2 [Theobroma cacao]
Length=183

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 126/167 (75%), Gaps = 16/167 (10%)
 Frame = +1

Query  169  LLLHPNQTALKVSLSLSLSTYKRISHCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQ  348
            +L  P Q +  V    S ++ +R  +           E S  D+ SVSDEEWKK LT +Q
Sbjct  29   VLKKPRQVSFSVRSMGSFASSQRPDNV---------REPSAVDYVSVSDEEWKKMLTPEQ  79

Query  349  FYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVK  528
            FYITRQKGTERAFTGEYW+TKTPGTYHC+CCDTPLF+       GTGWPSYY+P+GNNVK
Sbjct  80   FYITRQKGTERAFTGEYWNTKTPGTYHCICCDTPLFD-------GTGWPSYYQPIGNNVK  132

Query  529  SKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SKLDLSIIFMPRQEVLCA CDAHLGHVFDDGP PT KRYCINSA+LK
Sbjct  133  SKLDLSIIFMPRQEVLCATCDAHLGHVFDDGPRPTRKRYCINSASLK  179



>gb|EPS58912.1| hypothetical protein M569_15901, partial [Genlisea aurea]
Length=141

 Score =   225 bits (573),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ S+SDEEW+K+L+ QQFYITRQKGTERAFTGEYW+ KTPGTYHC+CCD PLFESS KF
Sbjct  22   DYKSLSDEEWRKKLSEQQFYITRQKGTERAFTGEYWNMKTPGTYHCICCDAPLFESSAKF  81

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSY +PVG NV SKLD+SI+F+PR+EVLCAACDAHLGHVFDDGP PTGKRYCIN
Sbjct  82   DSGTGWPSYDRPVGVNVTSKLDMSIVFLPRREVLCAACDAHLGHVFDDGPPPTGKRYCIN  141



>gb|ACN40208.1| unknown [Picea sitchensis]
Length=148

 Score =   225 bits (573),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+S +SD+EWKKRLT  Q+ ITR+KGTERA+TGEYW+TK  G YHCVCCDTPLF+S+TKF
Sbjct  21   DYSCISDDEWKKRLTKSQYDITRKKGTERAYTGEYWNTKITGIYHCVCCDTPLFDSNTKF  80

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY P+GNNVKSK+D SII MPRQEVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  81   DSGTGWPSYYDPIGNNVKSKVDFSIILMPRQEVLCATCDAHLGHVFDDGPPPTGKRYCIN  140

Query  655  SAALK  669
            SA+LK
Sbjct  141  SASLK  145



>gb|ABK22433.1| unknown [Picea sitchensis]
Length=220

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+S +SD+EWKKRLT  Q+ ITR+KGTERA+TGEYW+TK  G YHCVCCDTPLF+S+TKF
Sbjct  93   DYSCISDDEWKKRLTKSQYDITRKKGTERAYTGEYWNTKITGIYHCVCCDTPLFDSNTKF  152

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY P+GNNVKSK+D SII MPRQEVLCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  153  DSGTGWPSYYDPIGNNVKSKVDFSIILMPRQEVLCATCDAHLGHVFDDGPPPTGKRYCIN  212

Query  655  SAALK  669
            SA+LK
Sbjct  213  SASLK  217



>ref|NP_001117484.1| peptide methionine sulfoxide reductase B1 [Arabidopsis thaliana]
 gb|ABR46216.1| At1g53670 [Arabidopsis thaliana]
 gb|AEE32980.1| peptide methionine sulfoxide reductase B1 [Arabidopsis thaliana]
Length=195

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 7/130 (5%)
 Frame = +1

Query  280  EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE  459
            E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct  64   EAEKNEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD  123

Query  460  SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
                   GTGWPSYY+P+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct  124  -------GTGWPSYYQPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK  176

Query  640  RYCINSAALK  669
            RYC+NSAALK
Sbjct  177  RYCLNSAALK  186



>ref|XP_002985120.1| hypothetical protein SELMODRAFT_424211 [Selaginella moellendorffii]
 gb|EFJ13614.1| hypothetical protein SELMODRAFT_424211 [Selaginella moellendorffii]
Length=151

 Score =   207 bits (527),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +F SVSD EWK++LT +QFY+TRQKGTERAF+G+YW+TKT G Y C+CC TPLF S TKF
Sbjct  22   EFKSVSDTEWKEKLTDEQFYVTRQKGTERAFSGKYWNTKTAGIYECICCGTPLFNSITKF  81

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+ +GNNVKS+ D SI FMPR EV C+ CDAHLGHVFDDGP PTGKRYCIN
Sbjct  82   DSGTGWPSYYEVIGNNVKSESDWSIPFMPRTEVKCSKCDAHLGHVFDDGPPPTGKRYCIN  141

Query  655  SAAL  666
            SA+L
Sbjct  142  SASL  145



>ref|XP_001782030.1| predicted protein [Physcomitrella patens]
 gb|EDQ53173.1| predicted protein, partial [Physcomitrella patens]
Length=125

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D+ + SDEEWKKRL+ QQFY+ R+KGTER FTGEYW+TKT GTY CVCC TPLF S TKF
Sbjct  5    DYKTFSDEEWKKRLSQQQFYVARKKGTERPFTGEYWNTKTAGTYLCVCCKTPLFSSKTKF  64

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY  +G+NVKS +D SI FMPR EV+CA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  65   DSGTGWPSYYDTIGDNVKSHMDWSIPFMPRTEVVCAVCDAHLGHVFDDGPRPTGKRYCIN  124



>ref|XP_002969788.1| hypothetical protein SELMODRAFT_92187, partial [Selaginella moellendorffii]
 gb|EFJ28912.1| hypothetical protein SELMODRAFT_92187, partial [Selaginella moellendorffii]
Length=121

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            +F SVSD EWK++LT +QFY+TRQKGTERAF+G+YW+TKT G Y C+CC TPLF S TKF
Sbjct  1    EFKSVSDTEWKEKLTDEQFYVTRQKGTERAFSGKYWNTKTAGIYECICCGTPLFNSITKF  60

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+ +GNNVKS+ D SI FMPR EV C+ CDAHLGHVFDDGP PTGKRYCIN
Sbjct  61   DSGTGWPSYYEAIGNNVKSESDWSIPFMPRTEVKCSKCDAHLGHVFDDGPPPTGKRYCIN  120



>ref|XP_006477976.1| PREDICTED: peptide methionine sulfoxide reductase B1, chloroplastic-like 
[Citrus sinensis]
Length=104

 Score =   188 bits (477),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  385  FTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPR  564
            F  EYW+TKTPGTYHC+CCDTPLFESSTKFDSGTGWPSYY+P+G+N+KSKLDLSIIFMPR
Sbjct  6    FFREYWNTKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGSNMKSKLDLSIIFMPR  65

Query  565  QEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            QEVLCA CDAHLGHVFDDGP PTGKRYCINSA+LK
Sbjct  66   QEVLCAVCDAHLGHVFDDGPPPTGKRYCINSASLK  100



>ref|WP_015226259.1| methionine-R-sulfoxide reductase [Halothece sp. PCC 7418]
 gb|AFZ44384.1| methionine-R-sulfoxide reductase [Halothece sp. PCC 7418]
Length=132

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TRQKGTE AFTGEY D K PGTY CVCC  PLF+S TK+DSGTG
Sbjct  8    SEQEWKQQLTPEQFRVTRQKGTEPAFTGEYHDQKDPGTYKCVCCGQPLFDSETKYDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y PV  +NV  + D S +FM R EVLC+ACDAHLGHVFDDGP+PTGKRYC+NSAAL
Sbjct  68   WPSFYAPVKADNVDYETDRS-LFMTRTEVLCSACDAHLGHVFDDGPKPTGKRYCMNSAAL  126



>ref|WP_042250600.1| methionine sulfoxide reductase B [Nitrospina gracilis]
Length=135

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD+EWK +L+ +Q+ I RQ GTE AFTGEYW+TKTPG YHCVCCD PLF++ TKFDSGTG
Sbjct  8    SDQEWKDQLSPEQYRICRQHGTEPAFTGEYWNTKTPGMYHCVCCDQPLFDAETKFDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS++ P G +  S+ +   ++M R EVLC+ CDAHLGHVF+DGP PTG RYCINSA+LK
Sbjct  68   WPSFHSPQGEDAVSEKEDRTLWMRRTEVLCSRCDAHLGHVFNDGPAPTGLRYCINSASLK  127



>emb|CCQ90372.1| Peptide methionine sulfoxide reductase MsrB [Nitrospina gracilis 
3/211]
Length=134

 Score =   178 bits (452),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD+EWK +L+ +Q+ I RQ GTE AFTGEYW+TKTPG YHCVCCD PLF++ TKFDSGTG
Sbjct  7    SDQEWKDQLSPEQYRICRQHGTEPAFTGEYWNTKTPGMYHCVCCDQPLFDAETKFDSGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS++ P G +  S+ +   ++M R EVLC+ CDAHLGHVF+DGP PTG RYCINSA+LK
Sbjct  67   WPSFHSPQGEDAVSEKEDRTLWMRRTEVLCSRCDAHLGHVFNDGPAPTGLRYCINSASLK  126



>ref|WP_038682717.1| peptide methionine sulfoxide reductase [Rubrobacter radiotolerans]
 gb|AHY47500.1| TIGR00357: methionine-R-sulfoxide reductase [Rubrobacter radiotolerans]
Length=140

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D+EW  +LT +Q+ + R+KGTERAFTGEYW+TK  G Y CVCC  PLF S TK+DSGTG
Sbjct  10   TDDEWWAQLTPEQYRVARKKGTERAFTGEYWNTKDRGVYRCVCCGEPLFSSETKYDSGTG  69

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+    +  + D S+ FMPR EVLCAACDAHLGHVF DGPEPTGKRYC+NSAAL
Sbjct  70   WPSFWEPLEEEKIAEETDRSLFFMPRTEVLCAACDAHLGHVFPDGPEPTGKRYCLNSAAL  129

Query  667  K  669
            +
Sbjct  130  R  130



>ref|WP_015230176.1| methionine-R-sulfoxide reductase [Dactylococcopsis salina]
 gb|AFZ51186.1| methionine-R-sulfoxide reductase [Dactylococcopsis salina PCC 
8305]
Length=132

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TRQKGTERAFTG+Y D K PGTY C+CC  PLF S TK+DSGTG
Sbjct  8    SEQEWKQQLTPEQFRVTRQKGTERAFTGKYHDNKEPGTYKCICCGQPLFTSETKYDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y PV ++         +FM R EVLC+ACDAHLGHVFDDGP PTGKRYC+NSAAL
Sbjct  68   WPSFYAPVEDDKVDYESDRSLFMTRTEVLCSACDAHLGHVFDDGPAPTGKRYCMNSAAL  126



>ref|WP_027451971.1| peptide methionine sulfoxide reductase [Poribacteria bacterium 
WGA-3G]
Length=137

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++L+ +++ +TR+KGTERAFTG+Y D K  GTYHC+CC +PLF S TKFDSGTG
Sbjct  9    SEKEWKEQLSPEEYKVTRKKGTERAFTGQYHDCKEQGTYHCICCGSPLFSSETKFDSGTG  68

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++ +    V++K D SI FMPR EV+C  CDAHLGHVFDDGP PTGKRYC+NSAAL
Sbjct  69   WPSFWESISTEAVETKSDFSIFFMPRTEVVCTRCDAHLGHVFDDGPPPTGKRYCMNSAAL  128



>ref|WP_011244217.1| MULTISPECIES: methionine sulfoxide reductase B [Synechococcus]
 dbj|BAD80097.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB58220.1| Methionine sulfoxide reductase B [Synechococcus elongatus PCC 
7942]
 gb|AJD57307.1| peptide methionine sulfoxide reductase [Synechococcus sp. UTEX 
2973]
Length=140

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+EEW+ +LT +QF +TR+ GTERAFTG YWDTK PG Y C+CCD PLF S TKFDSGTG
Sbjct  8    SEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDTKFDSGTG  67

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV  + +  K D S + M R E+LCA CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct  68   WPSFWAPVDESAITYKKDFSFLMM-RTEILCARCDAHLGHVFPDGPKPTGQRYCLNSASL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_015126202.1| methionine-R-sulfoxide reductase [Synechococcus sp. PCC 6312]
 gb|AFY62665.1| methionine-R-sulfoxide reductase [Synechococcus sp. PCC 6312]
Length=138

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +1

Query  313  DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW  492
            D EW+ +LT +QF++TR+KGTERAFTG YW+ K PGTY CVCC TPLF+S TK+DSGTGW
Sbjct  13   DTEWQAQLTPEQFHVTRKKGTERAFTGCYWNNKEPGTYTCVCCGTPLFKSQTKYDSGTGW  72

Query  493  PSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            PS+++P+   NV+ ++D S +FM R EVLCA CDAHLGHVF DGP PTG+RYC+NSAAL
Sbjct  73   PSFWEPIDPKNVRREVDRS-LFMSRTEVLCAVCDAHLGHVFPDGPPPTGERYCMNSAAL  130



>ref|WP_028666014.1| methionine sulfoxide reductase B [Runella zeae]
Length=138

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  277  AEVSNKDFSSV--SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTP  450
            A+  N++   V  +D EWKK LT  Q+Y+TRQKGTERAFTG YW+ K  G Y CVCC TP
Sbjct  2    AQTQNQELKRVVKTDAEWKKILTPMQYYVTRQKGTERAFTGPYWNNKEKGIYKCVCCQTP  61

Query  451  LFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP  630
            LF S TKFDSGTGWPS+Y P+              M R EV+CA CDAHLGHVFDDGP P
Sbjct  62   LFSSDTKFDSGTGWPSFYAPISKKALKDAKDKSFGMERDEVICAVCDAHLGHVFDDGPRP  121

Query  631  TGKRYCINSAAL  666
            TG RYC+N AAL
Sbjct  122  TGLRYCMNGAAL  133



>ref|WP_026788276.1| MULTISPECIES: peptide methionine sulfoxide reductase [Planktothrix]
Length=133

 Score =   173 bits (438),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S TKFDSGTG
Sbjct  8    TDAEWKQQLTDEQFSVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSETKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ +P+  +N+  K D+S  FM R EVLCAACDAHLGHVFDDGP+PTG+RYC+NSAAL
Sbjct  68   WPSFSQPIKEDNISCKSDVS-FFMRRTEVLCAACDAHLGHVFDDGPKPTGQRYCMNSAAL  126



>gb|AEI50934.1| Peptide methionine sulfoxide reductase msrB [Runella slithyformis 
DSM 19594]
Length=158

 Score =   174 bits (440),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  277  AEVSNKDFSSV--SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTP  450
            A+  N++   +  +D EWKK LT  Q+Y+TRQKGTERAFTG YW+ K  GTY CVCC+TP
Sbjct  22   AQQQNQELKRLVKTDAEWKKLLTPMQYYVTRQKGTERAFTGPYWNNKEKGTYKCVCCNTP  81

Query  451  LFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP  630
            LF S TKF+SGTGWPS+Y P+   V          M R EV+CA CDAHLGHVFDDGP P
Sbjct  82   LFSSDTKFESGTGWPSFYAPLNKKVLKDEKDKSFGMERDEVICAVCDAHLGHVFDDGPRP  141

Query  631  TGKRYCINSAAL  666
            TG RYC+N AAL
Sbjct  142  TGLRYCMNGAAL  153



>ref|WP_027249836.1| peptide methionine sulfoxide reductase [Planktothrix agardhii]
Length=133

 Score =   173 bits (438),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S TKFDSGTG
Sbjct  8    TDAEWKQQLTDEQFSVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSETKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ +P+  +N+  K D+S  FM R EVLCAACDAHLGHVFDDGP+PTG+RYC+NSAAL
Sbjct  68   WPSFSQPIKEDNISCKSDVS-FFMRRTEVLCAACDAHLGHVFDDGPKPTGQRYCMNSAAL  126



>ref|WP_008735653.1| methionine sulfoxide reductase B [Alcanivorax pacificus]
 gb|AJD47923.1| methionine-R-sulfoxide reductase [Alcanivorax pacificus W11-5]
Length=131

 Score =   172 bits (437),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EW++ L  + F ITRQ GTERAFTG+Y D+KTPG YHCVCC TPLF+++TK+DSG+G
Sbjct  7    SEDEWRRELDPETFRITRQHGTERAFTGKYHDSKTPGVYHCVCCGTPLFDAATKYDSGSG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+PV + V +++    + M R EVLCA CDAHLGHVF DGP+PTG RYCINSA+L
Sbjct  67   WPSFYQPVEDEVIAEVTDQSLGMTRTEVLCAVCDAHLGHVFPDGPQPTGLRYCINSASL  125



