BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028H01

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU37791.1|  hypothetical protein MIMGU_mgv1a008244mg                306   1e-99   Erythranthe guttata [common monkey flower]
gb|AAG12330.1|AF249743_1  heterotrimeric GTP-binding protein subu...    304   7e-99   Nicotiana tabacum [American tobacco]
sp|P93397.1|GBB1_TOBAC  RecName: Full=Guanine nucleotide-binding ...    304   8e-99   Nicotiana tabacum [American tobacco]
ref|XP_009800901.1|  PREDICTED: guanine nucleotide-binding protei...    304   9e-99   Nicotiana sylvestris
gb|AIL52187.1|  heterotrimeric G-protein beta subunit                   303   1e-98   Capsicum annuum
gb|ACR77529.1|  heterotrimeric G protein beta 2 subunit                 303   2e-98   Nicotiana benthamiana
ref|XP_010254875.1|  PREDICTED: guanine nucleotide-binding protei...    303   2e-98   Nelumbo nucifera [Indian lotus]
emb|CDO97059.1|  unnamed protein product                                302   3e-98   Coffea canephora [robusta coffee]
gb|AJE63427.1|  heterotrimeric G protein beta 2 subunit                 302   5e-98   Capsicum annuum
ref|XP_010263695.1|  PREDICTED: guanine nucleotide-binding protei...    300   6e-98   Nelumbo nucifera [Indian lotus]
gb|KJB32495.1|  hypothetical protein B456_005G243000                    301   6e-98   Gossypium raimondii
gb|KHG11481.1|  Guanine nucleotide-binding subunit beta-2               301   6e-98   Gossypium arboreum [tree cotton]
sp|P93339.1|GBB_NICPL  RecName: Full=Guanine nucleotide-binding p...    301   7e-98   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003631647.1|  PREDICTED: guanine nucleotide-binding protei...    301   8e-98   Vitis vinifera
ref|XP_009605958.1|  PREDICTED: guanine nucleotide-binding protei...    301   9e-98   Nicotiana tomentosiformis
ref|XP_011048621.1|  PREDICTED: guanine nucleotide-binding protei...    301   1e-97   Populus euphratica
gb|AFK40354.1|  unknown                                                 294   1e-97   Medicago truncatula
ref|XP_002313052.1|  ERECTA-LIKE 4 family protein                       301   1e-97   Populus trichocarpa [western balsam poplar]
ref|XP_011048613.1|  PREDICTED: guanine nucleotide-binding protei...    301   1e-97   Populus euphratica
ref|XP_011037538.1|  PREDICTED: guanine nucleotide-binding protei...    300   2e-97   Populus euphratica
sp|Q40507.1|GBB3_TOBAC  RecName: Full=Guanine nucleotide-binding ...    300   2e-97   Nicotiana tabacum [American tobacco]
ref|XP_010263694.1|  PREDICTED: guanine nucleotide-binding protei...    300   2e-97   Nelumbo nucifera [Indian lotus]
ref|XP_002509478.1|  guanine nucleotide-binding protein beta, put...    300   4e-97   Ricinus communis
ref|XP_002306098.1|  ERECTA-LIKE 4 family protein                       299   9e-97   Populus trichocarpa [western balsam poplar]
ref|XP_004299095.1|  PREDICTED: guanine nucleotide-binding protei...    298   9e-97   Fragaria vesca subsp. vesca
ref|NP_001240891.1|  uncharacterized protein LOC100811645               298   1e-96   Glycine max [soybeans]
gb|AAD49742.1|AF170921_1  G protein beta subunit                        298   1e-96   Pisum sativum [garden pea]
ref|XP_004230907.1|  PREDICTED: guanine nucleotide-binding protei...    298   1e-96   Solanum lycopersicum
ref|NP_001274886.1|  guanine nucleotide-binding protein subunit beta    298   2e-96   Solanum tuberosum [potatoes]
ref|XP_007201063.1|  hypothetical protein PRUPE_ppa007241mg             298   2e-96   Prunus persica
ref|XP_008236879.1|  PREDICTED: guanine nucleotide-binding protei...    298   2e-96   Prunus mume [ume]
gb|KHN20072.1|  Guanine nucleotide-binding protein subunit beta-2       297   3e-96   Glycine soja [wild soybean]
ref|XP_008375922.1|  PREDICTED: guanine nucleotide-binding protei...    297   3e-96   Malus domestica [apple tree]
ref|XP_003527220.1|  PREDICTED: guanine nucleotide-binding protei...    297   3e-96   Glycine max [soybeans]
ref|XP_003603911.1|  Guanine nucleotide-binding protein subunit b...    297   5e-96   Medicago truncatula
ref|XP_010107843.1|  Guanine nucleotide-binding protein subunit b...    297   5e-96   Morus notabilis
ref|XP_009374178.1|  PREDICTED: guanine nucleotide-binding protei...    297   5e-96   
ref|XP_011088384.1|  PREDICTED: guanine nucleotide-binding protei...    296   6e-96   Sesamum indicum [beniseed]
sp|P93563.1|GBB_SOLTU  RecName: Full=Guanine nucleotide-binding p...    296   8e-96   Solanum tuberosum [potatoes]
gb|KDP46245.1|  hypothetical protein JCGZ_10085                         296   1e-95   Jatropha curcas
ref|XP_009609408.1|  PREDICTED: guanine nucleotide-binding protei...    296   1e-95   Nicotiana tomentosiformis
ref|XP_004500814.1|  PREDICTED: guanine nucleotide-binding protei...    295   1e-95   Cicer arietinum [garbanzo]
gb|KCW55344.1|  hypothetical protein EUGRSUZ_I01264                     293   2e-95   Eucalyptus grandis [rose gum]
ref|XP_009779361.1|  PREDICTED: guanine nucleotide-binding protei...    295   3e-95   Nicotiana sylvestris
gb|AAD33959.1|AF145976_1  G protein beta subunit                        295   3e-95   Pisum sativum [garden pea]
gb|AEQ61903.1|  GTP-binding protein beta subunit                        294   4e-95   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010690896.1|  PREDICTED: guanine nucleotide-binding protei...    295   5e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010254874.1|  PREDICTED: guanine nucleotide-binding protei...    294   9e-95   Nelumbo nucifera [Indian lotus]
ref|XP_007042211.1|  GTP binding protein beta 1 isoform 1               293   1e-94   
ref|XP_010028582.1|  PREDICTED: guanine nucleotide-binding protei...    293   1e-94   Eucalyptus grandis [rose gum]
gb|AAM97354.1|  G protein beta subunit                                  293   2e-94   Pisum sativum [garden pea]
ref|XP_009345730.1|  PREDICTED: guanine nucleotide-binding protei...    291   5e-94   Pyrus x bretschneideri [bai li]
ref|XP_006423250.1|  hypothetical protein CICLE_v10028655mg             291   1e-93   Citrus clementina [clementine]
gb|KDO49094.1|  hypothetical protein CISIN_1g016458mg                   291   1e-93   Citrus sinensis [apfelsine]
ref|XP_006856030.1|  hypothetical protein AMTR_s00059p00065870          290   1e-93   Amborella trichopoda
ref|XP_011092783.1|  PREDICTED: guanine nucleotide-binding protei...    290   1e-93   Sesamum indicum [beniseed]
gb|KDO49093.1|  hypothetical protein CISIN_1g016458mg                   291   2e-93   Citrus sinensis [apfelsine]
gb|KDO49095.1|  hypothetical protein CISIN_1g016458mg                   291   2e-93   Citrus sinensis [apfelsine]
ref|XP_010530843.1|  PREDICTED: guanine nucleotide-binding protei...    289   4e-93   Tarenaya hassleriana [spider flower]
ref|XP_003541055.1|  PREDICTED: guanine nucleotide-binding protei...    288   1e-92   Glycine max [soybeans]
ref|XP_003537878.1|  PREDICTED: guanine nucleotide-binding protei...    288   2e-92   Glycine max [soybeans]
gb|AFK33707.1|  unknown                                                 285   3e-91   Lotus japonicus
gb|AGZ15391.1|  G protein beta subunit                                  283   7e-91   Phaseolus vulgaris [French bean]
ref|XP_007131843.1|  hypothetical protein PHAVU_011G045900g             283   7e-91   Phaseolus vulgaris [French bean]
ref|XP_008447036.1|  PREDICTED: guanine nucleotide-binding protei...    283   1e-90   Cucumis melo [Oriental melon]
ref|XP_004160234.1|  PREDICTED: guanine nucleotide-binding protei...    279   1e-89   
ref|XP_010432411.1|  PREDICTED: guanine nucleotide-binding protei...    280   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010526922.1|  PREDICTED: guanine nucleotide-binding protei...    276   4e-89   Tarenaya hassleriana [spider flower]
ref|XP_004150413.1|  PREDICTED: guanine nucleotide-binding protei...    279   4e-89   Cucumis sativus [cucumbers]
gb|KHG07839.1|  Guanine nucleotide-binding subunit beta-2               278   8e-89   Gossypium arboreum [tree cotton]
gb|KJB79197.1|  hypothetical protein B456_013G037500                    276   1e-88   Gossypium raimondii
ref|XP_010437612.1|  PREDICTED: guanine nucleotide-binding protei...    277   2e-88   Camelina sativa [gold-of-pleasure]
gb|AIS73131.1|  heterotrimeric G protein beta subunit 2                 277   2e-88   Brassica nigra
ref|NP_974683.1|  guanine nucleotide-binding protein subunit beta       276   3e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79195.1|  hypothetical protein B456_013G037500                    276   4e-88   Gossypium raimondii
ref|XP_006412223.1|  hypothetical protein EUTSA_v10025475mg             276   4e-88   Eutrema salsugineum [saltwater cress]
dbj|BAJ34135.1|  unnamed protein product                                276   4e-88   Eutrema halophilum
gb|ACX43274.1|  GTP binding protein beta subunit                        276   4e-88   Brassica napus [oilseed rape]
gb|KFK30072.1|  hypothetical protein AALP_AA7G213100                    276   4e-88   Arabis alpina [alpine rockcress]
ref|XP_002867119.1|  hypothetical protein ARALYDRAFT_491213             276   4e-88   
gb|AAV85721.1|  At4g34460                                               276   6e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195172.1|  guanine nucleotide-binding protein subunit beta       276   6e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69061.1|  BnaC01g03920D                                          276   6e-88   
ref|XP_009138296.1|  PREDICTED: guanine nucleotide-binding protei...    275   2e-87   Brassica rapa
gb|AIO11831.1|  heterotrimeric G-protein beta subunit 1                 275   2e-87   Brassica rapa
ref|XP_006283934.1|  hypothetical protein CARUB_v10005053mg             275   2e-87   Capsella rubella
ref|XP_008783473.1|  PREDICTED: guanine nucleotide-binding protei...    275   3e-87   Phoenix dactylifera
gb|AIS73132.1|  heterotrimeric G protein beta subunit 3                 274   3e-87   Brassica nigra
gb|AIO11833.1|  heterotrimeric G-protein beta subunit 3                 274   3e-87   Brassica rapa
ref|XP_009112299.1|  PREDICTED: guanine nucleotide-binding protei...    274   3e-87   Brassica rapa
emb|CDX75436.1|  BnaA01g02660D                                          274   3e-87   
ref|XP_010942027.1|  PREDICTED: guanine nucleotide-binding protei...    273   5e-87   
gb|AIS73130.1|  heterotrimeric G protein beta subunit 1                 273   7e-87   Brassica nigra
ref|XP_010942026.1|  PREDICTED: guanine nucleotide-binding protei...    273   9e-87   Elaeis guineensis
ref|XP_010942025.1|  PREDICTED: guanine nucleotide-binding protei...    273   1e-86   Elaeis guineensis
ref|XP_009406753.1|  PREDICTED: guanine nucleotide-binding protei...    272   2e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17717.1|  unknown                                                 271   4e-86   Picea sitchensis
ref|XP_009108730.1|  PREDICTED: guanine nucleotide-binding protei...    270   2e-85   Brassica rapa
ref|XP_009416786.1|  PREDICTED: guanine nucleotide-binding protei...    270   2e-85   
ref|XP_004982216.1|  PREDICTED: guanine nucleotide-binding protei...    270   2e-85   Setaria italica
ref|XP_004982214.1|  PREDICTED: guanine nucleotide-binding protei...    271   3e-85   
gb|AHJ60245.1|  heterotrimeric G-protein beta subunit                   269   3e-85   Picea abies
emb|CDX72483.1|  BnaC07g45050D                                          281   3e-85   
ref|XP_004982215.1|  PREDICTED: guanine nucleotide-binding protei...    270   4e-85   
gb|EEC75892.1|  hypothetical protein OsI_12941                          268   9e-85   Oryza sativa Indica Group [Indian rice]
sp|Q40687.1|GBB_ORYSJ  RecName: Full=Guanine nucleotide-binding p...    268   9e-85   Oryza sativa Japonica Group [Japonica rice]
gb|AEE69019.1|  heterotrimeric G protein beta subunit                   268   9e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466691.1|  hypothetical protein SORBIDRAFT_01g012370          268   1e-84   Sorghum bicolor [broomcorn]
ref|XP_010935069.1|  PREDICTED: guanine nucleotide-binding protei...    267   2e-84   Elaeis guineensis
gb|ACF86117.1|  unknown                                                 267   3e-84   Zea mays [maize]
ref|NP_001105365.1|  guanine nucleotide-binding protein subunit beta    267   3e-84   Zea mays [maize]
gb|AIO11832.1|  heterotrimeric G-protein beta subunit 2                 266   3e-84   Brassica rapa
ref|XP_009381288.1|  PREDICTED: guanine nucleotide-binding protei...    266   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001078491.1|  guanine nucleotide-binding protein subunit beta    266   4e-84   Arabidopsis thaliana [mouse-ear cress]
gb|ADL27745.1|  G protein beta subunit                                  265   2e-83   Oryza sativa Indica Group [Indian rice]
emb|CDY45313.1|  BnaA03g52860D                                          276   3e-83   Brassica napus [oilseed rape]
ref|XP_009416784.1|  PREDICTED: guanine nucleotide-binding protei...    263   1e-82   
gb|EMT27863.1|  hypothetical protein F775_27280                         262   1e-82   
pdb|3J60|GG  Chain g, Localization Of The Small Subunit Ribosomal...    258   9e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003561442.1|  PREDICTED: guanine nucleotide-binding protei...    257   1e-80   Brachypodium distachyon [annual false brome]
ref|XP_010526923.1|  PREDICTED: guanine nucleotide-binding protei...    243   1e-76   Tarenaya hassleriana [spider flower]
gb|EEE63415.1|  hypothetical protein OsJ_18227                          245   2e-76   Oryza sativa Japonica Group [Japonica rice]
gb|AAC39373.1|  G protein beta subunit                                  246   3e-76   Avena fatua
emb|CAN73515.1|  hypothetical protein VITISV_027042                     246   3e-76   Vitis vinifera
ref|XP_010935070.1|  PREDICTED: guanine nucleotide-binding protei...    246   4e-76   
ref|XP_010935068.1|  PREDICTED: guanine nucleotide-binding protei...    245   7e-76   
ref|XP_010935067.1|  PREDICTED: guanine nucleotide-binding protei...    245   2e-75   Elaeis guineensis
gb|EMS45783.1|  Guanine nucleotide-binding protein subunit beta         236   1e-67   Triticum urartu
ref|XP_009779362.1|  PREDICTED: guanine nucleotide-binding protei...    201   4e-59   Nicotiana sylvestris
ref|NP_849494.2|  guanine nucleotide-binding protein subunit beta       198   1e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76284.1|  BnaA08g11160D                                          189   8e-55   
emb|CDY46247.1|  BnaC03g66080D                                          189   1e-54   Brassica napus [oilseed rape]
ref|XP_001753169.1|  GPB1 heterotrimeric G protein beta subunit p...    183   6e-52   
ref|XP_002967710.1|  hypothetical protein SELMODRAFT_440157             175   5e-49   Selaginella moellendorffii
ref|XP_002964323.1|  hypothetical protein SELMODRAFT_142121             172   1e-47   Selaginella moellendorffii
ref|XP_001757493.1|  GPB2 heterotrimeric G protein beta subunit p...    152   2e-41   
gb|KEZ45296.1|  hypothetical protein SAPIO_CDS2093                      142   2e-36   Scedosporium apiospermum
gb|KDE07792.1|  guanine nucleotide-binding protein subunit beta         140   6e-36   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|EZF44104.1|  guanine nucleotide-binding protein subunit beta         138   6e-36   Trichophyton rubrum CBS 100081
ref|XP_003017524.1|  hypothetical protein ARB_04406                     137   8e-36   Trichophyton benhamiae CBS 112371
gb|EZF68383.1|  guanine nucleotide-binding protein subunit beta         138   8e-36   Trichophyton soudanense CBS 452.61
gb|EZF25118.1|  guanine nucleotide-binding protein subunit beta         138   8e-36   Trichophyton rubrum MR850
gb|EZF79069.1|  guanine nucleotide-binding protein subunit beta         138   8e-36   Trichophyton rubrum MR1448
gb|EZF28331.1|  guanine nucleotide-binding protein subunit beta         138   9e-36   Trichophyton interdigitale H6
gb|EZG11290.1|  guanine nucleotide-binding protein subunit beta         138   9e-36   Trichophyton rubrum CBS 202.88
ref|XP_007807978.1|  G protein beta subunit                             138   1e-35   Metarhizium acridum CQMa 102
gb|EJU00042.1|  guanine nucleotide binding protein beta subunit 2       139   1e-35   Dacryopinax primogenitus
gb|EFX00034.1|  guanine nucleotide-binding protein beta subunit         139   1e-35   Grosmannia clavigera kw1407
gb|KFG82472.1|  G protein beta subunit                                  138   2e-35   Metarhizium anisopliae
ref|XP_006693118.1|  G protein beta subunit-like protein                139   2e-35   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KEF53104.1|  guanine nucleotide-binding protein subunit beta         137   3e-35   Exophiala aquamarina CBS 119918
ref|XP_007595151.1|  guanine nucleotide-binding protein subunit beta    139   3e-35   
emb|CCX14452.1|  Similar to Guanine nucleotide-binding protein su...    138   3e-35   Pyronema omphalodes CBS 100304
ref|XP_003655108.1|  hypothetical protein THITE_2118396                 138   3e-35   Thielavia terrestris NRRL 8126
ref|XP_003663156.1|  hypothetical protein MYCTH_2304670                 138   3e-35   Thermothelomyces thermophila ATCC 42464
gb|ENH75085.1|  Guanine nucleotide-binding protein subunit beta         138   4e-35   Fusarium oxysporum f. sp. cubense race 1
ref|XP_004349142.1|  guanine nucleotide-binding protein beta subunit    138   4e-35   Capsaspora owczarzaki ATCC 30864
gb|EMT65914.1|  Guanine nucleotide-binding protein subunit beta         138   4e-35   Fusarium oxysporum f. sp. cubense race 4
dbj|BAB69489.1|  guanine nucleotide-binding protein beta subunit        138   4e-35   Fusarium oxysporum
ref|XP_008597057.1|  heterotrimeric G protein beta subunit              138   4e-35   Beauveria bassiana ARSEF 2860
gb|AFJ79447.1|  G protein beta subunit                                  138   4e-35   Verticillium dahliae
gb|ELQ39060.1|  guanine nucleotide-binding protein subunit beta         138   5e-35   Magnaporthe oryzae Y34
emb|CCA67815.1|  related to G-protein beta subunit Bpp1                 138   5e-35   Serendipita indica DSM 11827
dbj|BAC01165.1|  heterotrimeric G-protein beta subunit                  138   5e-35   Magnaporthe grisea
ref|XP_001542437.1|  guanine nucleotide-binding protein beta subunit    136   5e-35   Histoplasma capsulatum NAm1
gb|AAL90861.1|AF484341_1  G-protein beta subunit                        138   5e-35   Sporothrix schenckii
ref|XP_009166447.1|  hypothetical protein T265_13295                    133   5e-35   Opisthorchis viverrini [Southeast Asian liver fluke]
gb|KIE01589.1|  G protein beta subunit                                  138   5e-35   Metarhizium majus ARSEF 297
ref|XP_009251519.1|  hypothetical protein FPSE_00124                    138   5e-35   Fusarium pseudograminearum CS3096
ref|XP_003044802.1|  predicted protein                                  138   6e-35   [Nectria] haematococca mpVI 77-13-4
ref|XP_007818659.2|  G protein beta subunit                             137   6e-35   Metarhizium robertsii ARSEF 23
gb|KHO01188.1|  G protein beta subunit                                  137   6e-35   Metarhizium album ARSEF 1941
gb|KIL86703.1|  hypothetical protein FAVG1_09959                        138   6e-35   Fusarium avenaceum
gb|KHJ34880.1|  putative guanine nucleotide-binding protein beta ...    137   6e-35   Erysiphe necator
gb|KFH43953.1|  Guanine nucleotide-binding protein subunit beta-l...    137   6e-35   Acremonium chrysogenum ATCC 11550
ref|XP_002795766.1|  guanine nucleotide-binding protein subunit beta    137   6e-35   
emb|CAQ86900.1|  G protein beta subunit                                 137   6e-35   Acremonium chrysogenum