>ref|WP_006632094.1| methionine sulfoxide reductase B [Microcoleus vaginatus]
 gb|EGK89408.1| Peptide methionine sulfoxide reductase msrB [Microcoleus vaginatus 
FGP-2]
Length=132

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+++LT +QF + R+KGTERAF+GEY D K PG Y+C+CC T LF+S TKFDSGTG
Sbjct  8    TDAEWQQQLTPEQFKVARKKGTERAFSGEYHDNKKPGIYNCICCGTELFKSETKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y PV   NVK + D + +FM R EVLCA CDAHLGHVF+DGP+PTG+RYC+NSAAL
Sbjct  68   WPSFYAPVSEENVKCESD-NTLFMRRTEVLCAVCDAHLGHVFNDGPKPTGQRYCMNSAAL  126



>ref|WP_024124516.1| methionine-R-sulfoxide reductase MsrB [Thermosynechococcus sp. 
NK55a]
 gb|AHB88107.1| methionine-R-sulfoxide reductase MsrB [Thermosynechococcus sp. 
NK55a]
Length=135

 Score =   172 bits (437),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +LT +Q+Y+TR+KGTERAFTG YW+ K PG Y CVCC TPLF S TK+DSGTG
Sbjct  7    TDAEWQAQLTPEQYYVTRKKGTERAFTGCYWNNKKPGLYRCVCCGTPLFRSETKYDSGTG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+  NN++ + DLS   M R EVLCA CDAHLGHVF+DGP PTG RYCINSAAL
Sbjct  67   WPSFWQPLDPNNIRMERDLS-HGMVRTEVLCAVCDAHLGHVFEDGPPPTGLRYCINSAAL  125



>ref|WP_011144007.1| methionine sulfoxide reductase B [Gloeobacter violaceus]
 ref|NP_926965.1| hypothetical protein gll4019 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91960.1| gll4019 [Gloeobacter violaceus PCC 7421]
Length=149

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+ EWKK LT +QF ITR+KGTERAFTG+Y DTK  G Y CVCC+TPLF S+ K+DSGTG
Sbjct  8    SEAEWKKILTPEQFLITRKKGTERAFTGKYHDTKQAGIYQCVCCETPLFSSAQKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV   N+ +K D S +FM R EVLCA CDAH GH+F+DGP PTG RYCINSAAL
Sbjct  68   WPSFWGPVNPKNIATKADFS-LFMRRTEVLCAVCDAHQGHLFNDGPPPTGLRYCINSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_015179581.1| Peptide methionine sulfoxide reductase msrB [Oscillatoria nigro-viridis]
 gb|AFZ10385.1| Peptide methionine sulfoxide reductase msrB [Oscillatoria nigro-viridis 
PCC 7112]
Length=132

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+++LT +QF +TR+KGTERAF+GEY D K PG Y C+CC T LF+S TK+DSGTG
Sbjct  8    TDAEWQQQLTPEQFKVTRKKGTERAFSGEYHDNKKPGIYKCICCGTELFKSETKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y PV   NVK + D + +FM R EVLCA CDAHLGHVF+DGP+PTG+RYC+NSAAL
Sbjct  68   WPSFYAPVSEENVKCESD-NTLFMRRTEVLCAVCDAHLGHVFNDGPKPTGQRYCMNSAAL  126



>ref|WP_041343781.1| methionine sulfoxide reductase B [Runella slithyformis]
Length=130

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWKK LT  Q+Y+TRQKGTERAFTG YW+ K  GTY CVCC+TPLF S TKF+SGTG
Sbjct  7    TDAEWKKLLTPMQYYVTRQKGTERAFTGPYWNNKEKGTYKCVCCNTPLFSSDTKFESGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+   V          M R EV+CA CDAHLGHVFDDGP PTG RYC+N AAL
Sbjct  67   WPSFYAPLNKKVLKDEKDKSFGMERDEVICAVCDAHLGHVFDDGPRPTGLRYCMNGAAL  125



>ref|WP_011057056.1| methionine sulfoxide reductase B [Thermosynechococcus elongatus]
 ref|NP_682004.1| methionine sulfoxide reductase B [Thermosynechococcus elongatus 
BP-1]
 sp|Q8DJK9.1|MSRB_THEEB RecName: Full=Peptide methionine sulfoxide reductase MsrB; AltName: 
Full=Peptide-methionine (R)-S-oxide reductase [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08766.1| tlr1214 [Thermosynechococcus elongatus BP-1]
Length=135

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +LT +Q+Y+TR+KGTERAFTG YW+ K PG Y CVCC TPLF S TK+DSGTG
Sbjct  7    TDAEWQAQLTPEQYYVTRKKGTERAFTGCYWNNKKPGLYSCVCCGTPLFRSETKYDSGTG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+  NN++ + DLS   M R EVLCA CDAHLGHVF+DGP PTG RYCINSAAL
Sbjct  67   WPSFWQPLDPNNIRMERDLS-HGMVRTEVLCAVCDAHLGHVFEDGPPPTGLRYCINSAAL  125



>ref|WP_022609192.1| methionine-R-sulfoxide reductase [Rubidibacter lacunae]
 gb|ERN39969.1| methionine-R-sulfoxide reductase [Rubidibacter lacunae KORDI 
51-2]
Length=139

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EWK++LT +Q+ +TR+KGTERAFTGEY + K  G Y CVCCD PLF S TK+DSGTG
Sbjct  8    NEDEWKEQLTPEQYRVTRKKGTERAFTGEYHNKKDSGVYKCVCCDLPLFSSETKYDSGTG  67

Query  490  WPSYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P V  NV+ + D S +FM R EVLCAACDAHLGHVF+DGP PTG+R+C+NSAAL
Sbjct  68   WPSYWEPVVPENVRYESDRS-LFMVRTEVLCAACDAHLGHVFEDGPPPTGQRFCMNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_028525553.1| hypothetical protein [Runella limosa]
Length=127

 Score =   170 bits (431),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWKK LT  QFY+TRQKGTERAFTG YW+ K  G Y CVCC TPLF + TKFDSGTG
Sbjct  4    TDAEWKKILTPIQFYVTRQKGTERAFTGPYWNNKEKGIYKCVCCGTPLFNADTKFDSGTG  63

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+   V          M R EV+CA CDAHLGHVFDDGP PTG RYC+N AAL
Sbjct  64   WPSFYAPISKKVLKDEKDKSFGMERDEVICAVCDAHLGHVFDDGPRPTGLRYCMNGAAL  122



>ref|WP_042155102.1| peptide methionine sulfoxide reductase [Planktothrix agardhii]
 gb|KEI67859.1| peptide methionine sulfoxide reductase [Planktothrix agardhii 
NIVA-CYA 126/8]
Length=133

 Score =   170 bits (431),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +QF +TR+KGTER FTG+Y D K  G Y CVCC T LF S TKFDSGTG
Sbjct  8    TDAEWKQQLTDEQFSVTRKKGTERPFTGKYHDNKEKGIYKCVCCGTELFTSETKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ +P+  +N+  K D+S  FM R EVLCAACDAHLGHVFDDGP+PTG+RYC+NSAAL
Sbjct  68   WPSFSQPIKEDNISCKSDVS-FFMRRTEVLCAACDAHLGHVFDDGPKPTGQRYCMNSAAL  126



>ref|WP_026796798.1| peptide methionine sulfoxide reductase [Planktothrix prolifica]
Length=133

 Score =   170 bits (431),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +QF +TR+KGTER FTG+Y D K  G Y CVCC T LF S TKFDSGTG
Sbjct  8    TDAEWKQQLTDEQFSVTRKKGTERPFTGKYHDNKEKGIYKCVCCGTELFTSETKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ +P+  +N+  K D+S  FM R EVLCAACDAHLGHVFDDGP+PTG+RYC+NSAAL
Sbjct  68   WPSFSQPIKEDNISCKSDVS-FFMRRTEVLCAACDAHLGHVFDDGPKPTGQRYCMNSAAL  126



>ref|WP_025770426.1| hypothetical protein [Thioalkalivibrio sp. HK1]
Length=131

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +1

Query  307  VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT  486
            +SD+EW+ RLT  QF ITR+KGTERAF+GEY D K PG Y C CCD PLF+S TKFDSGT
Sbjct  6    LSDDEWRLRLTPDQFRITRRKGTERAFSGEYHDCKRPGIYRCRCCDRPLFDSETKFDSGT  65

Query  487  GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            GWPS+ +P+     ++ D   ++M R EV+CA CDAHLGHVF DGP PTG RYCINSAAL
Sbjct  66   GWPSFSQPIDTGGIAEKDDRTLWMRRTEVVCALCDAHLGHVFPDGPPPTGLRYCINSAAL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_015172795.1| methionine-R-sulfoxide reductase [Geitlerinema sp. PCC 7407]
 gb|AFY67231.1| methionine-R-sulfoxide reductase [Geitlerinema sp. PCC 7407]
Length=133

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK++LT +QF ITR+KGTERAFTG Y D K PGTY CVCC TPLF + TK++SGTG
Sbjct  8    TEAEWKQQLTDEQFRITRKKGTERAFTGAYHDNKAPGTYRCVCCGTPLFSAETKYESGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+  +       +  FM R EVLCAACDAHLGHVF+DGP PTG+RYC+NSAAL
Sbjct  68   WPSFWAPLSESAIRYESDNSFFMRRVEVLCAACDAHLGHVFEDGPRPTGQRYCLNSAAL  126



>ref|WP_036481793.1| methionine sulfoxide reductase B [Nitratireductor basaltis]
 gb|KFB10682.1| Peptide methionine sulfoxide reductase MsrB [Nitratireductor 
basaltis]
Length=137

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+ +LT +Q+ +TR+ GTERAFTG YWD+K  G Y CVCCD PLF+S TK+DSGTG
Sbjct  12   SDEEWRGQLTPEQYKVTRKHGTERAFTGPYWDSKEDGIYRCVCCDNPLFDSETKYDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPSYY PV     S+      FM R EV CA CDAHLGHVF+DGPEPTG RYC+N  ALK
Sbjct  72   WPSYYAPVSPEAVSEHSDRSWFMTRTEVRCADCDAHLGHVFNDGPEPTGLRYCMNGHALK  131



>ref|WP_006101300.1| methionine sulfoxide reductase B [Coleofasciculus chthonoplastes]
 gb|EDX75593.1| methionine-R-sulfoxide reductase [Coleofasciculus chthonoplastes 
PCC 7420]
Length=148

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+++LT +Q+ + RQKGTERAFTGEY D K PG Y CVCC   LF S TK+DSGTG
Sbjct  8    SDAEWRQQLTPEQYKVARQKGTERAFTGEYHDNKQPGIYKCVCCGNDLFTSKTKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+   ++K + D + ++M R EVLCAACDAHLGHVFDDGPEPTG+RYC+NSAAL
Sbjct  68   WPSFWTPIDEESIKYEAD-NTLWMRRTEVLCAACDAHLGHVFDDGPEPTGQRYCLNSAAL  126



>ref|WP_041858792.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=133

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D +W+K LT ++F +TR+KGTERAFTG YWD   PG Y C CC T LF ++ KFDSGTG
Sbjct  7    TDADWQKELTPEEFAVTRKKGTERAFTGRYWDNHEPGLYRCTCCGTTLFRANEKFDSGTG  66

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P    NV ++ D S +FM R EVLC+ CDAHLGHVFDDGP PTG RYCINSAAL
Sbjct  67   WPSFYAPAAEENVATETD-SSLFMKRTEVLCSKCDAHLGHVFDDGPAPTGLRYCINSAAL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_011563648.1| methionine sulfoxide reductase B [Rubrobacter xylanophilus]
 gb|ABG03630.1| Protein-methionine-S-oxide reductase [Rubrobacter xylanophilus 
DSM 9941]
Length=138

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = +1

Query  307  VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT  486
            +SDEEW++RL+ +++ + R+ GTE AFTG YWD K  G Y CVCC TPLF S TK+DSGT
Sbjct  10   LSDEEWRRRLSPEEYRVAREGGTEPAFTGRYWDHKEEGVYRCVCCGTPLFSSETKYDSGT  69

Query  487  GWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
            GWPS++ P+   NV  + D S++ M R EVLCAACDAHLGHVFDDGP PTG+RYC+NSAA
Sbjct  70   GWPSFWAPIEEANVAYREDRSLL-MRRTEVLCAACDAHLGHVFDDGPPPTGRRYCMNSAA  128

Query  664  LK  669
            L+
Sbjct  129  LR  130



>ref|WP_017661733.1| methionine sulfoxide reductase B [Geitlerinema sp. PCC 7105]
Length=132

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EWK++LT +Q+ +TRQKGTERAFTGEY D K  G Y CVCC TPLF S TKFDSGTG
Sbjct  8    TEKEWKEQLTPEQYKVTRQKGTERAFTGEYHDNKRDGIYTCVCCGTPLFSSETKFDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+   NV+ K D S  FM R EV+C+ CDAHLGHVF+DGP PTG RYC+NSAAL
Sbjct  68   WPSFYAPLEEQNVEEKEDRS-FFMTRTEVVCSNCDAHLGHVFNDGPAPTGLRYCMNSAAL  126



>ref|WP_007355453.1| MULTISPECIES: methionine sulfoxide reductase B [Kamptonema]
 emb|CBN56241.1| methionine-R-sulfoxide reductase [ [[Oscillatoria] sp. PCC 6506]
Length=132

 Score =   168 bits (426),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+ EWK++LT +QF++TR+KGTERAFTGEY D K  G Y CVCC   LF S TK++SGTG
Sbjct  8    SESEWKEQLTPEQFHVTRKKGTERAFTGEYHDLKQAGIYKCVCCGNDLFSSETKYNSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y  +   NVKS+ D + +FM R EVLCAAC+AHLGHVF+DGP+PTG RYC+NSAAL
Sbjct  68   WPSFYDTINQENVKSESD-NTLFMRRTEVLCAACNAHLGHVFNDGPKPTGLRYCMNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_018399410.1| methionine sulfoxide reductase B [filamentous cyanobacterium 
ESFC-1]
Length=132

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TR+KGTERAFTGE+ D K  G Y CVCC T LF S TK+DSGTG
Sbjct  8    SEQEWKEQLTPEQFKVTRKKGTERAFTGEHHDNKRSGVYKCVCCGTELFSSETKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV   NV+ + D S +FM R EVLCAACDAHLGHVF DGP+PTGKRYC+NSA+L
Sbjct  68   WPSFWAPVSEENVEYETDKS-LFMSRTEVLCAACDAHLGHVFPDGPKPTGKRYCMNSASL  126



>ref|WP_015181317.1| methionine-R-sulfoxide reductase [Microcoleus sp. PCC 7113]
 gb|AFZ17157.1| methionine-R-sulfoxide reductase [Microcoleus sp. PCC 7113]
Length=132

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+EEWK++LT +QF +TR+KGTERAFTGEY++ K  G Y CVCC   LF S TK+DS TG
Sbjct  8    SEEEWKQQLTPEQFKVTRKKGTERAFTGEYYNLKEEGIYKCVCCGNDLFTSETKYDSKTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV   N+K + D S +FM R EVLCAACDAHLGHVF+DGP PTG+RYC+NSA+L
Sbjct  68   WPSFWAPVNQENIKLESDNS-LFMRRTEVLCAACDAHLGHVFNDGPAPTGQRYCMNSASL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_010477409.1| methionine sulfoxide reductase B [Acaryochloris sp. CCMEE 5410]
Length=131

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EW+ +LT +QF +TR  GTERAFTGEY D K  GTY CVCC T LF S TKFDSGTG
Sbjct  7    TEQEWEAQLTPEQFRVTRHHGTERAFTGEYHDLKAAGTYQCVCCGTELFTSDTKFDSGTG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P    +V+ K D S+ FM R EVLCAACDAHLGHVF+DGP+PTG RYC+NSAAL
Sbjct  67   WPSFWAPADKTHVQEKTDRSL-FMVRTEVLCAACDAHLGHVFNDGPKPTGLRYCMNSAAL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_026210568.1| peptide methionine sulfoxide reductase [Flexithrix dorotheae]
Length=138

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK +LT +Q+Y+TR+KGTERAFTGE+ + K  G Y C+CCD PLF S TKF SGTG
Sbjct  7    TDAEWKAQLTAEQYYVTREKGTERAFTGEFVNHKAKGIYTCICCDNPLFSSKTKFKSGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSYY+PV +   +++      M R EV+CA CDAHLGHVF DGPEPTG RYCINS AL
Sbjct  67   WPSYYEPVADTSVNEVIDKSFGMTRIEVVCAKCDAHLGHVFKDGPEPTGLRYCINSVAL  125