ref|XP_003712746.1|  guanine nucleotide-binding protein subunit beta    137   6e-35   Magnaporthe oryzae 70-15
ref|XP_009656945.1|  guanine nucleotide-binding protein subunit beta    137   7e-35   Verticillium dahliae VdLs.17
gb|EPE07329.1|  heterotrimeric g-protein beta subunit                   137   7e-35   Ophiostoma piceae UAMH 11346
ref|XP_007797937.1|  putative guanine nucleotide-binding protein ...    137   7e-35   
ref|XP_009217034.1|  guanine nucleotide-binding protein subunit beta    137   7e-35   Gaeumannomyces tritici R3-111a-1
gb|EWY85348.1|  guanine nucleotide-binding protein subunit beta         136   7e-35   Fusarium oxysporum FOSC 3-a
ref|XP_007832652.1|  Guanine nucleotide-binding protein subunit beta    137   7e-35   Pestalotiopsis fici W106-1
ref|XP_007786191.1|  Guanine nucleotide-binding protein subunit beta    137   7e-35   Endocarpon pusillum Z07020
gb|ADE20134.1|  heterotrimeric G-protein beta subunit                   137   7e-35   Colletotrichum hanaui
gb|EQK99388.1|  G protein beta subunit                                  137   8e-35   Ophiocordyceps sinensis CO18
sp|O14435.1|GBB_CRYPA  RecName: Full=Guanine nucleotide-binding p...    137   8e-35   Cryphonectria parasitica
gb|KIM28934.1|  hypothetical protein M408DRAFT_328991                   137   8e-35   Serendipita vermifera MAFF 305830
ref|XP_007918102.1|  putative guanine nucleotide-binding protein ...    137   8e-35   Phaeoacremonium minimum UCRPA7
ref|XP_003002364.1|  guanine nucleotide-binding protein subunit beta    137   8e-35   Verticillium alfalfae VaMs.102
gb|KIY03752.1|  guanine nucleotide-binding protein subunit beta         137   8e-35   Fonsecaea multimorphosa CBS 102226
ref|XP_003021074.1|  hypothetical protein TRV_04826                     137   8e-35   Trichophyton verrucosum HKI 0517
ref|XP_011117389.1|  hypothetical protein AOL_s00004g438                137   8e-35   Arthrobotrys oligospora ATCC 24927
gb|KDB20108.1|  guanine nucleotide-binding protein subunit beta         137   9e-35   Trichophyton interdigitale MR816
gb|EHL03873.1|  putative Guanine nucleotide-binding protein subun...    137   9e-35   Glarea lozoyensis 74030
ref|XP_010760821.1|  guanine nucleotide-binding protein subunit beta    137   9e-35   Paracoccidioides brasiliensis Pb18
gb|EEH40417.2|  guanine nucleotide-binding protein subunit beta         137   1e-34   Paracoccidioides lutzii Pb01
emb|CCE27519.1|  probable guanine nucleotide-binding protein beta...    137   1e-34   Claviceps purpurea 20.1
gb|AAZ42332.1|  G protein beta subunit                                  132   1e-34   Caenorhabditis remanei
ref|XP_001229630.1|  guanine nucleotide-binding protein beta subunit    137   1e-34   Chaetomium globosum CBS 148.51
gb|EEQ90059.1|  small G-beta protein GPB                                137   1e-34   
gb|KIX08259.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Rhinocladiella mackenziei CBS 650.93
gb|ADN95999.1|  GTP binding protein beta subunit                        137   1e-34   Ustilaginoidea virens
ref|XP_002621970.1|  small G-beta protein GPB                           137   1e-34   Blastomyces gilchristii SLH14081
ref|XP_007740645.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Cladophialophora psammophila CBS 110553
ref|XP_006963580.1|  heterotrimeric G protein, beta subunit             137   1e-34   Trichoderma reesei QM6a
ref|XP_007721690.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Capronia coronata CBS 617.96
gb|KIW85998.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Fonsecaea pedrosoi CBS 271.37
gb|KIV87521.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Exophiala sideris
ref|XP_007760803.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Cladophialophora yegresii CBS 114405
gb|EHK46560.1|  heterotrimeric G protein beta subunit                   137   1e-34   Trichoderma atroviride IMI 206040
gb|AAO37685.1|  heterotrimeric G protein beta subunit TGB1              137   1e-34   Trichoderma atroviride
gb|KIW33780.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Cladophialophora immunda
dbj|BAJ94652.1|  predicted protein                                      137   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIV92928.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Exophiala mesophila
ref|XP_007733470.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Capronia epimyces CBS 606.96
gb|ADB12512.1|  GTP binding protein beta subunit                        137   1e-34   Ustilaginoidea virens
gb|AAT40565.1|  small G-beta protein GPB                                137   1e-34   Paracoccidioides brasiliensis
ref|XP_008730131.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Cladophialophora carrionii CBS 160.54
ref|XP_008712871.1|  guanine nucleotide-binding protein subunit beta    137   1e-34   Cyphellophora europaea CBS 101466
ref|XP_001239616.1|  guanine nucleotide-binding protein beta subunit    136   1e-34   Coccidioides immitis RS
gb|KIW11996.1|  guanine nucleotide-binding protein subunit beta         137   1e-34   Exophiala spinifera
ref|XP_008946720.1|  PREDICTED: guanine nucleotide-binding protei...    132   1e-34   Merops nubicus
ref|XP_001908013.1|  hypothetical protein                               137   1e-34   Podospora anserina S mat+
ref|XP_003067194.1|  Guanine nucleotide-binding protein beta subu...    137   1e-34   Coccidioides posadasii C735 delta SOWgp
ref|XP_011107440.1|  hypothetical protein H072_1448                     136   1e-34   
gb|KIW60360.1|  guanine nucleotide-binding protein subunit beta         136   1e-34   Exophiala xenobiotica
gb|EQL27839.1|  guanine nucleotide-binding protein subunit beta         136   1e-34   Blastomyces dermatitidis ATCC 26199
ref|XP_008084030.1|  WD40 repeat-like protein                           137   1e-34   Glarea lozoyensis ATCC 20868
gb|EER38890.1|  small G-beta protein GPB                                135   1e-34   Histoplasma capsulatum H143
gb|KIW64254.1|  guanine nucleotide-binding protein subunit beta         136   1e-34   Phialophora americana
gb|KIW40198.1|  guanine nucleotide-binding protein subunit beta         136   1e-34   Exophiala oligosperma
ref|XP_002584356.1|  guanine nucleotide-binding protein beta subunit    137   1e-34   Uncinocarpus reesii 1704
ref|XP_001398668.1|  guanine nucleotide-binding protein subunit beta    136   2e-34   Aspergillus niger CBS 513.88
gb|EWC48535.1|  guanine nucleotide-binding protein subunit beta         136   2e-34   Drechslerella stenobrocha 248
ref|XP_003146986.1|  hypothetical protein LOAG_11417                    132   2e-34   
gb|EEH10050.1|  small G-beta protein GPB                                136   2e-34   Histoplasma capsulatum G186AR
ref|XP_007280702.1|  guanine nucleotide-binding protein beta subunit    136   2e-34   
emb|CCU75200.1|  G-protein beta subunit                                 136   2e-34   Blumeria graminis f. sp. hordei DH14
gb|KIW98040.1|  guanine nucleotide-binding protein subunit beta         137   2e-34   Cladophialophora bantiana CBS 173.52
gb|KEY64274.1|  hypothetical protein S7711_09313                        136   2e-34   Stachybotrys chartarum IBT 7711
gb|EPQ65165.1|  G protein beta subunit                                  136   2e-34   Blumeria graminis f. sp. tritici 96224
ref|XP_001595393.1|  guanine nucleotide-binding protein beta subunit    136   2e-34   Sclerotinia sclerotiorum 1980 UF-70
dbj|BAD93278.1|  G protein beta subunit                                 136   2e-34   Botrytis cinerea
gb|ESZ96322.1|  guanine nucleotide-binding protein beta subunit         136   2e-34   Sclerotinia borealis F-4128
gb|KDB16485.1|  G protein beta subunit                                  137   2e-34   Ustilaginoidea virens
gb|KIK07337.1|  hypothetical protein K443DRAFT_673598                   136   2e-34   Laccaria amethystina LaAM-08-1
gb|KDN68001.1|  putative guanine nucleotide-binding protein subun...    136   2e-34   Colletotrichum sublineola
ref|XP_001824062.1|  guanine nucleotide-binding protein subunit beta    136   3e-34   Aspergillus oryzae RIB40
gb|KIN04965.1|  hypothetical protein OIDMADRAFT_50796                   136   3e-34   Oidiodendron maius Zn
gb|AGH70128.1|  guanine nucleotide-binding protein beta 1               132   3e-34   Placozoa sp. H4
ref|XP_001259476.1|  G protein complex beta subunit SfaD                136   4e-34   Aspergillus fischeri NRRL 181
gb|EFQ25289.1|  WD domain-containing protein                            135   4e-34   Colletotrichum graminicola M1.001
ref|XP_001936327.1|  guanine nucleotide-binding protein subunit beta    135   5e-34   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_956704.2|  guanine nucleotide-binding protein beta subunit       135   5e-34   Neurospora crassa OR74A
gb|EYE94068.1|  guanine nucleotide-binding protein beta subunit         135   5e-34   Aspergillus ruber CBS 135680
emb|CEJ92086.1|  Putative Guanine nucleotide-binding protein subu...    135   5e-34   Torrubiella hemipterigena
ref|XP_003132597.2|  PREDICTED: guanine nucleotide-binding protei...    132   5e-34   
ref|XP_007785045.1|  guanine nucleotide-binding protein subunit beta    135   6e-34   Coniosporium apollinis CBS 100218
ref|XP_003348853.1|  hypothetical protein SMAC_01876                    135   6e-34   Sordaria macrospora k-hell
ref|XP_006957610.1|  guanine nucleotide binding protein beta subu...    135   6e-34   Wallemia mellicola CBS 633.66
gb|EPS32499.1|  putative G protein complex beta subunit                 135   6e-34   Penicillium oxalicum 114-2
ref|XP_007587344.1|  putative g protein complex beta subunit protein    134   6e-34   
ref|XP_001274512.1|  G protein complex beta subunit SfaD                136   6e-34   Aspergillus clavatus NRRL 1
ref|XP_003840142.1|  similar to guanine nucleotide-binding protei...    135   7e-34   Leptosphaeria maculans JN3