>gb|ABJ81183.1| methionine-R-sulfoxide reductase [Candidatus Solibacter usitatus 
Ellin6076]
Length=180

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D +W+K LT ++F +TR+KGTERAFTG YWD   PG Y C CC T LF ++ KFDSGTG
Sbjct  54   TDADWQKELTPEEFAVTRKKGTERAFTGRYWDNHEPGLYRCTCCGTTLFRANEKFDSGTG  113

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P    NV ++ D S +FM R EVLC+ CDAHLGHVFDDGP PTG RYCINSAAL
Sbjct  114  WPSFYAPAAEENVATETD-SSLFMKRTEVLCSKCDAHLGHVFDDGPAPTGLRYCINSAAL  172

Query  667  K  669
            K
Sbjct  173  K  173



>ref|WP_017305061.1| methionine sulfoxide reductase B [Spirulina subsalsa]
Length=131

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK++LT +QF +TR+KGTERAFTG+Y+D K  G Y CVCC T LF S TK++SGTG
Sbjct  8    TESEWKQQLTPEQFKVTRKKGTERAFTGQYYDNKQAGIYKCVCCGTELFSSETKYESGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+  +  +      +FM R EVLCA CDAHLGHVFDDGP PTG+RYC+NSAAL
Sbjct  68   WPSFYAPIAEDHVAYESDRSLFMVRTEVLCATCDAHLGHVFDDGPAPTGQRYCMNSAAL  126



>ref|WP_017712709.1| hypothetical protein [Prochlorothrix hollandica]
Length=136

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK  L+ ++F +TR+KGTERAFTG Y D+K  G+Y CVCC TPLF+S  KFDSGTG
Sbjct  8    TDAEWKAILSDEEFNVTRKKGTERAFTGRYHDSKATGSYQCVCCQTPLFKSQAKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+   N+  K D+S  FM R EVLCA CDAHLGHVF DGP PTG+RYC+NSAAL
Sbjct  68   WPSFWEPIAEENIAHKDDVS-FFMRRTEVLCAVCDAHLGHVFPDGPPPTGQRYCMNSAAL  126



>ref|XP_005537862.1| similar to transcriptional regulator [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM81826.1| similar to transcriptional regulator [Cyanidioschyzon merolae 
strain 10D]
Length=211

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
            KD+ ++++E+WK RLT  QF + R+ GTER FTGEYW+ K  G Y CVCC TPLF S TK
Sbjct  79   KDWRALTEEDWKARLTPMQFEVARRAGTERPFTGEYWNEKRTGIYRCVCCGTPLFSSETK  138

Query  472  FDSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC  648
            FDSGTGWPS+Y P+    VK + DLS   M R EVLCA CDAHLGHVF DGP+PTG RYC
Sbjct  139  FDSGTGWPSFYAPLSKEAVKERRDLS-HGMIRTEVLCAVCDAHLGHVFPDGPKPTGLRYC  197

Query  649  INSAALK  669
            +NS +LK
Sbjct  198  MNSYSLK  204



>ref|WP_008182689.1| methionine sulfoxide reductase B [Moorea producens]
 gb|EGJ33210.1| methionine-R-sulfoxide reductase [Moorea producens 3L]
Length=132

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ +WK++LT +QF +TRQKGTERAFTGEYW+ K  G Y C+CC T LF S TK+DSGTG
Sbjct  8    TEAQWKEQLTPEQFKVTRQKGTERAFTGEYWNNKDKGIYKCICCGTELFNSDTKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+   NVK + D S +FM R EVLCA CDAHLGHVF DGP PTG RYC+NSA+L
Sbjct  68   WPSFFAPIKEENVKEEPDNS-LFMRRTEVLCAVCDAHLGHVFSDGPPPTGLRYCMNSASL  126



>gb|EMS62105.1| Peptide methionine sulfoxide reductase B1, chloroplastic [Triticum 
urartu]
Length=130

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 90/120 (75%), Gaps = 22/120 (18%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D +S+SDEE KKRLT +Q+Y+TRQKGTERAFTG                      SSTKF
Sbjct  29   DNASLSDEELKKRLTKEQYYVTRQKGTERAFTG----------------------SSTKF  66

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PVG+NVKSKLD+SI FMPR E LCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  67   DSGTGWPSYYQPVGDNVKSKLDMSIFFMPRTESLCAVCDAHLGHVFDDGPPPTGKRYCIN  126



>ref|WP_015955025.1| methionine sulfoxide reductase B [Cyanothece sp. PCC 7424]
 gb|ACK71428.1| methionine-R-sulfoxide reductase [Cyanothece sp. PCC 7424]
Length=133

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EWK+ LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LFES TK+DSGTG
Sbjct  8    TEKEWKEILTPEQFKVTRKKGTERAFTGQYHDNKEKGIYKCVCCGTELFESDTKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV   N+K + D + +FM R EVLCA CDAHLGHVF+DGP PTG RYC+NSAAL
Sbjct  68   WPSFWQPVNEKNIKYEDDYA-LFMKRTEVLCAVCDAHLGHVFNDGPRPTGLRYCMNSAAL  126



>ref|WP_035272482.1| methionine sulfoxide reductase B [Alcaligenes faecalis]
 gb|KGP00629.1| methionine sulfoxide reductase B [Alcaligenes faecalis]
Length=131

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L+ ++FY+TRQKGTER FTG YWDT TPG Y CV CDTPLF S TKFD+G G
Sbjct  7    TDAEWRAQLSPEEFYVTRQKGTERPFTGRYWDTTTPGIYRCVGCDTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY+ P+  +NV+ +LD S   M R EVLC  CDAHLGHVF+DGP PTG RYCINS ++
Sbjct  67   WPSYFTPLNPDNVREELDTS-HGMRRTEVLCNVCDAHLGHVFEDGPPPTGLRYCINSLSM  125



>ref|WP_012162617.1| methionine sulfoxide reductase B [Acaryochloris marina]
 sp|B0BYW4.1|MSRB_ACAM1 RecName: Full=Peptide methionine sulfoxide reductase MsrB; AltName: 
Full=Peptide-methionine (R)-S-oxide reductase [Acaryochloris 
marina MBIC11017]
 gb|ABW27130.1| methionine-R-sulfoxide reductase, putative [Acaryochloris marina 
MBIC11017]
Length=131

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EW+ +LT +QF +TR  GTERAFTGEY D K  GTY CVCC T LF S TKFDSGTG
Sbjct  7    TEQEWEAQLTPEQFRVTRHHGTERAFTGEYHDLKAAGTYQCVCCGTELFTSDTKFDSGTG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P    +V+ K D S +FM R EVLCA CDAHLGHVF+DGP+PTG RYC+NSAAL
Sbjct  67   WPSFWAPADKTHVEEKTDRS-LFMVRTEVLCAVCDAHLGHVFNDGPKPTGLRYCMNSAAL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_008308363.1| methionine-R-sulfoxide reductase [Leptolyngbya sp. PCC 6406]
Length=132

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EW+++LT +Q+++TR+KGTERAF+G Y D K  GTY+CVCC T LF + TKFDSGTG
Sbjct  8    TEQEWRQQLTPEQYHVTREKGTERAFSGPYHDLKDKGTYYCVCCGTELFSAETKFDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P  N NV +K D S  FM R EV+CA CDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWDPSQNQNVATKTDFS-HFMIRTEVVCANCDAHLGHVFNDGPAPTGKRYCMNSAAL  126



>ref|WP_013322045.1| methionine sulfoxide reductase B [Cyanothece sp. PCC 7822]
 gb|ADN13939.1| methionine-R-sulfoxide reductase [Cyanothece sp. PCC 7822]
Length=133

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D    +++EWK+ LT +QF +TR+KGTERAFTG+Y D K  GTY CVCC   LF S TK+
Sbjct  3    DKVEKTEQEWKEILTPEQFKVTRKKGTERAFTGQYHDNKEKGTYKCVCCGNELFSSETKY  62

Query  475  DSGTGWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI  651
            +SGTGWPS++KP+   N+K + D ++ FM R EVLCAACDAHLGHVF+DGP+PTG RYC+
Sbjct  63   NSGTGWPSFWKPLKEENIKCEDDYAL-FMKRTEVLCAACDAHLGHVFNDGPKPTGLRYCM  121

Query  652  NSAAL  666
            NSAAL
Sbjct  122  NSAAL  126



>gb|EMT32969.1| hypothetical protein F775_44018 [Aegilops tauschii]
Length=173

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 89/120 (74%), Gaps = 22/120 (18%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D +S+SDEE KKRLT +Q+Y+TRQKGTERAFTG                      SSTKF
Sbjct  19   DNASLSDEELKKRLTKEQYYVTRQKGTERAFTG----------------------SSTKF  56

Query  475  DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN  654
            DSGTGWPSYY+PV +NVKSKLD+SI FMPR E LCA CDAHLGHVFDDGP PTGKRYCIN
Sbjct  57   DSGTGWPSYYQPVSDNVKSKLDMSIFFMPRTESLCAVCDAHLGHVFDDGPPPTGKRYCIN  116



>ref|WP_002686084.1| methionine sulfoxide reductase B [Beggiatoa alba]
 gb|EIJ42830.1| methionine-R-sulfoxide reductase [Beggiatoa alba B18LD]
Length=136

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
             S  D+ + +D EW+  LT  QF + R+KGTE AFTGEY+ TK  G YHCVCC TPLF S
Sbjct  2    TSTPDWKNKTDAEWQATLTPTQFAVCRKKGTEHAFTGEYYATKDAGVYHCVCCGTPLFSS  61

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
             TK+DSG+GWPS+++P+     +    + +FM R EVLCA C AHLGHVFDDGP PTG R
Sbjct  62   ETKYDSGSGWPSFWQPIHQEALAMKVDNSLFMQRTEVLCATCHAHLGHVFDDGPAPTGLR  121

Query  643  YCINSAALK  669
            YC+NS ALK
Sbjct  122  YCMNSVALK  130



>ref|WP_023173225.1| methionine-R-sulfoxide reductase [Gloeobacter kilaueensis]
 gb|AGY58100.1| methionine-R-sulfoxide reductase [Gloeobacter kilaueensis JS1]
Length=149

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S  EWK+ LT QQF++TRQKGTE  F+G+Y++    G Y CVCC TPLF S TKFDSGTG
Sbjct  8    SAAEWKRLLTPQQFWVTRQKGTEAPFSGQYYNNHESGIYRCVCCRTPLFSSKTKFDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+     + +  + +FM R EVLCA CDAHLGHVFDDGP PTG RYC+NSAAL
Sbjct  68   WPSFWAPIKQENVALVADNSLFMRRTEVLCATCDAHLGHVFDDGPRPTGLRYCMNSAAL  126



>ref|WP_008056400.1| methionine sulfoxide reductase B [Arthrospira sp. PCC 8005]
 emb|CCE20040.1| methionine sulfoxide reductase B [Arthrospira sp. PCC 8005]
 emb|CDM98522.1| methionine sulfoxide reductase B [Arthrospira sp. PCC 8005]
Length=132

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK++LT +QF +TR+KGTERAFTG Y+D K  G Y CVCC   LF S TK+DSGTG
Sbjct  8    TEAEWKQQLTPEQFKVTRKKGTERAFTGIYYDNKEKGVYRCVCCGNELFTSETKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV  N+V+ + D S+ FM R EVLCA CDAHLGHVF+DGP PTGKRYC+NSA+L
Sbjct  68   WPSFWEPVSENSVRYEQDNSL-FMRRVEVLCAKCDAHLGHVFEDGPRPTGKRYCMNSASL  126



>ref|WP_006622461.1| MULTISPECIES: methionine sulfoxide reductase B [Arthrospira]
 gb|EDZ91879.1| methionine-R-sulfoxide reductase [Arthrospira maxima CS-328]
 gb|EKD09653.1| methionine-R-sulfoxide reductase [Arthrospira platensis C1]
Length=132

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK++LT +QF +TR+KGTERAFTG Y+D K  G Y CVCC   LF S TK+DSGTG
Sbjct  8    TEAEWKQQLTPEQFKVTRKKGTERAFTGIYYDNKEKGVYRCVCCGNELFTSETKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV  N+V+ + D S+ FM R EVLCA CDAHLGHVF+DGP PTGKRYC+NSA+L
Sbjct  68   WPSFWEPVSENSVRYEQDNSL-FMRRVEVLCAKCDAHLGHVFEDGPRPTGKRYCMNSASL  126



>ref|WP_011381412.1| methionine sulfoxide reductase B [Nitrosospira multiformis]
 gb|ABB75403.1| Protein-methionine-S-oxide reductase [Nitrosospira multiformis 
ATCC 25196]
Length=136

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD+EWK +LT QQ+++ R+KGTERAFTGEYW+    G Y C CC   LF+S TKFDSGTG
Sbjct  8    SDQEWKNQLTPQQYHVCREKGTERAFTGEYWNCHDQGVYRCACCGAALFDSDTKFDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P    NV ++ D S  FM R EVLCA CDAHLGHVF+DGP PTG RYCINSA+L
Sbjct  68   WPSFWQPTRSENVVNQEDNS-HFMRRVEVLCARCDAHLGHVFEDGPAPTGLRYCINSASL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_006618845.1| methionine sulfoxide reductase B [Arthrospira platensis]
 dbj|BAI88010.1| peptide methionine sulfoxide reductase MsrB [Arthrospira platensis 
NIES-39]
 gb|KDR56368.1| peptide methionine sulfoxide reductase [Arthrospira platensis 
str. Paraca]
Length=132

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK++LT +QF +TR+KGTERAFTG Y+D K  G Y CVCC   LF S TK+DSGTG
Sbjct  8    TEAEWKQQLTPEQFKVTRKKGTERAFTGIYYDNKEKGVYRCVCCGNELFTSETKYDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV  N+V+ + D S+ FM R EVLCA CDAHLGHVF+DGP PTGKRYC+NSA+L
Sbjct  68   WPSFWEPVSENSVRYEQDNSL-FMRRVEVLCAKCDAHLGHVFEDGPRPTGKRYCMNSASL  126



>ref|WP_023066822.1| peptide methionine sulfoxide reductase MsrB [Lyngbya aestuarii]
 gb|ERT06922.1| peptide methionine sulfoxide reductase MsrB [Lyngbya aestuarii 
BL J]
Length=133

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TR+ GTE AFTG+Y D K  GTY CVCC T LF S  K+DSGTG
Sbjct  8    SEQEWKQQLTPEQFKVTRKHGTEPAFTGKYHDNKQSGTYKCVCCGTELFTSEAKYDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++KP      S  + S +FM R EVLC ACDAHLGHVF+DGP PTG+RYC+NSAAL
Sbjct  68   WPSFWKPASEENISYKEDSSLFMKRTEVLCGACDAHLGHVFNDGPAPTGQRYCMNSAAL  126



>ref|WP_017324412.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=132

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+++L+ +Q+ +TRQKGTERAFTG YWD K  G YHCVCC   LF+S TKF SGTG
Sbjct  8    TDAEWREQLSSEQYRVTRQKGTERAFTGTYWDNKAKGAYHCVCCGAKLFDSDTKFKSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      NV+ + D S +FM R EVLCA CDAHLGHVF DGP PTG+RYC+NSA+L
Sbjct  68   WPSFWDAADKENVRLEEDNS-LFMRRTEVLCAQCDAHLGHVFPDGPAPTGQRYCMNSASL  126



>ref|WP_041102217.1| methionine sulfoxide reductase B, partial [Sulfuritalea hydrogenivorans]
Length=130

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
            +S K   S +D EW+ +LT  Q+++ R+KGTERAF+GEYWD K PGTY C+ C  PLFES
Sbjct  1    MSTKPRISKTDAEWRAQLTPMQYHVAREKGTERAFSGEYWDCKDPGTYRCIGCGEPLFES  60

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
            +TKFDSG GWPS+  PV     +++D +  FM R EV+C+ C AHLGHVF DGP PTG R
Sbjct  61   TTKFDSGCGWPSFTAPVNAQGITEIDDNSHFMRRTEVVCSNCGAHLGHVFPDGPAPTGLR  120

Query  643  YCINSAAL  666
            YCINSA+L
Sbjct  121  YCINSASL  128



>ref|WP_011934016.1| methionine sulfoxide reductase B [Synechococcus sp. WH 7803]
 emb|CAK24552.1| Peptide methionine sulfoxide reductase MsrB [Synechococcus sp. 
WH 7803]
Length=137

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS  465
            +  D    S EEW+++LT +QF + RQ GTERAFTG YW+ K  GTYHC+CCD PLF SS
Sbjct  7    AEGDRMERSPEEWRQQLTPEQFQVARQGGTERAFTGAYWNHKDDGTYHCICCDAPLFSSS  66

Query  466  TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY  645
            TKF+SGTGWPS++  V +      +     M R E+LCA CDAHLGHVF DGP PTG+RY
Sbjct  67   TKFESGTGWPSFWDGVNSGAIRTKEDRTHGMVRTEILCARCDAHLGHVFPDGPAPTGQRY  126

Query  646  CINSAALK  669
            C+NSA+L+
Sbjct  127  CVNSASLQ  134



>ref|WP_009456637.1| MULTISPECIES: methionine sulfoxide reductase B [Alcaligenes]
 gb|EKU30716.1| methionine sulfoxide reductase B [Alcaligenes sp. HPC1271]
 gb|ERI33530.1| methionine sulfoxide reductase B [Alcaligenes sp. EGD-AK7]
Length=131

 Score =   163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L+ ++FY+TRQKGTER FTG YWDT TPG Y CV C TPLF S TKFD+G G
Sbjct  7    TDAEWRAQLSPEEFYVTRQKGTERPFTGRYWDTTTPGIYRCVGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY+ P+  +NV+ +LD S   M R EVLC  CDAHLGHVF+DGP PTG RYCINS ++
Sbjct  67   WPSYFTPLNPDNVREELDTS-HGMRRTEVLCNVCDAHLGHVFEDGPPPTGLRYCINSLSM  125



>ref|WP_007098957.1| methionine sulfoxide reductase B [Synechococcus sp. RS9916]
 gb|EAU74858.1| Methionine sulfoxide reductase B [Synechococcus sp. RS9916]
Length=142

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD+EWK +LT +QF + RQ GTERAFTG YWD K  G YHCVCC  PLF S+TKFDSGTG
Sbjct  18   SDDEWKAQLTPEQFQVARQGGTERAFTGAYWDNKATGMYHCVCCGAPLFSSATKFDSGTG  77

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++     + + +K D+S   M R E+ CA CDAHLGHVF DGP PTG+RYC+NSA+L
Sbjct  78   WPSFWDGASADAITTKTDVS-HGMVRTEINCARCDAHLGHVFSDGPAPTGQRYCVNSASL  136

Query  667  K  669
             
Sbjct  137  N  137



>ref|WP_009782903.1| methionine sulfoxide reductase B [Lyngbya sp. PCC 8106]
 gb|EAW38436.1| hypothetical protein L8106_06534 [Lyngbya sp. PCC 8106]
Length=133

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TR+ GTE AFTG+Y D K  GTY CVCC T LF S  K+DSGTG
Sbjct  8    SEQEWKQQLTPEQFKVTRKHGTEPAFTGKYHDNKQSGTYKCVCCGTELFTSEAKYDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++KP      S  + S +FM R EVLC ACDAHLGHVF+DGP PTG+RYC+NSAAL
Sbjct  68   WPSFWKPASEENISYKEDSSLFMKRTEVLCGACDAHLGHVFNDGPAPTGQRYCMNSAAL  126



>ref|WP_011613411.1| methionine sulfoxide reductase B [Trichodesmium erythraeum]
 gb|ABG53081.1| methionine-R-sulfoxide reductase [Trichodesmium erythraeum IMS101]
Length=132

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EWK++LT +QF +TR+KGTER FTGEY++ K  G Y CVCC   LF S  K+DSGTG
Sbjct  8    SEKEWKEQLTPEQFNVTRKKGTERPFTGEYYNNKEKGIYKCVCCGIDLFSSEAKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY+KP+   N+K + D S +FM R EVLC  CDAHLGHVF DGP PTG RYC+NSAAL
Sbjct  68   WPSYWKPINQENIKEETDWS-LFMRRTEVLCNNCDAHLGHVFPDGPPPTGLRYCLNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_040934081.1| peptide methionine sulfoxide reductase [Prochloron didemni]
Length=131

 Score =   163 bits (412),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+K+LT +QF +TR+KGTERAFTG+Y++ K  G Y C+CC   LF S TKFDSGTG
Sbjct  8    TDAEWQKQLTPEQFQVTRKKGTERAFTGKYYNWKEKGIYKCICCGNELFSSETKFDSGTG  67

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+  + VK + D+S  FM R EVLCA CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct  68   WPSFWQPIAEDKVKLEDDVS-FFMRRTEVLCANCDAHLGHVFSDGPKPTGQRYCMNSASL  126



>gb|EDN65272.1| Protein-methionine-S-oxide reductase [Beggiatoa sp. PS]
Length=134

 Score =   162 bits (411),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EW++ LT +QF + RQKGTERAFTG+Y D K  G Y CVCC   LF + TKF+SGTG
Sbjct  8    SEQEWRQLLTPEQFNVCRQKGTERAFTGQYHDCKDEGIYQCVCCGNELFSAKTKFNSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y P+ + +    +   + MPR EVLC  C AHLGHVFDDGP+PTGKR+CINS ALK
Sbjct  68   WPSFYAPIDSELVELNEDKSLLMPRTEVLCERCGAHLGHVFDDGPQPTGKRFCINSVALK  127



>ref|WP_028465220.1| hypothetical protein [Nisaea denitrificans]
Length=133

 Score =   162 bits (411),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+++LT +Q+ +TR+ GTER FTG+Y +T  PGTY CVCC  PLFES TKFD+G G
Sbjct  8    SDAEWREQLTDEQYQVTRKHGTERPFTGKYAETTEPGTYTCVCCGEPLFESETKFDAGCG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+P+ G N++S  D S  FM R EV CA C+AHLGHVF DGP+PTG RYCINSA+L
Sbjct  68   WPSFYQPIEGANIESTTDRS-HFMVRTEVHCAKCEAHLGHVFPDGPQPTGLRYCINSASL  126



>ref|WP_006043154.1| methionine sulfoxide reductase B [Synechococcus sp. WH 7805]
 gb|EAR19597.1| putative methionine sulfoxide reductase family protein [Synechococcus 
sp. WH 7805]
Length=137

 Score =   162 bits (411),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S +EWK++LT +QF + RQ GTERAFTG YW+ K  GTYHC+CCD PLF SSTKF+SGTG
Sbjct  15   SPDEWKQQLTPEQFQVARQGGTERAFTGAYWNHKDDGTYHCICCDAPLFSSSTKFESGTG  74

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS++  V +      +     M R E+LCA CDAHLGHVF DGP PTG+RYC+NSA+L+
Sbjct  75   WPSFWDGVSSGAIRTKEDRTHGMVRTEILCARCDAHLGHVFPDGPTPTGQRYCVNSASLQ  134



>ref|WP_015223778.1| methionine-R-sulfoxide reductase [Cyanobacterium stanieri]
 gb|AFZ48464.1| methionine-R-sulfoxide reductase [Cyanobacterium stanieri PCC 
7202]
Length=132

 Score =   162 bits (411),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWKK LT +QF +TR+ GTERAFTG+Y D K  G Y CVCC + LF S TK+DSGTG
Sbjct  8    TDAEWKKILTPEQFEVTRKHGTERAFTGKYHDNKEKGIYKCVCCGSELFSSETKYDSGTG  67

Query  490  WPSYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P    N+  K D S  FM R EVLCA C+AHLGHVFDDGP PTGKRYC+NSAAL
Sbjct  68   WPSFWQPSTEENIAYKNDFS-FFMKRTEVLCANCEAHLGHVFDDGPAPTGKRYCMNSAAL  126



>dbj|BAO30010.1| protein-methionine-S-oxide reductase [Sulfuritalea hydrogenivorans 
sk43H]
Length=161

 Score =   163 bits (413),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
            +S K   S +D EW+ +LT  Q+++ R+KGTERAF+GEYWD K PGTY C+ C  PLFES
Sbjct  1    MSTKPRISKTDAEWRAQLTPMQYHVAREKGTERAFSGEYWDCKDPGTYRCIGCGEPLFES  60

Query  463  STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR  642
            +TKFDSG GWPS+  PV     +++D +  FM R EV+C+ C AHLGHVF DGP PTG R
Sbjct  61   TTKFDSGCGWPSFTAPVNAQGITEIDDNSHFMRRTEVVCSNCGAHLGHVFPDGPAPTGLR  120

Query  643  YCINSAAL  666
            YCINSA+L
Sbjct  121  YCINSASL  128



>ref|WP_015218866.1| Peptide methionine sulfoxide reductase msrB [Cyanobacterium aponinum]
 gb|AFZ53135.1| Peptide methionine sulfoxide reductase msrB [Cyanobacterium aponinum 
PCC 10605]
Length=132

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +++EWK+ LT +QF +TR+ GTERAFTGEY D K  G Y CVCC   LF S TK++SGTG
Sbjct  8    TEQEWKEILTPEQFEVTRKHGTERAFTGEYHDFKGKGVYKCVCCGNELFVSDTKYNSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++P+  ++V  K D S+ FM R EVLC ACDAHLGHVF+DGPEPTGKRYC+NSAAL
Sbjct  68   WPSFWQPIREDSVAYKNDFSL-FMKRTEVLCNACDAHLGHVFNDGPEPTGKRYCMNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_015151356.1| methionine-R-sulfoxide reductase [Oscillatoria acuminata]
 gb|AFY84744.1| methionine-R-sulfoxide reductase [Oscillatoria acuminata PCC 
6304]
Length=133

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+ EWK++LT +QF + R+KGTERAFTG Y D K  G Y CVCC T LF S TKFDSGTG
Sbjct  8    SESEWKEQLTPEQFKVARKKGTERAFTGAYHDNKEKGVYKCVCCGTELFSSQTKFDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+     ++ +   +FM R EVLCA CDAHLGHVF DGP+PTG RYCINSA+L
Sbjct  68   WPSFWSPIQEGNVAEEEDRALFMRRTEVLCANCDAHLGHVFPDGPKPTGLRYCINSASL  126



>ref|WP_012306301.1| MULTISPECIES: methionine sulfoxide reductase B [Synechococcus]
 gb|ACA98677.1| methionine-R-sulfoxide reductase [Synechococcus sp. PCC 7002]
Length=133

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L+ + + +TR+ GTERAFTGEY D K  GTY+CVCC  PLF S TKF+SGTG
Sbjct  8    TDAEWQAQLSPEAYKVTRKHGTERAFTGEYHDFKGEGTYNCVCCGAPLFTSETKFNSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPSY++PV +   ++ +    FM R EVLCA CDAHLGHVF+DGP PTG RYCINS ALK
Sbjct  68   WPSYWQPVNDQAIAEKNDFSFFMKRTEVLCAKCDAHLGHVFNDGPPPTGLRYCINSVALK  127



>ref|WP_008595193.1| methionine sulfoxide reductase B [Nitratireductor pacificus]
 gb|EKF19806.1| methionine-R-sulfoxide reductase [Nitratireductor pacificus pht-3B]
Length=135

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +DEEW+  LT +Q+ ITR+ GTERAFTG  WD K  GTY CVCCD PLF S TKFDSGTG
Sbjct  12   TDEEWRAALTPEQYRITREHGTERAFTGPNWDNKEDGTYRCVCCDRPLFSSQTKFDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y P+     S       FM R E+ CA CDAHLGHVF DGP PTG+RYC+N  AL+
Sbjct  72   WPSFYAPLEEEAVSAHKDRSWFMSRTEIRCADCDAHLGHVFPDGPAPTGQRYCMNGHALR  131



>emb|CCI20814.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9808]
Length=138

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++    G N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANGANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_015133444.1| Peptide methionine sulfoxide reductase msrB [Leptolyngbya sp. 
PCC 7376]
 gb|AFY37672.1| Peptide methionine sulfoxide reductase msrB [Leptolyngbya sp. 
PCC 7376]
Length=133

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+++L+ + + + R+ GTERAF+GEY D K  GTY+CVCC TPLF S TKF+SGTG
Sbjct  8    TDAEWQEQLSPEAYKVARKHGTERAFSGEYHDFKGEGTYNCVCCGTPLFTSDTKFNSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++PV   NV  K D S  FM R EVLC+ CDAHLGHVF+DGP PTG+RYCINS +L
Sbjct  68   WPSYWQPVNETNVTEKSDFS-FFMKRTEVLCSKCDAHLGHVFNDGPPPTGQRYCINSVSL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_039724873.1| MULTISPECIES: peptide methionine sulfoxide reductase [Oscillatoriophycideae]
 gb|KIF20272.1| peptide methionine sulfoxide reductase [Aphanocapsa montana BDHKU210001]
 gb|KIF42505.1| peptide methionine sulfoxide reductase [Lyngbya confervoides 
BDU141951]
Length=132

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S +EWK +LT +Q+++TR+KGTERAFTG Y D K PGTY C+CC T LF S  KFDSGTG
Sbjct  8    SKQEWKAQLTPEQYHVTREKGTERAFTGVYHDNKEPGTYKCICCGTELFRSDEKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P    NV+++ D S  FM R EV CA C AHLGHVF+DGP PTG+RYCINSA+L
Sbjct  68   WPSFWAPANTENVETETDRS-FFMVRTEVHCANCGAHLGHVFNDGPAPTGQRYCINSASL  126



>ref|WP_037583245.1| peptide methionine sulfoxide reductase [Stigmatella aurantiaca]
Length=137

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+K+LT QQF++ R+KGTERAFTG+YWD    GTYHC  C  PLF S  KFDSGTG
Sbjct  14   TEAEWRKQLTPQQFHVLREKGTERAFTGKYWDHHEAGTYHCAACGHPLFSSEAKFDSGTG  73

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+  +  +    + +FM R EV+CA C  HLGHVFDDGP PTG RYCINS +L
Sbjct  74   WPSYWQPLSPSAVTLHQDTSLFMTRTEVVCARCGGHLGHVFDDGPPPTGMRYCINSVSL  132



>ref|WP_013564995.1| methionine sulfoxide reductase B [Isosphaera pallida]
 gb|ADV62707.1| methionine-R-sulfoxide reductase [Isosphaera pallida ATCC 43644]
Length=139

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            S +DEEW + L+  QF ITR+KGTERAFTG YW+TKTPGTY CVCC  PLF S  KFDSG
Sbjct  14   SKTDEEWAQLLSSTQFQITRRKGTERAFTGAYWNTKTPGTYLCVCCGQPLFSSDHKFDSG  73

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
            TGWPS+++ +        +    FM R E+LC+ C +HLGHVF+DGP PTG RYC+NSA+
Sbjct  74   TGWPSFFQAIDPAAVVTEEDRSYFMVRTEILCSNCGSHLGHVFEDGPPPTGLRYCVNSAS  133

Query  664  LK  669
            L 
Sbjct  134  LN  135



>gb|ADO71391.1| Peptide methionine sulfoxide reductase MsrB [Stigmatella aurantiaca 
DW4/3-1]
Length=175

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+K+LT QQF++ R+KGTERAFTG+YWD    GTYHC  C  PLF S  KFDSGTG
Sbjct  52   TEAEWRKQLTPQQFHVLREKGTERAFTGKYWDHHEAGTYHCAACGHPLFSSEAKFDSGTG  111

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+  +  +    + +FM R EV+CA C  HLGHVFDDGP PTG RYCINS +L
Sbjct  112  WPSYWQPLSPSAVTLHQDTSLFMTRTEVVCARCGGHLGHVFDDGPPPTGMRYCINSVSL  170



>ref|WP_002739419.1| peptide methionine sulfoxide reductase MsrB [Microcystis aeruginosa]
 gb|ELP53170.1| peptide methionine sulfoxide reductase MsrB [Microcystis aeruginosa 
TAIHU98]
Length=132

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++    G N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANGANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_039730591.1| methionine sulfoxide reductase B [Lyngbya confervoides]
 gb|KIF38430.1| methionine sulfoxide reductase B [Lyngbya confervoides BDU141951]
Length=139

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+ +LT +Q+ +TR+ GTERAFTG  WDTK  G Y CVCCD PLF S TKFDSGTG
Sbjct  13   SDAEWRAQLTPEQYKVTRKHGTERAFTGPNWDTKDAGLYRCVCCDKPLFRSETKFDSGTG  72

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV +   ++      FM R E+ CA CDAHLGHVF+DGP+PTG RYC+N  A+
Sbjct  73   WPSFFAPVDDEAVTEHKDRSFFMVRTEIRCADCDAHLGHVFNDGPQPTGLRYCMNGVAM  131



>ref|WP_042482482.1| methionine sulfoxide reductase B [Alcaligenes faecalis]
Length=131

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +L+ ++FY+TRQKGTERAFTG YWDT T G Y CV C TPLF S TKFD+G G
Sbjct  7    TEAEWRAQLSPEEFYVTRQKGTERAFTGRYWDTTTSGIYRCVGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY+ P+  +NV+ +LD S   M R EVLC  CDAHLGHVF+DGP PTG RYCINS ++
Sbjct  67   WPSYFTPLNPDNVREELDTS-HGMRRTEVLCNVCDAHLGHVFEDGPPPTGLRYCINSLSM  125