ref|XP_007688724.1|  hypothetical protein COCMIDRAFT_27000              135   7e-34   Bipolaris oryzae ATCC 44560
ref|XP_002567778.1|  Pc21g07370                                         135   7e-34   Penicillium rubens Wisconsin 54-1255
gb|AFK93096.1|  G-protein beta subunit Clgb1                            135   7e-34   Curvularia lunata
ref|XP_001806174.1|  hypothetical protein SNOG_16044                    134   7e-34   Parastagonospora nodorum SN15
ref|XP_007674737.1|  hypothetical protein BAUCODRAFT_404084             134   7e-34   Baudoinia panamericana UAMH 10762
ref|XP_007923553.1|  g-protein beta subunit-like protein                134   7e-34   Pseudocercospora fijiensis CIRAD86
ref|XP_007289004.1|  guanine nucleotide-binding protein beta subunit    135   7e-34   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KGO44879.1|  G-protein, beta subunit                                 134   8e-34   Penicillium expansum
ref|XP_003304755.1|  hypothetical protein PTT_17426                     134   8e-34   
gb|EMF15237.1|  G-protein beta subunit                                  134   8e-34   Sphaerulina musiva SO2202
gb|EME48011.1|  G protein beta like subunit                             134   8e-34   Dothistroma septosporum NZE10
gb|ABE72964.1|  G-protein beta subunit                                  134   8e-34   Zymoseptoria tritici
gb|EKG16879.1|  G-protein beta subunit                                  134   8e-34   Macrophomina phaseolina MS6
emb|CDM30690.1|  Guanine nucleotide-binding protein subunit beta        134   8e-34   
emb|CCD58560.1|  unnamed protein product                                134   9e-34   
gb|ACY56335.1|  heterotrimeric G-protein beta subunit                   134   9e-34   
gb|KDB16478.1|  G protein beta subunit                                  137   9e-34   
gb|KIW03753.1|  guanine nucleotide-binding protein subunit beta         134   9e-34   
gb|KDQ31285.1|  hypothetical protein PLEOSDRAFT_1088718                 134   1e-33   
gb|EAL91392.1|  G protein complex beta subunit SfaD                     135   1e-33   
ref|XP_003855366.1|  G-protein beta subunit                             134   1e-33   
ref|XP_753430.2|  G protein complex beta subunit SfaD                   134   1e-33   
gb|EKV10669.1|  G protein complex beta subunit SfaD                     134   1e-33   
gb|AAC33436.1|  G-protein beta subunit                                  134   1e-33   
gb|AAW26990.1|  SJCHGC05537 protein                                     134   1e-33   
dbj|GAA83243.1|  G protein beta subunit SfaD                            134   1e-33   
ref|XP_002146687.1|  G protein complex beta subunit SfaD                134   1e-33   
ref|XP_657685.1|  GBB_CRYPA Guanine nucleotide-binding protein be...    134   1e-33   
ref|XP_006454225.1|  guanine nucleotide binding protein beta subu...    134   1e-33   
dbj|GAM35801.1|  hypothetical protein TCE0_017r04404                    134   1e-33   
gb|KDN37942.1|  putative G-protein beta subunit Bpp1                    134   1e-33   
ref|XP_002478991.1|  G protein complex beta subunit SfaD                134   1e-33   
gb|KEQ61617.1|  guanine nucleotide-binding protein-like protein s...    134   1e-33   
dbj|GAC99464.1|  hypothetical protein PHSY_007065                       134   1e-33   
gb|KDR85626.1|  hypothetical protein GALMADRAFT_218719                  134   2e-33   
gb|EIE75342.1|  hypothetical protein RO3G_00046                         134   2e-33   
gb|ACI33136.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    133   2e-33   
gb|KIO06877.1|  hypothetical protein M404DRAFT_998299                   134   2e-33   
emb|CDQ88615.1|  unnamed protein product                                133   2e-33   
gb|ACY66435.1|  guanine nucleotide-binding protein G(I)/G(S)/G(T)...    132   2e-33   
gb|ACI34200.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    133   2e-33   
gb|KFY30630.1|  hypothetical protein V494_08087                         132   2e-33   
gb|AAW25818.1|  unknown                                                 130   2e-33   
gb|AFN86168.1|  guanine nucleotide binding protein beta polypepti...    128   2e-33   
ref|XP_007390873.1|  hypothetical protein PHACADRAFT_248083             134   2e-33   
emb|CEG80074.1|  Putative Guanine nucleotide binding protein beta...    133   2e-33   
emb|CEG66533.1|  Putative Guanine nucleotide-binding protein subu...    133   2e-33   
gb|KII94026.1|  hypothetical protein PLICRDRAFT_413480                  133   2e-33   
emb|CBQ68126.1|  G-protein beta subunit Bpp1                            133   2e-33   
dbj|GAA97540.1|  hypothetical protein E5Q_04218                         135   2e-33   
dbj|BAE33181.1|  unnamed protein product                                133   2e-33   
ref|XP_004652379.1|  PREDICTED: guanine nucleotide-binding protei...    133   2e-33   
emb|CDQ76873.1|  unnamed protein product                                133   2e-33   
gb|KFY09959.1|  hypothetical protein V491_07871                         133   2e-33   
gb|KFZ08491.1|  hypothetical protein V501_05953                         133   2e-33   
gb|ELR06948.1|  guanine nucleotide-binding protein subunit beta         133   2e-33   
gb|EST06635.1|  G-beta protein                                          133   2e-33   
ref|XP_007001778.1|  G-protein beta subunit GPB1                        133   2e-33   
ref|XP_002473929.1|  candidate G-protein beta subunit                   133   2e-33   
gb|KFY15544.1|  hypothetical protein V492_01917                         133   2e-33   
ref|XP_001211230.1|  guanine nucleotide-binding protein beta subunit    132   2e-33   
gb|KFX85728.1|  hypothetical protein V490_09449                         133   2e-33   
ref|XP_010782136.1|  PREDICTED: guanine nucleotide-binding protei...    133   2e-33   
gb|KFY87168.1|  hypothetical protein V500_07143                         133   3e-33   
gb|KFY22639.1|  hypothetical protein V493_06444                         133   3e-33   
gb|KIP11721.1|  hypothetical protein PHLGIDRAFT_17891                   133   3e-33   
gb|KFY64152.1|  hypothetical protein V496_03450                         133   3e-33   
gb|KEI41986.1|  hypothetical protein L969DRAFT_43010                    135   3e-33   
gb|KIL01011.1|  hypothetical protein PAXRUDRAFT_7786                    133   3e-33   
ref|XP_009013973.1|  hypothetical protein HELRODRAFT_75178              133   3e-33   
ref|XP_002841111.1|  hypothetical protein                               133   3e-33   
ref|XP_003037057.1|  guanine nucleotide binding protein beta subu...    133   3e-33   
gb|KIY65983.1|  guanine nucleotide binding protein beta subunit 2       133   3e-33   
ref|XP_006732499.1|  PREDICTED: guanine nucleotide-binding protei...    132   3e-33   
gb|AAG31060.1|AF277161_1  G-protein B1 subunit                          132   3e-33   
ref|XP_002411384.1|  THO complex subunit, putative                      132   4e-33   
dbj|BAB63107.1|  hypothetical protein                                   131   4e-33   
gb|EMS22312.1|  guanine nucleotide binding protein beta subunit 2       132   4e-33   
ref|XP_007237084.1|  PREDICTED: guanine nucleotide-binding protei...    132   4e-33   
ref|XP_011386498.1|  G-protein beta subunit Bpp1                        132   4e-33   
ref|XP_007298281.1|  G-protein beta subunit                             132   4e-33   
ref|XP_010873676.1|  PREDICTED: guanine nucleotide-binding protei...    132   4e-33   
dbj|GAM90612.1|  hypothetical protein ANO11243_086570                   132   4e-33   
ref|XP_004639747.1|  PREDICTED: guanine nucleotide-binding protei...    132   5e-33   
ref|XP_008122386.1|  PREDICTED: guanine nucleotide-binding protei...    132   5e-33   
gb|KIK70487.1|  hypothetical protein GYMLUDRAFT_147651                  132   5e-33   
gb|ACD89060.1|  G-protein beta subunit                                  132   5e-33   
gb|KIK30110.1|  hypothetical protein PISMIDRAFT_671161                  132   5e-33   
gb|KDQ63041.1|  hypothetical protein JAAARDRAFT_29031                   132   5e-33   
ref|XP_007422625.1|  PREDICTED: guanine nucleotide-binding protei...    132   5e-33   
gb|AAZ79898.1|  G protein beta 1 subunit                                132   5e-33   
gb|KIL71611.1|  hypothetical protein M378DRAFT_174841                   132   5e-33   
gb|KDQ14498.1|  hypothetical protein BOTBODRAFT_55346                   132   5e-33   
ref|XP_009540278.1|  hypothetical protein HETIRDRAFT_30594              132   5e-33   
emb|CEI91472.1|  Putative G-protein beta subunit Bpp1                   132   5e-33   
ref|XP_007844457.1|  guanine nucleotide binding protein beta subu...    132   5e-33   
ref|XP_009269488.1|  Guanine nucleotide-binding protein subunit beta    132   5e-33   
ref|XP_004327705.1|  PREDICTED: guanine nucleotide-binding protei...    131   5e-33   
gb|AAU12180.1|  G protein beta 1 subunit                                132   5e-33   
gb|KFV95318.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    131   6e-33   
ref|XP_009032026.1|  hypothetical protein HELRODRAFT_91325              132   6e-33   
dbj|GAA51958.1|  guanine nucleotide binding protein (G protein) b...    134   6e-33   
ref|XP_004591382.1|  PREDICTED: guanine nucleotide-binding protei...    131   6e-33   
gb|EUC58591.1|  guanine nucleotide-binding protein subunit beta         132   6e-33   
ref|XP_007946466.1|  PREDICTED: guanine nucleotide-binding protei...    132   6e-33   
ref|XP_006884085.1|  PREDICTED: guanine nucleotide-binding protei...    132   6e-33   
ref|XP_004038092.1|  PREDICTED: guanine nucleotide-binding protei...    132   6e-33   
dbj|BAF83260.1|  unnamed protein product                                132   6e-33   
ref|NP_001084140.1|  guanine nucleotide-binding protein G(I)/G(S)...    132   6e-33   