>ref|WP_023072593.1| methionine sulfoxide reductase b [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36614.1| methionine sulfoxide reductase b [Leptolyngbya sp. Heron Island 
J]
Length=134

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +LT +Q+ +TR+ GTERAFTG+Y D K  G Y+C+CC + LF S TKFDSGTG
Sbjct  8    TDAEWQAQLTPEQYQVTRKHGTERAFTGKYHDNKAAGIYNCICCGSELFSSETKFDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P    NV +K D S  FM R EVLCA CDAHLGHVF DGP+PTG+RYC+NSAAL
Sbjct  68   WPSFWAPSKSENVATKRDFS-HFMIRTEVLCAVCDAHLGHVFPDGPQPTGQRYCMNSAAL  126



>ref|WP_015477845.1| methionine sulfoxide reductase B [Pseudomonas denitrificans]
 gb|AGI24990.1| methionine sulfoxide reductase B [Pseudomonas denitrificans ATCC 
13867]
Length=131

 Score =   160 bits (406),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            + W+  LT +QF+I R  GTERAFTGEY DTKTPG YHCVCC T LF+S  K+DSG+GWP
Sbjct  9    DSWRDELTDEQFHICRLGGTERAFTGEYHDTKTPGIYHCVCCGTALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV   V  +L+     M R EV C  CDAHLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVNGEVVKELEDFSHGMQRIEVRCGKCDAHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_011396194.1| methionine sulfoxide reductase B [Hahella chejuensis]
 sp|Q2SJP9.1|MSRB_HAHCH RecName: Full=Peptide methionine sulfoxide reductase MsrB; AltName: 
Full=Peptide-methionine (R)-S-oxide reductase [Hahella 
chejuensis KCTC 2396]
 gb|ABC29125.1| Conserved domain frequently associated with peptide methionine 
sulfoxide reductase [Hahella chejuensis KCTC 2396]
Length=139

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD+EW+++LT +Q+ +TR KGTER FTGEY+DTK  G Y CVCC  PLF S  K+DSG G
Sbjct  7    SDQEWRQQLTDEQYRVTRGKGTERPFTGEYYDTKEAGVYVCVCCGEPLFTSENKYDSGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+    +  ++D+S + M R E+LC+ CDAHLGHVFDDGP+PTG+RYC+NSA+L
Sbjct  67   WPSFWAPMDKEKITEEIDMSHM-MVRTEILCSKCDAHLGHVFDDGPQPTGQRYCVNSASL  125

Query  667  K  669
            +
Sbjct  126  R  126



>ref|WP_004784131.1| MULTISPECIES: peptide methionine sulfoxide reductase msrB [Acinetobacter]
 gb|ENU98671.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
NIPH 899]
 gb|ENX08148.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
NIPH 2171]
 gb|EXA66796.1| peptide methionine sulfoxide reductase MsrB [Acinetobacter baumannii 
348935]
Length=139

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+ ++F ITR+KGTE AFTG+YW+TK  GTY C CC TPLF S+TK+DSG G
Sbjct  7    TDREWQRELSPEEFRITREKGTEPAFTGKYWNTKQEGTYVCRCCGTPLFSSTTKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y+PV ++V  +L  +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L+
Sbjct  67   WPSFYRPVSSSVVEELPDTSHGMVRTEIVCHHCDAHLGHVFPDGPEPTGLRYCVNSASLE  126



>ref|WP_009623407.1| MULTISPECIES: methionine sulfoxide reductase B [Pseudomonas]
 gb|ETM66543.1| methionine sulfoxide reductase B [Pseudomonas sp. M1]
Length=133

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            E W++ L  QQF+I R  GTERAFTGEY+ TKTPG YHCVCC   LF+S  K+DSG+GWP
Sbjct  9    ESWREELDEQQFHICRLGGTERAFTGEYYATKTPGIYHCVCCGAALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV  +  ++L+     M R EV CAAC+AHLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVSKDAIAELEDFSHGMHRIEVRCAACEAHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_025041094.1| methionine sulfoxide reductase B [Nitrosospira briensis]
Length=135

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EW+K+LT QQ+++ R+ GTE AFTGEYW+    G Y C CC   LF S TKFDSGTG
Sbjct  8    SEQEWQKQLTPQQYHVCREGGTEPAFTGEYWNCHDNGVYRCACCGAALFSSDTKFDSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV   NV ++ D S  FM R EVLCA CDAHLGHVFDDGPEPTG RYCINS +L
Sbjct  68   WPSFWQPVDPANVTAEEDDS-FFMHRTEVLCARCDAHLGHVFDDGPEPTGLRYCINSGSL  126

Query  667  K  669
            K
Sbjct  127  K  127



>gb|EAU67795.1| peptide methionine sulfoxide reductase MsrB [Stigmatella aurantiaca 
DW4/3-1]
Length=192

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+K+LT QQF++ R+KGTERAFTG+YWD    GTYHC  C  PLF S  KFDSGTG
Sbjct  69   TEAEWRKQLTPQQFHVLREKGTERAFTGKYWDHHEAGTYHCAACGHPLFSSEAKFDSGTG  128

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+  +  +    + +FM R EV+CA C  HLGHVFDDGP PTG RYCINS +L
Sbjct  129  WPSYWQPLSPSAVTLHQDTSLFMTRTEVVCARCGGHLGHVFDDGPPPTGMRYCINSVSL  187



>ref|WP_017516978.1| methionine sulfoxide reductase B [Pseudomonas nitroreducens]
Length=131

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            + W+  LT +QF+I R  GTERAFTGEY DTKTPG YHCVCC T LF+S  K+DSG+GWP
Sbjct  9    DSWRDELTDEQFHICRLGGTERAFTGEYHDTKTPGIYHCVCCGTALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV   V  +L+     M R EV C  CDAHLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVNGEVVKELEDFSHGMHRIEVRCGKCDAHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_003813871.1| MULTISPECIES: methionine sulfoxide reductase B [Bordetella]
 ref|YP_006897122.1| peptide methionine sulfoxide reductase [Bordetella parapertussis 
Bpp5]
 ref|YP_006970646.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
253]
 emb|CAE38634.1| peptide methionine sulfoxide reductase [Bordetella parapertussis]
 emb|CAE35774.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
RB50]
 emb|CCJ50646.1| peptide methionine sulfoxide reductase [Bordetella parapertussis 
Bpp5]
 emb|CCJ60228.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
MO149]
 emb|CCJ56529.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
253]
 emb|CCN24360.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
1289]
 emb|CCN17440.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
MO211]
 emb|CCN06158.1| peptide methionine sulfoxide reductase [Bordetella bronchiseptica 
Bbr77]
 dbj|BAO70305.1| methionine sulfoxide reductase B [Bordetella bronchiseptica]
 gb|KAK54534.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica OSU054]
 gb|KAK62537.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 980-2]
 gb|KAK75155.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MO211]
 gb|KAK80376.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica CA90 
BB02]
 gb|KCV24776.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 00-P-2730]
 gb|KCV37204.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 00-P-2796]
 gb|KCV42441.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 345]
 gb|KCV49929.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 7E71]
 gb|KCV52185.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 3E44]
 gb|KCV61354.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 980]
 gb|KDB60204.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica A1-7]
 gb|KDB65428.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica B18-5 
(C3)]
 gb|KDB71571.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica C4]
 gb|KDB75318.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica CA90 
BB1334]
 gb|KDB81430.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica CARE970018BB]
 gb|KDB88939.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica D756]
 gb|KDB89223.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica D989]
 gb|KDB98177.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica D993]
 gb|KDB98804.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica E010]
 gb|KDC03926.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica E012]
 gb|KDC05679.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica E013]
 gb|KDC13572.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica F-1]
 gb|KDC19989.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica E014]
 gb|KDC29200.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica F4563]
 gb|KDC32087.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica F2]
 gb|KDC36230.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica M435/02/3]
 gb|KDC36433.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica GA96-01]
 gb|KDC45306.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica M85/00/2]
 gb|KDC57358.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD595]
 gb|KDC63717.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD591]
 gb|KDC65508.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD624]
 gb|KDC76753.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD632]
 gb|KDC76998.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD635]
 gb|KDC84698.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD668]
 gb|KDC85406.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD665]
 gb|KDC91194.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD670]
 gb|KDC92402.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD675]
 gb|KDD03143.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD681]
 gb|KDD04360.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD698]
 gb|KDD11996.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD707]
 gb|KDD18892.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD731]
 gb|KDD22482.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD785]
 gb|KDD27213.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD782]
 gb|KDD31417.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD849]
 gb|KDD38831.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD839]
 gb|KDD40709.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica OSU095]
 gb|KDD45253.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD901]
 gb|KDD50507.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica RB630]
 gb|KDD53859.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica OSU553]
 gb|KDD63760.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica SO10328]
 gb|KDD83246.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD678]
 gb|KDD87018.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MBORD762]
 gb|KDD91908.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica MO275]
 gb|KDD97377.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica SBL-F6116]
 gb|KDS77850.1| methionine sulfoxide reductase B [Bordetella bronchiseptica KM22]
 gb|KFJ70850.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica]
Length=133

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +LT +++ + RQKGTERAF+G YWDT TPG Y C+ C TPLF S TKFD+G G
Sbjct  7    TDAEWRTQLTPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+    V+ +LD S   M R EVLC  CDAHLGHVF DGPEPTG RYCINS +L
Sbjct  67   WPSYFEPLAPERVREELDTS-HGMVRTEVLCNICDAHLGHVFPDGPEPTGLRYCINSLSL  125

Query  667  K  669
            K
Sbjct  126  K  126



>gb|EEY90813.1| methionine-R-sulfoxide reductase [Acinetobacter lwoffii SH145]
Length=141

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW++ L+ ++F ITR+KGTE AFTG+YW+TK  GTY C CC TPLF S TK+DSG G
Sbjct  9    SDREWQRELSPEEFRITREKGTEPAFTGKYWNTKQDGTYVCRCCGTPLFSSETKYDSGCG  68

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+PV ++V  +L  +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L
Sbjct  69   WPSFYRPVSSSVVEELPDTSHGMVRTEIVCHHCDAHLGHVFPDGPEPTGLRYCVNSASL  127



>ref|WP_004645533.1| MULTISPECIES: peptide methionine sulfoxide reductase msrB [Acinetobacter]
 gb|ENU17184.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
CIP A162]
 gb|ENU62086.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii 
NIPH 715]
 gb|ENW29497.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii 
CIP 70.31]
 gb|ENX13842.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
CIP 51.11]
 gb|ENX19786.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
CIP 102136]
 gb|ENX27175.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
CIP 101966]
 gb|ENX31579.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
CIP 64.7]
 gb|ESJ96618.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii 
NIPH 512]
 gb|KGH46428.1| methionine sulfoxide reductase B [Acinetobacter sp. MII]
Length=139

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW++ L+ ++F ITR+KGTE AFTG+YW+TK  GTY C CC TPLF S TK+DSG G
Sbjct  7    SDREWQRELSPEEFRITREKGTEPAFTGKYWNTKQDGTYVCRCCGTPLFSSETKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+PV ++V  +L  +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L
Sbjct  67   WPSFYRPVSSSVVEELPDTSHGMVRTEIVCHHCDAHLGHVFPDGPEPTGLRYCVNSASL  125



>ref|WP_027864150.1| methionine sulfoxide reductase B [Massilia alkalitolerans]
Length=131

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
             D  + SD EW+ +L   Q+ +TR   TERAFTG+YWD    G YHCVCCDTPLFES  K
Sbjct  2    NDKVTKSDAEWRAQLDPMQYQVTRHAATERAFTGKYWDHHEHGIYHCVCCDTPLFESDAK  61

Query  472  FDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC  648
            FDSG GWPSY+K +  +NV  K+D S   M R E++CA CDAHLGHVF DGP PTG RYC
Sbjct  62   FDSGCGWPSYFKALDPDNVIEKVDRS-HGMLRTEIICAICDAHLGHVFPDGPPPTGLRYC  120

Query  649  INSAALK  669
            INSAA++
Sbjct  121  INSAAMR  127



>ref|WP_007196734.1| methionine sulfoxide reductase B [Hoeflea phototrophica]
 gb|EDQ33728.1| methionine-R-sulfoxide reductase [Hoeflea phototrophica DFL-43]
Length=135

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 0/122 (0%)
 Frame = +1

Query  301  SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS  480
            ++ SD EW+ +LT +Q+Y+TRQ GTE+AFTG  WD K PG Y CVCC   LF S TKF+S
Sbjct  9    TARSDAEWRAQLTAEQYYVTRQHGTEQAFTGPNWDQKAPGLYRCVCCRQALFRSETKFES  68

Query  481  GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA  660
            GTGWPS+ +PV     S+      FM R E+ CA C+AHLGHVF DGPEPTGKRYC+N  
Sbjct  69   GTGWPSFCQPVAPETVSEHKDRSFFMVRIEIRCAGCEAHLGHVFKDGPEPTGKRYCMNGT  128

Query  661  AL  666
            A+
Sbjct  129  AM  130



>ref|WP_002758329.1| methionine sulfoxide reductase B [Microcystis aeruginosa]
 emb|CCH96248.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9717]
 emb|CCI18356.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9807]
Length=138

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANETNIKYERDIS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_025899968.1| peptide methionine sulfoxide reductase [Sneathiella glossodoripedis]
Length=133

 Score =   160 bits (405),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EWK  LT +Q+ ITR+KGTERAFTG Y   K  G Y C+CCD PLF S  KFDSGTG
Sbjct  7    SDAEWKALLTPEQYKITRKKGTERAFTGAYDGNKRSGVYRCICCDEPLFSSEAKFDSGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+P+   +  +++    FM R EV+C  CDAHLGHVF DGP PTG RYC+NSAAL
Sbjct  67   WPSFYEPLNPEMVGEVEDRSFFMRRTEVICNKCDAHLGHVFPDGPAPTGLRYCLNSAAL  125



>emb|CCI31716.1| peptide methionine sulfoxide reductase msrB [Microcystis sp. 
T1-4]
Length=138

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFASDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>gb|ACL46530.1| methionine-R-sulfoxide reductase [Cyanothece sp. PCC 7425]
Length=148

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  319  EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS  498
            EW+ +LT +Q+ +TRQKGTERAFTGEY+  K PG Y CVCC T LFES +K++SGTGWPS
Sbjct  23   EWQAQLTPEQYAVTRQKGTERAFTGEYYQNKKPGIYRCVCCGTELFESDSKYESGTGWPS  82

Query  499  YYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +++P+ +   +  +    FM R EVLCA CDAHLGHVF DGP+PTG RYCINS AL+
Sbjct  83   FWQPLDDTAIALKEDYSHFMHRTEVLCARCDAHLGHVFPDGPQPTGLRYCINSVALQ  139



>emb|CCI29297.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9809]
Length=138

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_017295985.1| hypothetical protein [Geminocystis herdmanii]
Length=140

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EWK+ LT +QF +TR+ GTERAFTGEY D K  G Y CVCC   LF S TK++SGTG
Sbjct  8    TETEWKEILTPEQFQVTRKHGTERAFTGEYHDYKGKGIYKCVCCGNELFVSDTKYNSGTG  67

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++PV  ++V  K D+S  FM R EVLC  CDAHLGHVFDDGP+PTGKRYC+NSAAL
Sbjct  68   WPSFWQPVKEDSVAYKTDVS-FFMKRTEVLCNTCDAHLGHVFDDGPKPTGKRYCMNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>emb|CCI37930.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9701]
Length=138

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWRDQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_043267144.1| methionine sulfoxide reductase B [Pseudomonas sp. AAC]
 gb|KES25349.1| methionine sulfoxide reductase B [Pseudomonas sp. AAC]
Length=133

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            E W++ L  QQF+I R  GTERAFTGEY+ TKTPG YHCVCC   LF+S  K+DSG+GWP
Sbjct  9    ESWREELDEQQFHICRLGGTERAFTGEYYATKTPGIYHCVCCGAALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV     ++L+     M R EV CAAC+AHLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVSKQAIAELEDFSHGMHRIEVRCAACEAHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_022934414.1| peptide methionine sulfoxide reductase [Synergistetes bacterium 
JGI 0000079-D21]
Length=131

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +1

Query  313  DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW  492
            +++W K LT +QF ITR+KGTE  F+G YWD    GTY CVCC   LF+S  KFDSGTGW
Sbjct  9    EDDWAKELTPEQFRITRKKGTEPPFSGRYWDHHEDGTYVCVCCGNELFDSRDKFDSGTGW  68

Query  493  PSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            PS+ KP+G + V+++ DLS  FM R EVLCA CDAHLGHVFDDGP PTGKRYCINSA+L
Sbjct  69   PSFKKPLGADRVETREDLS-HFMRRVEVLCARCDAHLGHVFDDGPPPTGKRYCINSASL  126



>emb|CCI02637.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9443]
Length=138

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQDQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANETNIKYERDIS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_039899783.1| peptide methionine sulfoxide reductase [Microcystis sp. T1-4]
Length=132

 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFASDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_041237285.1| peptide methionine sulfoxide reductase [Cyanothece sp. PCC 7425]
Length=132

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  319  EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS  498
            EW+ +LT +Q+ +TRQKGTERAFTGEY+  K PG Y CVCC T LFES +K++SGTGWPS
Sbjct  7    EWQAQLTPEQYAVTRQKGTERAFTGEYYQNKKPGIYRCVCCGTELFESDSKYESGTGWPS  66

Query  499  YYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            +++P+ +   +  +    FM R EVLCA CDAHLGHVF DGP+PTG RYCINS AL+
Sbjct  67   FWQPLDDTAIALKEDYSHFMHRTEVLCARCDAHLGHVFPDGPQPTGLRYCINSVALQ  123



>ref|WP_012264512.1| methionine sulfoxide reductase B [Microcystis aeruginosa]
 dbj|BAG00845.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa 
NIES-843]
Length=132

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_043996314.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa]
Length=132

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWQDQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANETNIKYERDIS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_024970986.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa]
Length=138

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TETEWQTQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANETNIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>emb|CCI07308.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 7941]
 gb|EPF24267.1| Peptide methionine sulfoxide reductase MsrB [Microcystis aeruginosa 
SPC777]
Length=138

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TETEWQTQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_016167511.1| MULTISPECIES: peptide methionine sulfoxide reductase msrB [Bacteria]
 gb|EOR06603.1| peptide methionine sulfoxide reductase msrB [Acinetobacter tandoii 
DSM 14970 = CIP 107469]
Length=139

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            S +D EW++ L+ ++F ITRQKGTE AFTG+YW++K  GTY C CC TPLF S+TK+DSG
Sbjct  5    SKTDREWQRELSPEEFRITRQKGTEPAFTGKYWNSKQEGTYVCRCCGTPLFSSTTKYDSG  64

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
             GWPS++KP+      +L  +   M R E++C  CDAHLGHVF+DGP+PTG RYC+NSA+
Sbjct  65   CGWPSFFKPIAGGAIDELQDNSHGMERTEIVCHHCDAHLGHVFEDGPQPTGLRYCVNSAS  124

Query  664  LK  669
            L+
Sbjct  125  LE  126



>ref|WP_043998091.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa]
Length=132

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWRDQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_003801011.1| methionine sulfoxide reductase B [Alcaligenes faecalis]
 gb|EJC64923.1| methionine sulfoxide reductase B [Alcaligenes faecalis subsp. 
faecalis NCIB 8687]
Length=131

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +L+ ++FY+TRQKGTER FTG YWDT T G Y CV C TPLF S TKFD+G G
Sbjct  7    TEAEWRAQLSPEEFYVTRQKGTERPFTGRYWDTTTAGIYRCVGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY+ P+  +NV+ +LD S   M R EVLC  CDAHLGHVF+DGP PTG RYCINS +L
Sbjct  67   WPSYFTPLNPDNVREELDTS-HGMRRTEVLCNVCDAHLGHVFEDGPPPTGLRYCINSLSL  125



>ref|WP_015164205.1| Peptide methionine sulfoxide reductase msrB [Pseudanabaena sp. 
PCC 7367]
 gb|AFY69232.1| Peptide methionine sulfoxide reductase msrB [Pseudanabaena sp. 
PCC 7367]
Length=134

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+++LT  Q+ +TRQKGTER F  EY+D K  G Y C+CC T LF S TK++SGTG
Sbjct  11   SDTEWREQLTPLQYKVTRQKGTERPFANEYFDNKAKGIYKCICCGTELFSSDTKYESGTG  70

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS++ P+ ++  +  + + +FM R EVLCA CDAHLGHVF DGP PTG+RYC+NSA+LK
Sbjct  71   WPSFWAPIDDDHVATEEDNALFMRRTEVLCAVCDAHLGHVFRDGPAPTGQRYCMNSASLK  130



>ref|WP_002750849.1| methionine sulfoxide reductase B [Microcystis aeruginosa]
 emb|CAO87936.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94649.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9432]
Length=138

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E+LCA CDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANETNIKYERDVS-FFMVRTEILCATCDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_027591782.1| MULTISPECIES: methionine sulfoxide reductase B [Pseudomonadaceae]
 gb|KHL68803.1| peptide methionine sulfoxide reductase msrB [Serpens flexibilis]
 gb|KHO65945.1| methionine sulfoxide reductase B [Pseudomonas tuomuerensis]
Length=134

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            + W+  LT +QF+I R  GTERAF+GEY+ T+TPG Y C CC  PLF+S TK+DSG+GWP
Sbjct  9    DAWRDELTPEQFHICRLGGTERAFSGEYYATRTPGIYQCACCQAPLFDSDTKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            SY++PV N    +L+ S   M R EV CA CDAHLGHVF DGP PTG RYCINSA+L
Sbjct  69   SYFQPVSNEAVRELEDSSHGMQRIEVRCARCDAHLGHVFPDGPRPTGLRYCINSASL  125



>emb|CDI01681.1| methionine sulfoxide reductase B [Candidatus Competibacter denitrificans 
Run_A_D11]
Length=140

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
            +SNK   S ++ EW+ +LT +QF I R+KGTERAFTG Y D   PG Y CVCC   LF+S
Sbjct  1    MSNK--ISKTEAEWRAQLTPEQFAICREKGTERAFTGHYHDCHEPGIYRCVCCGKALFDS  58

Query  463  STKFDSGTGWPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            +TKFDSG+GWPS+++PV  +NV +  D S  FM R EV+CA C AHLGHVFDDGP+PTG 
Sbjct  59   NTKFDSGSGWPSFWQPVQADNVATAEDRSF-FMRRTEVVCADCGAHLGHVFDDGPKPTGL  117

Query  640  RYCINSAALK  669
            RYCINSA+L+
Sbjct  118  RYCINSASLR  127



>ref|WP_036229421.1| methionine sulfoxide reductase B [Massilia sp. JS1662]
 gb|KGF82992.1| methionine sulfoxide reductase B [Massilia sp. JS1662]
Length=131

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D  + +D EW+ +L   ++ +TR   TERAFTG+YWD    G YHCVCCDTPLFES  KF
Sbjct  3    DKVTKTDAEWRAQLDPMEYQVTRHAATERAFTGKYWDHHEHGIYHCVCCDTPLFESDAKF  62

Query  475  DSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI  651
            DSG GWPSY+K +  +NV  K+D S   M R E++CA CDAHLGHVF DGP PTG RYCI
Sbjct  63   DSGCGWPSYFKALDPDNVIEKVDRS-HGMVRTEIICAVCDAHLGHVFPDGPPPTGLRYCI  121

Query  652  NSAALK  669
            NSAAL+
Sbjct  122  NSAALR  127



>ref|WP_036395302.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa]
Length=132

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TETEWQTQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CAACDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANEANIKYERDVS-FFMVRTEIVCAACDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_012106145.1| peptide methionine sulfoxide reductase [Methanoregula boonei]
 ref|YP_001403767.1| methionine-R-sulfoxide reductase [Methanoregula boonei 6A8]
 gb|ABS55124.1| methionine-R-sulfoxide reductase [Methanoregula boonei 6A8]
Length=163

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
              V  +     +D EW+ +LT +QF + R++GTE AFTG+Y D K PGTY C CC TPLF
Sbjct  23   GRVEERTVIQKTDAEWQAQLTPEQFSVARKQGTEYAFTGKYHDCKAPGTYCCACCGTPLF  82

Query  457  ESSTKFDSGTGWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT  633
             S TKFDSGTGWPS+  PV   NV++  D S   M R EVLCA C AHLGHVFDDGP+PT
Sbjct  83   SSDTKFDSGTGWPSFSAPVSPLNVRTHTDRS-NGMVRTEVLCARCRAHLGHVFDDGPKPT  141

Query  634  GKRYCINSAAL  666
            GKRYC+NSAAL
Sbjct  142  GKRYCMNSAAL  152



>ref|WP_006854465.1| methionine sulfoxide reductase B [Synechococcus sp. WH 8016]
 gb|EHA60542.1| Peptide methionine sulfoxide reductase msrB [Synechococcus sp. 
WH 8016]
Length=141

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +1

Query  283  VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES  462
            V+  D    + EEW+++L+  QF + RQ GTE AFTG YWD K  G YHCVCCD PLF S
Sbjct  6    VAGGDRVERTPEEWRQQLSPTQFQVARQGGTEAAFTGAYWDHKEDGMYHCVCCDAPLFSS  65

Query  463  STKFDSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK  639
            STKF+SGTGWPS++  V    +++  D S   M R E+LCA CDAHLGHVF+DGP PTG+
Sbjct  66   STKFESGTGWPSFWNGVTQGAIRTHEDRSHGMM-RTEILCARCDAHLGHVFNDGPAPTGQ  124

Query  640  RYCINSAAL  666
            RYC NSA+L
Sbjct  125  RYCTNSASL  133



>ref|WP_033463228.1| methionine sulfoxide reductase B [Bordetella bronchiseptica]
 gb|KCV64216.1| methionine-R-sulfoxide reductase [Bordetella bronchiseptica 99-R-0433]
Length=133

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +LT +++ + RQKGTERAFTG YW+T TPG Y C+ C TPLF S TKFD+G G
Sbjct  7    TDAEWRAQLTPEEYAVARQKGTERAFTGRYWNTTTPGIYRCIGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+    V+ +LD S   M R EVLC  CDAHLGHVF DGPEPTG RYCINS +L
Sbjct  67   WPSYFEPLAPERVREELDTS-HGMVRTEVLCNICDAHLGHVFPDGPEPTGLRYCINSLSL  125

Query  667  K  669
            +
Sbjct  126  Q  126



>ref|WP_034431472.1| hypothetical protein [Candidatus Contendobacter odensis]
 emb|CDH44312.1| Peptide methionine sulfoxide reductase MsrB [Candidatus Contendobacter 
odensis Run_B_J11]
Length=133

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
             D S  +D EW+ +LT +Q+ I RQKGTE AFTGEY D   PG Y C CC   LF+S TK
Sbjct  2    NDKSVKTDAEWRAQLTPEQYRICRQKGTEPAFTGEYHDCHEPGIYRCACCGKDLFDSETK  61

Query  472  FDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI  651
            FDSG+GWPS+++PV +   +  D    FM R EVLCA C AHLGHVFDDGPEPTG RYCI
Sbjct  62   FDSGSGWPSFWQPVRSENIATTDDRGWFMHRTEVLCADCGAHLGHVFDDGPEPTGLRYCI  121

Query  652  NSAALK  669
            NSA+LK
Sbjct  122  NSASLK  127



>ref|WP_008931849.1| methionine sulfoxide reductase B [Ectothiorhodospira sp. PHS-1]
 gb|EHQ52282.1| methionine-R-sulfoxide reductase [Ectothiorhodospira sp. PHS-1]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            S S+  W+  LT +Q+ +TR+ GTERAFTG + D K  G YHC+CCD PLF S  K+DSG
Sbjct  6    SKSEARWRAELTPEQYRVTREAGTERAFTGCFHDHKAAGVYHCICCDAPLFNSDHKYDSG  65

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
            +GWPSY++PV  +   +     +FM R EV CA CDAHLGHVF+DGP PTG RYCINSAA
Sbjct  66   SGWPSYWQPVSESALERHVDRSLFMTRVEVRCAGCDAHLGHVFEDGPPPTGLRYCINSAA  125

Query  664  LK  669
            L+
Sbjct  126  LR  127



>ref|WP_010931540.1| methionine sulfoxide reductase B [Bordetella pertussis]
 ref|NP_882077.1| methionine sulfoxide reductase B [Bordetella pertussis Tohama 
I]
 emb|CAE43823.1| peptide methionine sulfoxide reductase [Bordetella pertussis 
Tohama I]
 gb|AEE68691.1| methionine sulfoxide reductase B [Bordetella pertussis CS]
 emb|CCJ64120.1| peptide methionine sulfoxide reductase [Bordetella pertussis 
18323]
 gb|ETA64231.1| methionine-R-sulfoxide reductase [Bordetella pertussis CHLA-11]
 gb|ETH01346.1| methionine-R-sulfoxide reductase [Bordetella pertussis 2250905]
 gb|ETH04058.1| methionine-R-sulfoxide reductase [Bordetella pertussis 2356847]
 gb|ETH06431.1| methionine-R-sulfoxide reductase [Bordetella pertussis 2371640]
 gb|ETH12470.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-SEAT-0006]
 gb|ETH17598.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-SEAT-0007]
 gb|ETH20050.1| methionine-R-sulfoxide reductase [Bordetella pertussis CHLA-13]
 gb|ETH23312.1| methionine-R-sulfoxide reductase [Bordetella pertussis CHLA-15]
 gb|ETH26579.1| methionine-R-sulfoxide reductase [Bordetella pertussis CHLA-20]
 gb|ETH30551.1| methionine-R-sulfoxide reductase [Bordetella pertussis CHLA-26]
 gb|ETH37184.1| methionine-R-sulfoxide reductase [Bordetella pertussis H897]
 gb|ETH39519.1| methionine-R-sulfoxide reductase [Bordetella pertussis H918]
 gb|ETH42892.1| methionine-R-sulfoxide reductase [Bordetella pertussis H939]
 gb|ETH47000.1| methionine-R-sulfoxide reductase [Bordetella pertussis H921]
 gb|ETH50339.1| methionine-R-sulfoxide reductase [Bordetella pertussis H973]
 gb|ETH53743.1| methionine-R-sulfoxide reductase [Bordetella pertussis I002]
 gb|ETH59815.1| methionine-R-sulfoxide reductase [Bordetella pertussis I036]
 gb|ETH62487.1| methionine-R-sulfoxide reductase [Bordetella pertussis I176]
 gb|ETH68763.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHLA-0006]
 gb|ETH70299.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHLA-0011]
 gb|ETH73907.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOC-0008]
 gb|ETH80651.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOC-0016]
 gb|ETH88429.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOC-0018]
 gb|ETH92025.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOC-0019]
 gb|ETH96922.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOC-0021]
 gb|ETH98118.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CHOM-0012]
 gb|ETI05061.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-SEAT-0004]
 gb|ETI06580.1| methionine-R-sulfoxide reductase [Bordetella pertussis STO1-CNMC-0004]
 gb|KCV21011.1| methionine-R-sulfoxide reductase [Bordetella pertussis H934]
 gb|KCV22832.1| methionine-R-sulfoxide reductase [Bordetella pertussis B200]
 gb|AIW93568.1| methionine sulfoxide reductase B [Bordetella pertussis B1917]
 gb|AIW94507.1| methionine sulfoxide reductase B [Bordetella pertussis B1920]
 gb|AJB25366.1| methionine sulfoxide reductase B [Bordetella pertussis 137]
Length=133

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L  +++ + RQKGTERAF+G YWDT TPG Y C+ C TPLF S TKFD+G G
Sbjct  7    TDAEWRTQLAPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+    V+ +LD S   M R EVLC  CDAHLGHVF DGPEPTG RYCINS +L
Sbjct  67   WPSYFEPLAPERVREELDTS-HGMVRTEVLCNICDAHLGHVFPDGPEPTGLRYCINSLSL  125

Query  667  K  669
            K
Sbjct  126  K  126



>gb|ELS47740.1| peptide methionine sulfoxide reductase MsrB [Microcystis aeruginosa 
DIANCHI905]
Length=132

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  8    TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  67

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E+LCA CDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  68   WPSFWTAANETNIKYERDVS-FFMVRTEILCATCDAHLGHVFNDGPPPTGKRYCLNSAAL  126

Query  667  K  669
            +
Sbjct  127  Q  127



>ref|WP_028990572.1| hypothetical protein [Thermithiobacillus tepidarius]
Length=130

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEWK +LT +Q+YITRQ GTE AFTG Y   K  G YHCV C  PLF S+ KFDSGTG
Sbjct  7    SDEEWKAQLTPEQYYITRQGGTEPAFTGRYCRHKDTGVYHCVNCGAPLFSSAQKFDSGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPSY+ PV        D   + M R EV CA C AHLGHVFDDGPEPTG RYCINSAAL+
Sbjct  67   WPSYWAPVAPAAVEMRDDYSLGMHRVEVNCANCGAHLGHVFDDGPEPTGLRYCINSAALE  126