ref|NP_001006835.1|  guanine nucleotide binding protein (G protei...    132   6e-33   
ref|XP_007905463.1|  PREDICTED: guanine nucleotide-binding protei...    132   7e-33   
gb|AAZ23828.1|  guanine nucleotide binding protein beta 4               131   7e-33   
ref|XP_005069787.1|  PREDICTED: guanine nucleotide-binding protei...    132   7e-33   
gb|EPT03478.1|  hypothetical protein FOMPIDRAFT_1022435                 132   7e-33   
ref|XP_006971195.1|  PREDICTED: guanine nucleotide-binding protei...    131   7e-33   
gb|AAM15922.1|AF501886_1  guanine nucleotide binding protein beta 4     132   7e-33   
gb|AFK83794.1|  visual G beta                                           132   7e-33   
ref|XP_002127296.1|  PREDICTED: guanine nucleotide-binding protei...    132   7e-33   
ref|XP_010154881.1|  PREDICTED: guanine nucleotide-binding protei...    131   7e-33   
ref|XP_007379313.1|  guanine nucleotide binding protein beta subunit    132   7e-33   
gb|KFH70743.1|  guanine nucleotide-binding protein subunit beta-1       132   8e-33   
ref|XP_005343822.1|  PREDICTED: guanine nucleotide-binding protei...    132   8e-33   
ref|XP_003509126.1|  PREDICTED: guanine nucleotide-binding protei...    132   8e-33   
gb|AAI14619.1|  GNB1 protein                                            131   8e-33   
ref|XP_006107565.1|  PREDICTED: guanine nucleotide-binding protei...    130   8e-33   
ref|XP_008205635.1|  PREDICTED: guanine nucleotide-binding protei...    129   8e-33   
gb|KIM70152.1|  hypothetical protein SCLCIDRAFT_12727                   132   8e-33   
ref|XP_009286316.1|  PREDICTED: guanine nucleotide-binding protei...    132   8e-33   
gb|AAH15920.1|  GNB3 protein                                            130   8e-33   
ref|XP_006682362.1|  hypothetical protein BATDEDRAFT_17943              132   8e-33   
ref|XP_010894390.1|  PREDICTED: guanine nucleotide-binding protei...    132   8e-33   
ref|XP_003273817.1|  PREDICTED: guanine nucleotide-binding protei...    130   8e-33   
ref|XP_009065631.1|  hypothetical protein LOTGIDRAFT_236462             132   8e-33   
gb|KJA28607.1|  hypothetical protein HYPSUDRAFT_62246                   132   8e-33   
gb|AIC61969.1|  GNB3                                                    130   8e-33   
dbj|BAB64500.1|  hypothetical protein                                   131   8e-33   
gb|ACI34147.1|  Guanine nucleotide-binding protein GI/GS/GT subun...    131   8e-33   
ref|NP_038559.2|  guanine nucleotide-binding protein subunit beta-4     131   9e-33   
emb|CDI51638.1|  G-protein beta subunit Bpp1                            132   9e-33   
ref|NP_001013932.1|  guanine nucleotide-binding protein subunit b...    131   9e-33   
gb|KFQ86003.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    131   9e-33   
gb|EHH17199.1|  hypothetical protein EGK_13538                          128   9e-33   
ref|XP_008703526.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
ref|XP_004424767.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
ref|XP_004603145.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
emb|CAG06987.1|  unnamed protein product                                131   9e-33   
ref|XP_001495326.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
emb|CDH56220.1|  guanine nucleotide binding protein beta subunit2       131   9e-33   
ref|XP_002716487.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
gb|KIJ29823.1|  hypothetical protein M422DRAFT_268694                   132   9e-33   
ref|XP_004647349.1|  PREDICTED: guanine nucleotide-binding protei...    131   9e-33   
ref|XP_007879043.1|  hypothetical protein PFL1_03335                    131   9e-33   
ref|XP_005545103.1|  PREDICTED: guanine nucleotide-binding protei...    130   9e-33   
ref|XP_004068666.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|AFD33363.1|  G protein beta 1                                        131   1e-32   
gb|KIY46334.1|  guanine nucleotide binding protein beta subunit 2       131   1e-32   
ref|XP_006183833.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_006750274.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_005796981.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_003973377.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|NP_001086141.1|  MGC84000 protein                                   131   1e-32   
gb|EFB20679.1|  hypothetical protein PANDA_013768                       130   1e-32   
ref|XP_004570997.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004024543.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004398413.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|AAA37664.1|  G-protein beta subunit                                  131   1e-32   
gb|EFB29343.1|  hypothetical protein PANDA_000240                       130   1e-32   
ref|XP_003455365.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004904454.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004880422.1|  PREDICTED: guanine nucleotide-binding protei...    132   1e-32   
ref|XP_008566332.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_006642037.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_006016254.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004003182.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_008031945.1|  G-protein beta subunit                             131   1e-32   
ref|XP_004548729.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_008557847.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|ABX75535.1|  G-protein beta subunit                                  131   1e-32   
ref|XP_010169104.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_005724603.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_009199588.1|  PREDICTED: guanine nucleotide-binding protei...    130   1e-32   
gb|AIC56938.1|  GNB4                                                    131   1e-32   
ref|NP_001092503.1|  guanine nucleotide-binding protein subunit b...    131   1e-32   
ref|XP_545211.1|  PREDICTED: guanine nucleotide-binding protein s...    131   1e-32   
ref|XP_003962986.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
dbj|BAF63410.1|  G-protein beta subunit 1                               131   1e-32   
gb|EMP25966.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    131   1e-32   
gb|KIK42136.1|  hypothetical protein CY34DRAFT_24068                    131   1e-32   
ref|XP_008283304.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|NP_997774.1|  guanine nucleotide-binding protein G(I)/G(S)/G(...    131   1e-32   
emb|CAG31478.1|  hypothetical protein RCJMB04_6n13                      131   1e-32   
ref|XP_010630753.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_008264760.1|  PREDICTED: guanine nucleotide-binding protei...    132   1e-32   
ref|XP_008317802.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_010729805.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_010125255.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_002758128.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_005986108.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_004479026.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
dbj|BAE40243.1|  unnamed protein product                                131   1e-32   
ref|NP_001098323.1|  guanine nucleotide-binding protein beta subunit    131   1e-32   
ref|XP_004880424.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_001508337.2|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_007648044.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_006740020.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_005383097.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|NP_067642.1|  guanine nucleotide-binding protein subunit beta-4     131   1e-32   
ref|XP_003448366.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
dbj|GAC73956.1|  G-protein beta subunit                                 131   1e-32   
ref|XP_005969939.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|NP_001012853.2|  guanine nucleotide-binding protein G(I)/G(S)...    131   1e-32   
emb|CCF51194.1|  probable G-protein beta subunit Bpp1                   131   1e-32   
ref|XP_005800197.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|EDL15010.1|  guanine nucleotide binding protein, beta 1, isofo...    131   1e-32   
ref|NP_001088470.1|  guanine nucleotide binding protein (G protei...    131   1e-32   
ref|XP_004425556.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|NP_032168.1|  guanine nucleotide-binding protein G(I)/G(S)/G(...    131   1e-32   
ref|XP_003467593.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|AAC72249.1|  G protein beta 1 subunit                                131   1e-32   
ref|NP_001126664.1|  guanine nucleotide-binding protein G(I)/G(S)...    131   1e-32   
ref|XP_001503482.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_001363370.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
pdb|4MK0|B  Chain B, Crystal Structure Of G Protein-coupled Recep...    131   1e-32   
gb|EPQ10807.1|  Guanine nucleotide-binding protein G(I)/G(S)/G(T)...    131   1e-32   
ref|XP_009323420.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
pdb|2BCJ|B  Chain B, Crystal Structure Of G Protein-coupled Recep...    131   1e-32   
ref|XP_007129197.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
ref|XP_006278284.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|KIM47595.1|  hypothetical protein M413DRAFT_439261                   131   1e-32   
emb|CDO73153.1|  hypothetical protein BN946_scf185007.g208              131   1e-32   
ref|XP_006903972.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
dbj|BAE33588.1|  unnamed protein product                                131   1e-32   
ref|XP_004272341.1|  PREDICTED: guanine nucleotide-binding protei...    131   1e-32   
gb|ABS45044.1|  guanine nucleotide-binding protein, beta-1 subunit      131   1e-32   