>ref|WP_039743365.1| hypothetical protein [Geobacter pickeringii]
 gb|AJE03901.1| hypothetical protein GPICK_11550 [Geobacter pickeringii]
Length=132

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L+ +Q+ ITR+KGTERAFTGEYW++   GTY CVCC   LF SS KFDSGTG
Sbjct  9    TDAEWRAQLSPEQYEITRKKGTERAFTGEYWNSHDVGTYRCVCCGAELFRSSDKFDSGTG  68

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+  PV   +V+S+ D S  FM R E+ C +C AHLGH+F DGP PTGKRYCINSAAL
Sbjct  69   WPSFTAPVATESVESEEDRS-FFMRRTEIHCTSCGAHLGHLFGDGPAPTGKRYCINSAAL  127

Query  667  K  669
            +
Sbjct  128  R  128



>ref|WP_044193003.1| hypothetical protein [Hyalangium minutum]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +DEEWKK+L  +Q+ I R+KGTERAFTG YWD    G Y C  C   LF S TKFDSGTG
Sbjct  12   TDEEWKKQLNPEQYRILRKKGTERAFTGAYWDHHEAGVYRCAGCGNALFASETKFDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV + + ++ D S  FM R EV+C+ C  HLGHVF DGP PTG+RYCINSAAL
Sbjct  72   WPSFWAPVASGMVAEHDDSSFFMRRTEVVCSRCQGHLGHVFPDGPRPTGQRYCINSAAL  130



>ref|WP_024766956.1| methionine sulfoxide reductase B [Pseudomonas nitroreducens]
Length=131

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            + W+  LT +QF++ R  GTERAFTGEY DTKTPG YHCVCC T LF+S  K+DSG+GWP
Sbjct  9    DSWRDELTDEQFHVCRLGGTERAFTGEYHDTKTPGIYHCVCCGTALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV   V  +L+     M R EV C  CD+HLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVNGEVVKELEDFSHGMHRIEVRCGKCDSHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_011843871.1| peptide methionine sulfoxide reductase [Methanoculleus marisnigri]
 ref|YP_001046942.1| methionine sulfoxide reductase B [Methanoculleus marisnigri JR1]
 gb|ABN56960.1| methionine-R-sulfoxide reductase [Methanoculleus marisnigri JR1]
Length=161

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+++LT +QF + R++GTE AFTG+YWD K  G Y CVCC   LF S TKF+SGTG
Sbjct  31   SDEEWRRQLTPEQFSVARKEGTEPAFTGKYWDCKEDGLYVCVCCGNHLFSSKTKFESGTG  90

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ KPV + NV+++ D +  FM R EVLC  CDAHLGHVFDDGP PT +RYC+NSA+L
Sbjct  91   WPSFSKPVSDLNVRAEPD-TRFFMNRTEVLCRRCDAHLGHVFDDGPPPTHQRYCMNSASL  149

Query  667  K  669
            +
Sbjct  150  R  150



>ref|WP_036206181.1| methionine sulfoxide reductase B [Massilia sp. LC238]
 gb|KFC76268.1| Peptide methionine sulfoxide reductase MsrB [Massilia sp. LC238]
Length=131

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
             D  + SD EW+ +L   ++ +TR   TERAFTG+YWD    G YHCVCCDTPLFES  K
Sbjct  2    NDKVTKSDAEWRAQLDPMEYQVTRHAATERAFTGKYWDHHEHGIYHCVCCDTPLFESDAK  61

Query  472  FDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC  648
            FDSG GWPSY++ +  +NV  K+D S   M R E++CA CDAHLGHVF DGP PTG RYC
Sbjct  62   FDSGCGWPSYFRALDPDNVIEKVDRS-HGMLRTEIICAVCDAHLGHVFPDGPPPTGLRYC  120

Query  649  INSAALK  669
            INSAA++
Sbjct  121  INSAAMR  127



>gb|KFE66161.1| Peptide methionine sulfoxide reductase MsrB [Hyalangium minutum]
Length=138

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +DEEWKK+L  +Q+ I R+KGTERAFTG YWD    G Y C  C   LF S TKFDSGTG
Sbjct  14   TDEEWKKQLNPEQYRILRKKGTERAFTGAYWDHHEAGVYRCAGCGNALFASETKFDSGTG  73

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV + + ++ D S  FM R EV+C+ C  HLGHVF DGP PTG+RYCINSAAL
Sbjct  74   WPSFWAPVASGMVAEHDDSSFFMRRTEVVCSRCQGHLGHVFPDGPRPTGQRYCINSAAL  132



>ref|WP_037014221.1| methionine sulfoxide reductase B [Pseudomonas nitroreducens]
Length=131

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  316  EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP  495
            + W+  LT +QF++ R  GTERAFTGEY DTKTPG YHCVCC T LF+S  K+DSG+GWP
Sbjct  9    DSWRDELTDEQFHVCRLGGTERAFTGEYHDTKTPGIYHCVCCGTALFDSDAKYDSGSGWP  68

Query  496  SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            SY++PV   V  +L+     M R EV C  CD+HLGHVF DGP PTG RYCINSA+LK
Sbjct  69   SYFQPVNGEVVKELEDFSHGMHRIEVRCGKCDSHLGHVFPDGPRPTGLRYCINSASLK  126



>ref|WP_043212549.1| methionine sulfoxide reductase B [Bordetella hinzii]
 gb|KCB36612.1| methionine-R-sulfoxide reductase [Bordetella hinzii 8-296-03]
Length=133

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+ +L+ Q+F++TR+KGTERAFTG YWDT T G Y CV C TPLF S TKFD+G G
Sbjct  7    SDAEWRAQLSPQEFHVTREKGTERAFTGRYWDTFTEGIYRCVACGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+    V+ + D S   M R EVLC  CD+HLGHVF DGPEPTG RYCINS +L
Sbjct  67   WPSYFEPIDPARVREETDTS-HGMVRTEVLCNICDSHLGHVFPDGPEPTGLRYCINSLSL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_005106520.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii]
 gb|ENW31689.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii 
NIPH 478]
Length=139

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW++ L+ ++F ITR+KGTE  FTG+YW+TK  GTY C CC TPLF S TK+DSG G
Sbjct  7    SDREWQRELSPEEFRITREKGTEPPFTGKYWNTKQDGTYVCRCCGTPLFSSETKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y+PV ++V  +L  +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L
Sbjct  67   WPSFYRPVSSSVVEELPDTSHGMVRTEIVCHHCDAHLGHVFPDGPEPTGLRYCVNSASL  125



>ref|WP_027601226.1| MULTISPECIES: methionine sulfoxide reductase B [Pseudomonas]
Length=133

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S E+W++RLT  QF + R   TER +TG Y +TKTPG YHC CC+  LF+SSTKFDSG G
Sbjct  7    SPEDWRERLTDDQFRVCRLAATERPYTGAYCNTKTPGVYHCACCELALFDSSTKFDSGCG  66

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSYY P+ G  V+ K D S   M R EVLCA CDAHLGHVF DGP PTG RYCINS AL
Sbjct  67   WPSYYAPIDGEAVREKEDFS-HGMHRVEVLCARCDAHLGHVFPDGPPPTGLRYCINSVAL  125

Query  667  K  669
            +
Sbjct  126  Q  126



>ref|WP_028033320.1| methionine sulfoxide reductase B [Chelativorans sp. J32]
Length=135

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+K LT +Q+++TR+ GTERAFTG YWD K  G Y CV C  PLF S TK+DSGTG
Sbjct  12   SDEEWRKELTPEQYHVTREHGTERAFTGPYWDNKRQGLYRCVACGRPLFSSETKYDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y P   +  +    +   M R EV CA CD+HLGH+FDDGP PTG RYC+N  ALK
Sbjct  72   WPSFYAPADTDAVTLHKDNSFLMTRVEVRCADCDSHLGHLFDDGPAPTGLRYCMNGTALK  131



>gb|ABG62263.1| methionine-R-sulfoxide reductase [Chelativorans sp. BNC1]
Length=136

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+K LT +Q+++TR+ GTERAFTG YWD K  G Y CV C  PLF S TK+DSGTG
Sbjct  13   SDEEWRKDLTPEQYHVTREHGTERAFTGPYWDNKREGVYRCVACGRPLFSSETKYDSGTG  72

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+ ++  S        M R EV CA CD+HLGHVFDDGP PTG RYC+N  AL
Sbjct  73   WPSFYAPMDDDAVSLHKDQSYSMTRTEVRCAECDSHLGHVFDDGPAPTGLRYCMNGNAL  131



>ref|WP_004866470.1| peptide methionine sulfoxide reductase msrB [Acinetobacter gerneri]
 gb|ENV32669.1| peptide methionine sulfoxide reductase msrB [Acinetobacter gerneri 
DSM 14967 = CIP 107464]
 gb|EPR80828.1| Peptide methionine sulfoxide reductase MsrB [Acinetobacter gerneri 
MTCC 9824]
Length=139

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+ ++F ITRQKGTE AFTG++W+TK  GTY C CC  PLF S TKFDSG G
Sbjct  7    TDREWQRELSPEEFRITRQKGTEAAFTGKFWNTKQQGTYVCRCCGEPLFSSETKFDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS++KP+  +V  + + +   M R E++C  CDAHLGHVF+DGP+PTG RYC+NSA+L+
Sbjct  67   WPSFFKPINTSVIEEHEDTTHGMVRTEIVCHHCDAHLGHVFEDGPQPTGLRYCVNSASLE  126



>gb|KDE56182.1| peptide methionine sulfoxide reductase [Methanoculleus sp. MH98A]
Length=161

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+++LT +QF + R++GTE AFTG+YWD K  G Y CVCC   LF S TKF+SGTG
Sbjct  31   SDEEWRRQLTPEQFSVARKEGTEPAFTGKYWDCKEDGLYVCVCCGNHLFSSETKFESGTG  90

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+ KPV + N++++ D +  FM R EVLC  CDAHLGHVFDDGP PT +RYC+NSA+L
Sbjct  91   WPSFSKPVSDRNIRTEPD-TRFFMNRTEVLCRRCDAHLGHVFDDGPPPTHQRYCMNSASL  149

Query  667  K  669
            +
Sbjct  150  R  150



>ref|WP_007162231.1| MULTISPECIES: methionine sulfoxide reductase B [Pseudomonas]
 gb|EHK69487.1| methionine sulfoxide reductase B [Pseudomonas psychrotolerans 
L19]
 gb|KIZ48308.1| methionine sulfoxide reductase B [Pseudomonas oryzihabitans]
Length=133

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S E+W++RLT  QF + R   TER +TG Y +TKTPG YHC CC+  LF+SSTKFDSG G
Sbjct  7    SPEDWRERLTDDQFRVCRLAATERPYTGAYCNTKTPGVYHCACCELALFDSSTKFDSGCG  66

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSYY P+ G  V+ K D S   M R EVLCA CDAHLGHVF DGP PTG RYCINS AL
Sbjct  67   WPSYYAPIDGEAVREKEDFS-HGMHRVEVLCARCDAHLGHVFPDGPPPTGLRYCINSVAL  125

Query  667  K  669
            +
Sbjct  126  Q  126



>ref|WP_043401389.1| hypothetical protein [Cystobacter violaceus]
Length=129

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +Q+ + R++GTERAFTG+YWD K  GTYHC  C  PLF S TKFDSGTG
Sbjct  7    TDAEWKQQLTPEQYKVLRKQGTERAFTGKYWDLKAAGTYHCAACGQPLFSSETKFDSGTG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++ +   V S  D S + M R EV+C  C +HLGHVFDDGPEPTG RYC+NS AL
Sbjct  67   WPSFWQALPGAVDSHEDRSWL-MVRTEVVCGRCGSHLGHVFDDGPEPTGLRYCMNSVAL  124



>ref|WP_024546824.1| peptide methionine sulfoxide reductase [Synechococcus sp. NKBG15041c]
Length=133

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+ +L+ + + + R+ GTERAFTGEY D K  GTY+CVCC  PLF S TKF+SGTG
Sbjct  8    TDAEWQAQLSPEAYKVARKHGTERAFTGEYHDFKGEGTYNCVCCGNPLFTSDTKFNSGTG  67

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++PV +  +  K D S  FM R EVLC+ CDAHLGHVF+DGP PTG RYCINS AL
Sbjct  68   WPSYWQPVNDTAITEKSDFS-FFMKRTEVLCSKCDAHLGHVFNDGPPPTGLRYCINSVAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_002783632.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa]
 emb|CCI13114.1| peptide methionine sulfoxide reductase msrB [Microcystis aeruginosa 
PCC 9806]
Length=138

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CA CDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTAANETNIKYERDVS-FFMVRTEIVCATCDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_025511310.1| methionine sulfoxide reductase B [Oxalobacteraceae bacterium 
JGI 0001012-C15]
Length=131

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  295  DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF  474
            D  + +D EW+ +L   ++ +TR   TERAFTG+YWD    G YHCVCCDTPLFES  KF
Sbjct  3    DKVTKTDAEWRAQLDPMEYQVTRHAATERAFTGKYWDHHEHGIYHCVCCDTPLFESDAKF  62

Query  475  DSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI  651
            DSG GWPSY+K +  +NV  K+D +   M R E++CA CDAHLGHVF DGP PTG RYCI
Sbjct  63   DSGCGWPSYFKALDPDNVIEKVDRT-HGMVRTEIICAVCDAHLGHVFPDGPPPTGLRYCI  121

Query  652  NSAALK  669
            NSAAL+
Sbjct  122  NSAALR  127



>ref|WP_041545138.1| methionine sulfoxide reductase B [Chelativorans sp. BNC1]
Length=135

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW+K LT +Q+++TR+ GTERAFTG YWD K  G Y CV C  PLF S TK+DSGTG
Sbjct  12   SDEEWRKDLTPEQYHVTREHGTERAFTGPYWDNKREGVYRCVACGRPLFSSETKYDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y P+ ++  S        M R EV CA CD+HLGHVFDDGP PTG RYC+N  AL
Sbjct  72   WPSFYAPMDDDAVSLHKDQSYSMTRTEVRCAECDSHLGHVFDDGPAPTGLRYCMNGNAL  130



>dbj|GAL93218.1| peptide methionine sulfoxide reductase MsrB [Microcystis aeruginosa 
NIES-44]
Length=138

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            ++ EW+ +LT +QF +TR+KGTERAFTG+Y D K  G Y CVCC T LF S +K+DSGTG
Sbjct  14   TEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTG  73

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++      N+K + D+S  FM R E++CA CDAHLGHVF+DGP PTGKRYC+NSAAL
Sbjct  74   WPSFWTATNETNIKYERDVS-FFMVRTEIVCATCDAHLGHVFNDGPPPTGKRYCLNSAAL  132

Query  667  K  669
            +
Sbjct  133  Q  133



>ref|WP_011620360.1| methionine sulfoxide reductase B [Synechococcus sp. CC9311]
 gb|ABI45127.1| methionine-R-sulfoxide reductase [Synechococcus sp. CC9311]
Length=141

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  277  AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF  456
            A ++  D    + EEWK++L+  QF + RQ GTE AFTG YW+ K  G YHCVCCD PLF
Sbjct  4    APIAGGDRVERTPEEWKEKLSPTQFQVARQGGTEAAFTGAYWNHKEDGMYHCVCCDAPLF  63

Query  457  ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG  636
             SSTKF+SGTGWPS++  V        +     M R E+LCA CDAHLGHVF+DGP PTG
Sbjct  64   SSSTKFESGTGWPSFWNGVTEGAIRTHEDRSHGMVRTEILCARCDAHLGHVFNDGPAPTG  123

Query  637  KRYCINSAAL  666
            +RYC NSA+L
Sbjct  124  QRYCTNSASL  133



>ref|WP_018046828.1| hypothetical protein [Nitrospina sp. AB-629-B06]
Length=132

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D+EW+++L+  QF I R+KGTE AF+G YW+TK  G Y C+CC   LF+SS+KFDSGTG
Sbjct  8    NDDEWRQQLSPDQFKICRKKGTEPAFSGSYWNTKETGIYQCICCGNELFDSSSKFDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y+ + +   +  + S +FM R EVLC  CD+HLGHVF DGP+PTG R+CINSA+L+
Sbjct  68   WPSFYQAINSEQVATKEDSSLFMKRTEVLCNKCDSHLGHVFPDGPQPTGLRFCINSASLE  127



>ref|WP_036246971.1| methionine sulfoxide reductase B [Massilia sp. BSC265]
 gb|KFI07684.1| methionine sulfoxide reductase B [Massilia sp. BSC265]
Length=131