>gb|EYU37791.1| hypothetical protein MIMGU_mgv1a008244mg [Erythranthe guttata]
Length=380

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVA+LKERHMAAT+TVNSLR+RLK+KRLLLLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVADLKERHMAATETVNSLRDRLKQKRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT+S
Sbjct  121  SVACGGLDSMCSIFNLNSPTDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITAS  176



>gb|AAG12330.1|AF249743_1 heterotrimeric GTP-binding protein subunit beta 1 [Nicotiana 
tabacum]
Length=377

 Score =   304 bits (778),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>sp|P93397.1|GBB1_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-1 
[Nicotiana tabacum]
 emb|CAB06618.1| G protein beta subunit [Nicotiana tabacum]
Length=377

 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_009800901.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Nicotiana sylvestris]
Length=377

 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>gb|AIL52187.1| heterotrimeric G-protein beta subunit [Capsicum annuum]
Length=377

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHM ATQTVN LRE+LK+KRL LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMVATQTVNDLREKLKQKRLQLLDTDVAGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>gb|ACR77529.1| heterotrimeric G protein beta 2 subunit [Nicotiana benthamiana]
Length=377

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN L E+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVKELKERHMAATQTVNDLCEKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_010254875.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Nelumbo nucifera]
Length=379

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT TVN+LRERLK+KR LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNALRERLKQKRTLLLDTDVAGYARSQGRTPVSFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPVDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>emb|CDO97059.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AATQTV++LR+RLK+KRLLLLDTDVA Y+RSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKERHLAATQTVSALRDRLKQKRLLLLDTDVAGYSRSQGRTPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGH GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHNGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+EDAHLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVSKMLSGHKGYVSSCQYVPDEDAHLITSS  176



>gb|AJE63427.1| heterotrimeric G protein beta 2 subunit [Capsicum annuum]
Length=377

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHM ATQTVN LRE+LK+KRL LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMVATQTVNDLREKLKQKRLQLLDTDVAGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_010263695.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Nelumbo nucifera]
Length=337

 Score =   300 bits (769),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK+RH+AAT TVN+LRE+LK+KR+LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKKRHIAATATVNALREQLKQKRILLLDTDVAGYARSQGRTPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWN+LTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNSLTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSICSIFNLNSPNDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>gb|KJB32495.1| hypothetical protein B456_005G243000 [Gossypium raimondii]
Length=377

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKE+H AAT+TVN+LRERLK++R  LLDTDVATYARSQGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKEKHAAATETVNNLRERLKQRRQQLLDTDVATYARSQGKSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSS  176



>gb|KHG11481.1| Guanine nucleotide-binding subunit beta-2 [Gossypium arboreum]
Length=377

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKE+H AAT+TVN+LRERLK++R  LLDTDVATYARSQGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKEKHAAATETVNNLRERLKQRRQQLLDTDVATYARSQGKSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSS  176



>sp|P93339.1|GBB_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta; 
AltName: Full=NpGPB1 [Nicotiana plumbaginifolia]
 emb|CAA70704.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=377

 Score =   301 bits (772),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+G 
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGH  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_003631647.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Vitis vinifera]
 emb|CBI32581.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   301 bits (772),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAAT+TVNSLRERLK+KRLLLLDTDVA YAR+QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRERLKQKRLLLLDTDVAGYARAQGKSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  +S+ LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLAMSKMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_009605958.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Nicotiana tomentosiformis]
 sp|P93398.1|GBB2_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-2 
[Nicotiana tabacum]
 emb|CAB06619.1| G protein beta subunit [Nicotiana tabacum]
Length=377

 Score =   301 bits (771),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YARSQGKTP+ FGPTDLVCCR 
Sbjct  1    MSVKELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVIFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHVITSS  176



>ref|XP_011048621.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X2 [Populus euphratica]
Length=375

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>gb|AFK40354.1| unknown [Medicago truncatula]
Length=177

 Score =   294 bits (752),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD+A YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYAKSQGRTPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGK+YSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKIYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT  650
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLIT  174



>ref|XP_002313052.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
 gb|EEE87007.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
Length=377

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH+AAT+TVNSL ERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLGERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_011048613.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Populus euphratica]
Length=377

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A +AR+QG+ P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDIAGHARAQGRNPVSFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPAGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_011037538.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Populus euphratica]
Length=377

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+ATYAR+Q ++P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDMATYARAQERSPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>sp|Q40507.1|GBB3_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Nicotiana tabacum]
 emb|CAA66842.1| G protein [Nicotiana tabacum]
Length=375

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAATQTV+ LRE+LK+KRL LLDTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHMAATQTVSDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSI+NLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIYNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_010263694.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Nelumbo nucifera]
Length=376

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK+RH+AAT TVN+LRE+LK+KR+LLLDTDVA YARSQG+TP+SFGPTDLVCCR 
Sbjct  1    MSVAELKKRHIAATATVNALREQLKQKRILLLDTDVAGYARSQGRTPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWN+LTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNSLTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN TVSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSICSIFNLNSPNDKDGNLTVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_002509478.1| guanine nucleotide-binding protein beta, putative [Ricinus communis]
 gb|EEF50865.1| guanine nucleotide-binding protein beta, putative [Ricinus communis]
Length=377

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK RH+AAT+TVN+LRERLK+KRLLLLDTDVA YAR+QGKTP+SFGPTDLVCCR 
Sbjct  1    MSVAELKARHVAATETVNTLRERLKQKRLLLLDTDVAGYARAQGKTPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTAEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P + DGN  VS+ LSGHKGYVSACQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTEKDGNLPVSKMLSGHKGYVSACQYVPDEDTHLITSS  176



>ref|XP_002306098.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
 gb|EEE86609.1| ERECTA-LIKE 4 family protein [Populus trichocarpa]
Length=377

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH+AAT+TVNSLRERLK+KRLLLLDTD+A YAR+Q ++P+SFGPTDLVCCR 
Sbjct  1    MSVSELKERHVAATETVNSLRERLKQKRLLLLDTDMARYARAQERSPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_004299095.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Fragaria vesca subsp. vesca]
Length=377

 Score =   298 bits (764),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA++TVNSLRERLK+KR  LLDTDVA YARSQGK  ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKQKRASLLDTDVAGYARSQGKAALTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNL+ P D DGN  VSRTL+GHKGYVSACQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLSSPCDKDGNLPVSRTLNGHKGYVSACQYVPDEDTHLITGS  176



>ref|NP_001240891.1| uncharacterized protein LOC100811645 [Glycine max]
 gb|ACU21225.1| unknown [Glycine max]
 gb|KHN33759.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+TVNSLRERLKE+RL LLDTD+A YARSQG++P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETVNSLRERLKERRLSLLDTDIAGYARSQGRSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGH GKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHAGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCS+FNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSLFNLNSPTDRDGNLAVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>gb|AAD49742.1|AF170921_1 G protein beta subunit [Pisum sativum]
Length=377

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT+TVN+LRERLK++RL LLDTD+A YARSQG+ P++FGPTD++CCR 
Sbjct  1    MSVAELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGS  176



>ref|XP_004230907.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Solanum 
lycopersicum]
Length=377

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA++QGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKTQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|NP_001274886.1| guanine nucleotide-binding protein subunit beta [Solanum tuberosum]
 gb|AAL07488.1|AF414114_1 G protein beta subunit 2 [Solanum tuberosum]
Length=377

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA++QGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKTQGKTPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_007201063.1| hypothetical protein PRUPE_ppa007241mg [Prunus persica]
 gb|EMJ02262.1| hypothetical protein PRUPE_ppa007241mg [Prunus persica]
Length=377

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA++TVNSLRERLKEKR  LLDTDVA YA+SQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKEKRASLLDTDVAGYAKSQGKTPLTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITGS  176



>ref|XP_008236879.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Prunus mume]
Length=377

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA++TVNSLRERLK+KR  LLDTDVA YA+SQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASETVNSLRERLKQKRASLLDTDVAGYAKSQGKTPLTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLITGS  176



>gb|KHN20072.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+T+NSLRERLKE+RL LLDTD+A YARSQG+ P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETINSLRERLKERRLSLLDTDIAGYARSQGRAPVTFGPTDLVCCRA  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HL+T S
Sbjct  121  SVACGGLDSVCSIFNLNSPADRDGNLAVSQMLSGHKGYVSSCQYVPDEDTHLVTGS  176



>ref|XP_008375922.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Malus domestica]
Length=377

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA+ TVNSLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASDTVNSLRERLKQKRASLLDTDVAEYARSQGKTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSRTLSGHKGYVS+CQYVP+ED HLI+ S
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLSGHKGYVSSCQYVPDEDTHLISGS  176



>ref|XP_003527220.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoformX1 [Glycine max]
 ref|XP_006581122.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X2 [Glycine max]
Length=377

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+T+NSLRERLKE+RL LLDTD+A YARSQG+ P++FGPTDLVCCR 
Sbjct  1    MSVTELKERHLAATETINSLRERLKERRLSLLDTDIAGYARSQGRAPVTFGPTDLVCCRA  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HL+T S
Sbjct  121  SVACGGLDSVCSIFNLNSPADRDGNLAVSQMLSGHKGYVSSCQYVPDEDTHLVTGS  176



>ref|XP_003603911.1| Guanine nucleotide-binding protein subunit beta-1 [Medicago truncatula]
 gb|AES74162.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=378

 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD+A YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYAKSQGRTPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGS  176



>ref|XP_010107843.1| Guanine nucleotide-binding protein subunit beta-2 [Morus notabilis]
 gb|EXC17243.1| Guanine nucleotide-binding protein subunit beta-2 [Morus notabilis]
Length=377

 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+A T+TVNSLRE+L+++RL LLDTDVA YA+SQG+TP+ FGPTDLVCCR 
Sbjct  1    MSVAELKERHVATTETVNSLREQLRQRRLSLLDTDVAGYAKSQGRTPVRFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVM CAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMNCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  V++TL GH+GYVS+CQYVP ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVAKTLIGHRGYVSSCQYVPEEDTHLITSS  176



>ref|XP_009374178.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Pyrus 
x bretschneideri]
Length=378

 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA+ TVNSLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVAASDTVNSLRERLKQKRASLLDTDVAGYARSQGKTPLTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  VSRTL+GHKGYVS+CQYVP+EDAHLIT S
Sbjct  121  SVACGGLDSACSIFNLNSLCDKDGNLPVSRTLNGHKGYVSSCQYVPDEDAHLITGS  176



>ref|XP_011088384.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Sesamum 
indicum]
Length=377

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAAT+TVNSLR+RL+++RLLLLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRDRLRQQRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKV+SLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN   DNDG+  VSR LSGHKGYVS+CQYVP+ED HLIT+S
Sbjct  121  SVACGGLDSMCSIFNLNTQTDNDGHMPVSRMLSGHKGYVSSCQYVPDEDTHLITAS  176



>sp|P93563.1|GBB_SOLTU RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Solanum tuberosum]
 emb|CAA61106.1| GB1 protein [Solanum tuberosum]
Length=377

 Score =   296 bits (758),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAATQTVN LRE+LK+KRL LLDTDV+ YA+ QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKRQGKSPVTFGPTDLVCCRI  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSS  176



>gb|KDP46245.1| hypothetical protein JCGZ_10085 [Jatropha curcas]
Length=377

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK RH+AAT+TVN+LRERLK+KRLLLLDTDVA YAR+QGK P+SFGPTDLVCCR 
Sbjct  1    MSVAELKARHVAATETVNTLRERLKQKRLLLLDTDVAGYARAQGKPPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VS+ LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLPVSKMLSGHKGYVSSCQYVPDEDTHLITSS  176



>ref|XP_009609408.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Nicotiana tomentosiformis]
Length=380

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAA QTVN+LRERLK+KRL LLDTDVA YARSQG TP+SFGPTDLVCCR 
Sbjct  4    MSVTELKERHMAANQTVNTLRERLKQKRLHLLDTDVAGYARSQGITPVSFGPTDLVCCRI  63

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGH+GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  64   LQGHSGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPIGQ  123

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+ED H+IT S
Sbjct  124  SVACGGLDSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEDGHVITGS  179



>ref|XP_004500814.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cicer arietinum]
Length=378

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+AAT+TVN+LRERLK++RL LLDTD++ YA+SQG+TP++FGPTD++CCR 
Sbjct  1    MSVTELKERHIAATETVNNLRERLKQRRLSLLDTDISGYAKSQGRTPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGS  176



>gb|KCW55344.1| hypothetical protein EUGRSUZ_I01264 [Eucalyptus grandis]
Length=313

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH AAT+TVNSLRERLK+KR+ LLDTDVA YAR+QGKTP++FG TDLVCCR 
Sbjct  1    MSVAELKERHRAATETVNSLRERLKQKRVQLLDTDVAGYARTQGKTPVTFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVS SQDGR IVWNALTSQKTHAI+LPCAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSVSQDGRFIVWNALTSQKTHAIRLPCAWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ DAHLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPVDRDGNLPVSRMLSGHKGYVSSCQYVPDGDAHLITGS  176



>ref|XP_009779361.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X1 [Nicotiana sylvestris]
Length=380

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERHMAA QTVN+LRERLK+KRL LLDTDVA YARSQGK P+SFGPTDLVCCR 
Sbjct  4    MSVTELKERHMAANQTVNTLRERLKQKRLHLLDTDVAGYARSQGKAPVSFGPTDLVCCRI  63

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G 
Sbjct  64   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPFGH  123

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+E+ H+IT S
Sbjct  124  SVACGGLDSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEEGHMITGS  179



>gb|AAD33959.1|AF145976_1 G protein beta subunit [Pisum sativum]
Length=377

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVA++KERH+AAT+TVN+LRERL   RL LLDTD+A YARSQG+ P++FGPTD++CCR 
Sbjct  1    MSVADVKERHIAATETVNNLRERLSRDRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPLDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGS  176



>gb|AEQ61903.1| GTP-binding protein beta subunit [Salvia miltiorrhiza]
Length=377

 Score =   294 bits (753),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAA +TVNSL+ERLK+KRLLLLDTDVA YAR+QG+T +SFGPTDLVCCR 
Sbjct  1    MSVAELKERHMAAAETVNSLKERLKQKRLLLLDTDVAGYARAQGQTRVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGH+GKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHSGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN   D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT+S
Sbjct  121  SVACGGLDSMCSIFNLNSQTDKDGNPPVSRMLSGHKGYVSSCQYVPDEDTHLITAS  176



>ref|XP_010690896.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Beta vulgaris subsp. vulgaris]
Length=391

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            + + KMSVAELKERH AA + VNSLRE+LK++R  LLDTDVA++A SQGK  +SFG TDL
Sbjct  10   EKREKMSVAELKERHTAAIEQVNSLREQLKQRRRHLLDTDVASFAASQGKATVSFGQTDL  69

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
            VCCR LQGH+GKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF
Sbjct  70   VCCRTLQGHSGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  129

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            SPTGQSVACGGLDSVCSIFNLN P D +GN  VS+TLSGHKGYVS CQY+P+EDAHLITS
Sbjct  130  SPTGQSVACGGLDSVCSIFNLNSPTDREGNLPVSKTLSGHKGYVSCCQYIPDEDAHLITS  189

Query  654  S  656
            S
Sbjct  190  S  190



>ref|XP_010254874.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
isoform X1 [Nelumbo nucifera]
Length=387

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 163/184 (89%), Gaps = 8/184 (4%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTD--------VATYARSQGKTPISFGP  284
            MSVAELKERH+AAT TVN+LRERLK+KR LLLDTD         A YARSQG+TP+SFGP
Sbjct  1    MSVAELKERHIAATATVNALRERLKQKRTLLLDTDGSSSCYSHFAGYARSQGRTPVSFGP  60

Query  285  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT  464
            TDLVCCR LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT
Sbjct  61   TDLVCCRILQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT  120

Query  465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL  644
            CAFSP GQSVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HL
Sbjct  121  CAFSPNGQSVACGGLDSVCSIFNLNSPVDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHL  180

Query  645  ITSS  656
            ITSS
Sbjct  181  ITSS  184



>ref|XP_007042211.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 ref|XP_007042212.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 gb|EOX98042.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
 gb|EOX98043.1| GTP binding protein beta 1 isoform 1 [Theobroma cacao]
Length=377

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKER  AAT+TVN+LRERL+++RL L+DTDVA YARSQG++P++FGPTDLVCCR 
Sbjct  1    MSVVELKERLSAATETVNNLRERLRQRRLQLIDTDVAEYARSQGRSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN P D DGN  VS+TLSGHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDSMCSIFNLNSPTDRDGNLPVSKTLSGHKGYVSCCQYVPDEDIHIITSS  176



>ref|XP_010028582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Eucalyptus grandis]
 gb|KCW55345.1| hypothetical protein EUGRSUZ_I01264 [Eucalyptus grandis]
Length=377