 Score =   157 bits (398),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = +1

Query  292  KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK  471
             D  + SD EW+ +L   ++ +TR   TERAFTG+YWD    G YHCVCCDT LFES  K
Sbjct  2    NDKVTKSDAEWRAQLDPMEYQVTRHAATERAFTGKYWDHHEHGIYHCVCCDTALFESDAK  61

Query  472  FDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC  648
            FDSG GWPSY+KP+    V  K+D S   M R E++CA CDAHLGHVF+DGP PTG RYC
Sbjct  62   FDSGCGWPSYFKPLDPAKVIEKVDRS-HGMVRTEIICAVCDAHLGHVFEDGPPPTGLRYC  120

Query  649  INSAALK  669
            INSAA++
Sbjct  121  INSAAMR  127



>ref|WP_004030286.1| methionine sulfoxide reductase B [Methanobacterium formicicum]
 gb|EKF86318.1| peptide methionine sulfoxide reductase msrB [Methanobacterium 
formicicum DSM 3637]
Length=155

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +DEEWK+ LT +QF + R+KGTE AFTG+Y D    G Y CVCC T LF+S TKFDSGTG
Sbjct  30   TDEEWKEILTPKQFDVARKKGTELAFTGKYHDCHEDGIYQCVCCGTDLFDSQTKFDSGTG  89

Query  490  WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ PV + N+ +K D S++ M R EVLCA C AHLGHVFDDGP PTG RYC+NSA+L
Sbjct  90   WPSFWAPVADENITTKTDRSLL-MVRTEVLCARCHAHLGHVFDDGPAPTGLRYCMNSASL  148



>gb|EEF57343.1| methionine-R-sulfoxide reductase [bacterium Ellin514]
Length=178

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+K+LT +QF +TR+KGTERAFTGEY +    G Y CVCC   LF S  KFDSGTG
Sbjct  53   TDAEWQKQLTPEQFKVTRKKGTERAFTGEYANNHEKGIYKCVCCGLDLFSSDAKFDSGTG  112

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+   +V+++ D +  FM R EVLC  C+AHLGHVFDDGP+PTG RYC+NSAAL
Sbjct  113  WPSFWAPLSAESVETRSD-NTFFMKRTEVLCPRCEAHLGHVFDDGPKPTGLRYCLNSAAL  171

Query  667  K  669
            K
Sbjct  172  K  172



>ref|WP_004693474.1| peptide methionine sulfoxide reductase msrB [Acinetobacter johnsonii]
 gb|ENU40611.1| peptide methionine sulfoxide reductase msrB [Acinetobacter johnsonii 
CIP 64.6]
Length=139

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +1

Query  304  SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG  483
            S +D EW++ L+ ++F ITRQKGTE AFTG+YW+TK  GTY C CC TPLF S  K+DSG
Sbjct  5    SKTDREWQRELSPEEFRITRQKGTEPAFTGKYWNTKQAGTYVCRCCGTPLFISENKYDSG  64

Query  484  TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA  663
             GWPS+YKPV   V  +   +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+
Sbjct  65   CGWPSFYKPVNTAVIEEHQDTSHGMVRTEIVCHHCDAHLGHVFTDGPEPTGLRYCVNSAS  124

Query  664  LK  669
            L+
Sbjct  125  LE  126



>ref|WP_029578748.1| methionine sulfoxide reductase B [Bordetella hinzii]
 gb|KCB22140.1| methionine-R-sulfoxide reductase [Bordetella hinzii OH87 BAL007II]
 gb|KCB28530.1| methionine-R-sulfoxide reductase [Bordetella hinzii L60]
 gb|KCB39020.1| methionine-R-sulfoxide reductase [Bordetella hinzii CA90 BAL1384]
 gb|KCB40070.1| methionine-R-sulfoxide reductase [Bordetella hinzii 5132]
 gb|KCB48521.1| methionine-R-sulfoxide reductase [Bordetella hinzii 4161]
 gb|KCB49644.1| methionine-R-sulfoxide reductase [Bordetella hinzii 1277]
Length=133

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SD EW+ +L+ Q+F++TR+KGTERAFTG YWDT T G Y CV C TPLF S TKFD+G G
Sbjct  7    SDAEWRAQLSPQEFHVTREKGTERAFTGRYWDTFTEGIYRCVGCGTPLFASDTKFDAGCG  66

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+    V+ + D S   M R EVLC  CD+HLGHVF DGPEPTG RYCINS +L
Sbjct  67   WPSYFEPIDPARVREETDTS-HGMVRTEVLCNICDSHLGHVFPDGPEPTGLRYCINSLSL  125

Query  667  K  669
            K
Sbjct  126  K  126



>ref|WP_018049533.1| hypothetical protein [Nitrospina sp. AB-629-B18]
Length=132

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D+EW+++L+  QF I R+KGTE AF+G YW+ K  GTY CVCC   LF+SS+KFDSGTG
Sbjct  8    NDDEWRQQLSPDQFRICRKKGTEPAFSGNYWNAKETGTYQCVCCGNELFDSSSKFDSGTG  67

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y+ + +   +  + S +FM R EVLC  CD+HLGHVF DGP+PTG R+CINSA+L+
Sbjct  68   WPSFYQAIDSEKVATKEDSSLFMRRTEVLCNKCDSHLGHVFPDGPQPTGLRFCINSASLE  127



>ref|WP_040550779.1| hypothetical protein [Pedosphaera parvula]
Length=133

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW+K+LT +QF +TR+KGTERAFTGEY +    G Y CVCC   LF S  KFDSGTG
Sbjct  8    TDAEWQKQLTPEQFKVTRKKGTERAFTGEYANNHEKGIYKCVCCGLDLFSSDAKFDSGTG  67

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++ P+   +V+++ D +  FM R EVLC  C+AHLGHVFDDGP+PTG RYC+NSAAL
Sbjct  68   WPSFWAPLSAESVETRSD-NTFFMKRTEVLCPRCEAHLGHVFDDGPKPTGLRYCLNSAAL  126

Query  667  K  669
            K
Sbjct  127  K  127



>ref|WP_035266138.1| methionine sulfoxide reductase B [Acinetobacter sp. Ver3]
 gb|EZQ10932.1| methionine sulfoxide reductase B [Acinetobacter sp. Ver3]
Length=139

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+ +++ ITRQKGTE AFTG YW+TK  GTY C CC  PLF S TK+DSG G
Sbjct  7    TDREWQRELSPEEYRITRQKGTEPAFTGRYWNTKQEGTYVCRCCGEPLFTSETKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y+P+   V  + D     M R E++C  CDAHLGHVF+DGPEPTG RYC+NSA+L+
Sbjct  67   WPSFYRPINQTVIEEHDDHSHGMIRTEIVCHHCDAHLGHVFEDGPEPTGLRYCVNSASLE  126



>gb|KFA90719.1| hypothetical protein Q664_26760 [Cystobacter violaceus Cb vi76]
Length=168

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EWK++LT +Q+ + R++GTERAFTG+YWD K  GTYHC  C  PLF S TKFDSGTG
Sbjct  46   TDAEWKQQLTPEQYKVLRKQGTERAFTGKYWDLKAAGTYHCAACGQPLFSSETKFDSGTG  105

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+++ +   V S  D S + M R EV+C  C +HLGHVFDDGPEPTG RYC+NS AL
Sbjct  106  WPSFWQALPGAVDSHEDRSWL-MVRTEVVCGRCGSHLGHVFDDGPEPTGLRYCMNSVAL  163



>ref|WP_004980125.1| peptide methionine sulfoxide reductase msrB [Acinetobacter johnsonii]
 gb|ENV73292.1| peptide methionine sulfoxide reductase msrB [Acinetobacter johnsonii 
ANC 3681]
Length=139

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+  +F ITRQKGTE AFTG+YW+TK  GTY C CC TPLF S  K+DSG G
Sbjct  7    TDREWQRELSPDEFRITRQKGTEPAFTGKYWNTKQAGTYVCRCCGTPLFNSENKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+YKP+   V  +   +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L+
Sbjct  67   WPSFYKPLNTTVIEEQQDTTHGMVRTEIVCHHCDAHLGHVFTDGPEPTGLRYCVNSASLE  126



>ref|WP_005097408.1| MULTISPECIES: peptide methionine sulfoxide reductase msrB [Acinetobacter]
 gb|ENW23561.1| peptide methionine sulfoxide reductase msrB [Acinetobacter lwoffii 
NCTC 5866 = CIP 64.10]
 gb|ENW87650.1| peptide methionine sulfoxide reductase msrB [Acinetobacter sp. 
NIPH 713]
Length=139

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+ ++F ITRQKGTE AFTG+YW+TK  G Y C CC  PLF S TKFDSG G
Sbjct  7    TDREWQRELSPEEFRITRQKGTEPAFTGKYWNTKQDGVYVCRCCGEPLFTSETKFDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+Y+P+ ++V  +L  +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L+
Sbjct  67   WPSFYRPLSSSVIEELPDTSHGMVRTEIVCHHCDAHLGHVFPDGPEPTGLRYCVNSASLE  126



>ref|WP_003299543.1| MULTISPECIES: methionine sulfoxide reductase B [Pseudomonas stutzeri 
subgroup]
 gb|AFM33921.1| PilB-like protein [Pseudomonas stutzeri CCUG 29243]
 gb|EME00794.1| PilB-like protein [Pseudomonas stutzeri NF13]
 gb|ESQ97212.1| methionine sulfoxide reductase B [Pseudomonas chloritidismutans 
AW-1]
 gb|ESQ99767.1| methionine sulfoxide reductase B [Pseudomonas chloritidismutans 
AW-1]
 gb|KIZ32868.1| methionine sulfoxide reductase B [Pseudomonas stutzeri]
Length=132

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  322  WKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSY  501
            W++ L+ +QF I R   TER FTG+Y DTKTPG YHC CCDTPLF++  KFDSG GWPSY
Sbjct  11   WREELSDEQFQICRLGATERPFTGKYNDTKTPGIYHCACCDTPLFDADAKFDSGCGWPSY  70

Query  502  YKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            ++PV +   + LD     M R EV CA CDAHLGHVF DGP+PTG RYCINSA+L 
Sbjct  71   FQPVSDTAIASLDDFSHGMHRIEVRCARCDAHLGHVFPDGPQPTGLRYCINSASLN  126



>ref|WP_036260542.1| methionine sulfoxide reductase B [Methylocapsa aurea]
Length=138

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +1

Query  286  SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS  465
            + K+  S S+ EW+ +LT +QF + R+ GTE+AFTG  WD K PG Y CVCC  PLF++ 
Sbjct  5    AAKEKISKSEAEWRSQLTPEQFEVARKHGTEQAFTGPNWDQKKPGLYSCVCCGEPLFDAK  64

Query  466  TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY  645
            TKFDSGTGWPS+Y PV  +     + +  FM R EV CA C+AHLGHVF DGP+PTG RY
Sbjct  65   TKFDSGTGWPSFYGPVAEDAVEAHEDNSHFMRRTEVRCARCEAHLGHVFPDGPKPTGLRY  124

Query  646  CINSAALK  669
            C+N  ALK
Sbjct  125  CMNGCALK  132



>ref|WP_014750326.1| methionine sulfoxide reductase B [Advenella kashmirensis]
 gb|AFK62235.1| methionine sulfoxide reductase B [Advenella kashmirensis WT001]
Length=130

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S+++W++ L+ + +++TRQKGTERAFTGEYWD   PG Y CV C TPLF S TKFD+G G
Sbjct  6    SEQQWRELLSPESYHVTRQKGTERAFTGEYWDHFQPGIYTCVACGTPLFASDTKFDAGCG  65

Query  490  WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P+  +NV+ ++D S   M R EVLC  CDAHLGHVF DGP PTG RYCINS +L
Sbjct  66   WPSYFEPLNPHNVREEVDTS-HGMTRTEVLCNVCDAHLGHVFPDGPPPTGLRYCINSLSL  124

Query  667  K  669
            +
Sbjct  125  R  125



>ref|WP_009452151.1| methionine sulfoxide reductase B [Nitratireductor indicus]
 gb|EKF40606.1| methionine-R-sulfoxide reductase [Nitratireductor indicus C115]
Length=135

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S EEW+  LT +Q+ +TR+ GTERAFTG YWD K  G Y CVCC  PLF S TK+DSGTG
Sbjct  12   SKEEWRSELTPEQYRVTREHGTERAFTGPYWDNKEDGLYRCVCCGRPLFSSETKYDSGTG  71

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+Y PV  +  S+      FM R E+ C  CDAHLGHVF+DGP PTG RYC+N  AL
Sbjct  72   WPSFYAPVDKDAVSEHKDRSWFMTRTEIRCTDCDAHLGHVFEDGPAPTGLRYCMNGTAL  130



>ref|WP_009285242.1| methionine sulfoxide reductase B [Fibrisoma limi]
 emb|CCH56677.1| methionine-R-sulfoxide reductase [Fibrisoma limi BUZ 3]
Length=135

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            SDEEW++ LT +Q+ + R KGTER F+GEY + K PG Y CVCCDT LFES+TKFDSGTG
Sbjct  8    SDEEWRRMLTPEQYRVARGKGTERPFSGEYCEAKDPGIYACVCCDTELFESTTKFDSGTG  67

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS+  P+    ++ + D S   M R EVLC  CDAHLGHVFDDGP PTG RYC+NS +L
Sbjct  68   WPSFTAPIEEERIRLEKDFS-YGMIRIEVLCNVCDAHLGHVFDDGPPPTGMRYCLNSVSL  126



>ref|WP_017642580.1| methionine sulfoxide reductase B [Pseudomonas sp. 313]
Length=133

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 87/121 (72%), Gaps = 2/121 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S E+W++RLT  QF + R   TER +TG Y +TKTPG YHC CC+  LF+SSTKFDSG G
Sbjct  7    SPEDWRERLTDDQFRVCRLAATERPYTGAYCNTKTPGVYHCACCELALFDSSTKFDSGCG  66

Query  490  WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSYY P+    V+ K D S   M R EVLCA CDAHLGHVF DGP PTG RYCINS AL
Sbjct  67   WPSYYAPINAEAVREKEDFS-HGMQRVEVLCARCDAHLGHVFPDGPPPTGLRYCINSVAL  125

Query  667  K  669
            +
Sbjct  126  Q  126



>ref|WP_005399615.1| MULTISPECIES: methionine sulfoxide reductase B [Acinetobacter]
 gb|EEY97177.1| methionine-R-sulfoxide reductase [Acinetobacter johnsonii SH046]
Length=139

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            +D EW++ L+  +F ITRQKGTE AFTG+YW+TK  GTY C CC TPLF S  K+DSG G
Sbjct  7    TDREWQRELSPDEFRITRQKGTEPAFTGKYWNTKQAGTYVCRCCGTPLFNSENKYDSGCG  66

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK  669
            WPS+YKP+   V  +   +   M R E++C  CDAHLGHVF DGPEPTG RYC+NSA+L+
Sbjct  67   WPSFYKPLNTTVIEEHQDTTHGMVRTEIVCHHCDAHLGHVFTDGPEPTGLRYCVNSASLE  126



>ref|WP_011365194.1| methionine sulfoxide reductase B [Synechococcus sp. CC9605]
 gb|ABB35994.1| Methionine sulfoxide reductase B [Synechococcus sp. CC9605]
Length=133

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S EEWK+ LT +QF + R  GTERAFTG YW+ K  G YHCVCC  PLF S TKFDSGTG
Sbjct  10   SAEEWKQSLTPEQFQVARCGGTERAFTGAYWNNKATGMYHCVCCGAPLFSSKTKFDSGTG  69

Query  490  WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPS++  V +  + +K DL+   M R E+ CA CDAHLGHVF DGP PTG+RYC+NSA+L
Sbjct  70   WPSFWDGVSSEAITTKADLT-HGMVRTEINCAQCDAHLGHVFPDGPAPTGQRYCVNSASL  128



>ref|WP_041399314.1| hypothetical protein, partial [Planctomyces brasiliensis]
Length=313

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  310  SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG  489
            S++EW+  LT +Q+++TR+ GTERAFTG+YWD K+PG Y CVCCD  LF S TKFDSG G
Sbjct  193  SEDEWRAMLTPEQYHVTREAGTERAFTGKYWDEKSPGEYRCVCCDALLFTSDTKFDSGCG  252

Query  490  WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL  666
            WPSY++P  N   +  + +  FM R EV C  C AHLGHVF+DGP+PTG RYCINSA+L
Sbjct  253  WPSYFEPAQNGNITYHEDNSHFMTRTEVRCKKCGAHLGHVFNDGPQPTGMRYCINSASL  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780