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH AAT+TVNSLRERLK+KR+ LLDTDVA YAR+QGKTP++FG TDLVCCR 
Sbjct  1    MSVAELKERHRAATETVNSLRERLKQKRVQLLDTDVAGYARTQGKTPVTFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVS SQDGR IVWNALTSQKTHAI+LPCAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSVSQDGRFIVWNALTSQKTHAIRLPCAWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ DAHLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPVDRDGNLPVSRMLSGHKGYVSSCQYVPDGDAHLITGS  176



>gb|AAM97354.1| G protein beta subunit [Pisum sativum]
Length=377

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVA++KERH+AAT+TVN+LRERLK++RL LLDTD+A YARSQG+ P++ GPTD++CCR 
Sbjct  1    MSVADVKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTLGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGS  176



>ref|XP_009345730.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Pyrus x bretschneideri]
Length=377

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+ A+ TV SLRERLK+KR  LLDTDVA YARSQGKTP++FGPTDLVCCR 
Sbjct  1    MSVAELKERHVVASDTVKSLRERLKQKRASLLDTDVAGYARSQGKTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSRTL GHKGYVS+CQYVP+ED HLI+ S
Sbjct  121  SVACGGLDSVCSIFNLNSLCDKDGNLPVSRTLGGHKGYVSSCQYVPDEDTHLISGS  176



>ref|XP_006423250.1| hypothetical protein CICLE_v10028655mg [Citrus clementina]
 ref|XP_006487153.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Citrus sinensis]
 gb|ESR36490.1| hypothetical protein CICLE_v10028655mg [Citrus clementina]
Length=379

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSS
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSS  178



>gb|KDO49094.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=379

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSS
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSS  178



>ref|XP_006856030.1| hypothetical protein AMTR_s00059p00065870 [Amborella trichopoda]
 gb|ERN17497.1| hypothetical protein AMTR_s00059p00065870 [Amborella trichopoda]
Length=377

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKE+H+AAT TVNSLRERLK+KRL LLDTDVA YA+S GKTP+SFGPTDLVCCR 
Sbjct  1    MSVAELKEKHLAATATVNSLRERLKQKRLQLLDTDVAGYAKSIGKTPVSFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTG+VYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGRVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  VSR LSGHKGYVS CQYVP+ D HLITSS
Sbjct  121  SVACGGLDSACSIFNLNSQTDKDGNLPVSRILSGHKGYVSCCQYVPDGDTHLITSS  176



>ref|XP_011092783.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Sesamum indicum]
Length=379

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = +3

Query  129  MSV-AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  305
            MSV AELKERH AAT+T+N L+++LK+KRLLLLDTDVA YARSQGKTP++FGPTDLVCCR
Sbjct  1    MSVLAELKERHTAATETLNGLKDKLKQKRLLLLDTDVAGYARSQGKTPVTFGPTDLVCCR  60

Query  306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  485
             LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G
Sbjct  61   TLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPGG  120

Query  486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            QSVACGGLDSVCSIFNLN P + DGN  VSR L+GHKGYVS+CQYVP+E+ HLIT+S
Sbjct  121  QSVACGGLDSVCSIFNLNSPNNKDGNLPVSRMLTGHKGYVSSCQYVPDEETHLITAS  177



>gb|KDO49093.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=389

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSS
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSS  178



>gb|KDO49095.1| hypothetical protein CISIN_1g016458mg [Citrus sinensis]
Length=388

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SV+ELKERH AA +TVNSLRERLK+KR  LLD DVA Y+RSQG+ P+SFGPTDLVCCR L
Sbjct  4    SVSELKERHAAAIETVNSLRERLKQKRQQLLDVDVAGYSRSQGRAPVSFGPTDLVCCRTL  63

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH GKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS
Sbjct  64   QGHAGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  123

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS CQYVP+ED HLITSS
Sbjct  124  VACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSS  178



>ref|XP_010530843.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Tarenaya hassleriana]
Length=377

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELK+RH AAT+TVN+LRERL++KRL LLDTDVA Y+ +QG+TP++FGPTDLVCCR 
Sbjct  1    MSVSELKDRHAAATETVNNLRERLRQKRLQLLDTDVAGYSAAQGRTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS TGQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSSTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGH+GYVS CQY+PNED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSTTDKDGNLPVSRMLSGHRGYVSCCQYIPNEDTHLITSS  176



>ref|XP_003541055.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1-like 
[Glycine max]
 gb|KHN25368.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH AAT TVN+LR RLK+KRL LLDTDV+ YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHSAATDTVNNLRHRLKQKRLSLLDTDVSGYARSQGRTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>ref|XP_003537878.1| PREDICTED: guanine nucleotide-binding protein subunit beta-1 
[Glycine max]
 gb|KHN39779.1| Guanine nucleotide-binding protein subunit beta-2 [Glycine soja]
Length=377

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH AAT TVN+LR RLK+KRL LLDTD++ YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVTELKERHSAATDTVNNLRHRLKQKRLSLLDTDISGYARSQGRTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>gb|AFK33707.1| unknown [Lotus japonicus]
Length=377

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV ELKERH+ A +TVN+LRERLK+KRL LLDTD++ YA+SQG+ P++FGPTD++CCR 
Sbjct  1    MSVTELKERHLTAAETVNNLRERLKQKRLSLLDTDISGYAKSQGRAPVTFGPTDILCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVY+LDWT EKNRIVS SQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYALDWTSEKNRIVSTSQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFNLNSSTDRDGNLNVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>gb|AGZ15391.1| G protein beta subunit [Phaseolus vulgaris]
Length=377

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK+RH AA  TVN+LR RLK+KRL LLDTD+  YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVAELKDRHSAAIDTVNNLRHRLKQKRLSLLDTDICEYARSQGRTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+LN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFHLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>ref|XP_007131843.1| hypothetical protein PHAVU_011G045900g [Phaseolus vulgaris]
 gb|ESW03837.1| hypothetical protein PHAVU_011G045900g [Phaseolus vulgaris]
Length=377

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK+RH AA  TVN+LR RLK+KRL LLDTD+  YARSQG+TP++FGPTDLVCCR 
Sbjct  1    MSVAELKDRHSAAIDTVNNLRHRLKQKRLSLLDTDICEYARSQGRTPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EK++IVSASQDGRLIVWNALT QK HAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTSEKSQIVSASQDGRLIVWNALTRQKIHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+LN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLIT S
Sbjct  121  SVACGGLDSVCSIFHLNSPTDKDGNLPVSRMLSGHKGYVSSCQYVPDEDTHLITGS  176



>ref|XP_008447036.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2 
[Cucumis melo]
Length=377

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YARS G+TPISFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARSLGRTPISFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVA GGLDSVCSIFNLN P D DGN  V+RTLSGHKGY+S+CQYVP+ED HLIT S
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLSGHKGYISSCQYVPDEDTHLITGS  176



>ref|XP_004160234.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cucumis sativus]
Length=330

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YAR+ G+TP+SFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARTLGRTPVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVA GGLDSVCSIFNLN P D DGN  V+RTL GHKGY+S+CQYVP+ED HLIT S
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLCGHKGYISSCQYVPDEDTHLITGS  176



>ref|XP_010432411.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Camelina 
sativa]
 ref|XP_010447077.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Camelina 
sativa]
Length=377

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV++LKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSDLKERHAVATETVNNLRDRLRQRRLQLLDTDVARYSAAQGRTPVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCQYVPNEDAHLITSS  176



>ref|XP_010526922.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Tarenaya hassleriana]
Length=292

 Score =   276 bits (706),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELK+RH AA +TV++LRERL++KRL LLDTDV  Y+  Q +TP+SF PTDLVCCR 
Sbjct  1    MSVAELKDRHAAALETVSNLRERLRQKRLHLLDTDVVGYSTVQKRTPVSFEPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+N IVSASQDGRL+VWNALTSQKTHAIKLPCAWVM CAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERNWIVSASQDGRLVVWNALTSQKTHAIKLPCAWVMACAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS CQY+PNED HLITSS
Sbjct  121  SVACGGLDSVCSIFNLNSTTDKDGNIPVSRMLSGHKGYVSCCQYIPNEDTHLITSS  176



>ref|XP_004150413.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
[Cucumis sativus]
 gb|KGN44348.1| hypothetical protein Csa_7G267960 [Cucumis sativus]
Length=377

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MS +ELKERH+AA +TVNSL+ERLK+KR  LLDT+VA YAR+ G+TP+SFG TDLVCCR 
Sbjct  1    MSGSELKERHVAAIETVNSLKERLKQKRHSLLDTNVAGYARTLGRTPVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPC WVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCPWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVA GGLDSVCSIFNLN P D DGN  V+RTL GHKGY+S+CQYVP+ED HLIT S
Sbjct  121  SVAGGGLDSVCSIFNLNSPTDRDGNLPVTRTLCGHKGYISSCQYVPDEDTHLITGS  176



>gb|KHG07839.1| Guanine nucleotide-binding subunit beta-2 [Gossypium arboreum]
Length=377

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            M VAELKERH AA + VN LRERLK++R  LLDTDVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MPVAELKERHAAAIEAVNDLRERLKQRRQQLLDTDVAGYARSHGRSQVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS+CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDSMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSS  176



>gb|KJB79197.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
Length=331

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH AA + VN LRERLK++R  LLD DVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHAAAIEAVNDLRERLKQRRQQLLDADVAGYARSLGRSQVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLD +CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDGMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSS  176



>ref|XP_010437612.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Camelina sativa]
Length=377

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV++LKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSDLKERHAVATETVNNLRDRLRQRRLQLLDTDVARYSAAQGRTPVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT E+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTSERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCQYVPNEDAHLITSS  176



>gb|AIS73131.1| heterotrimeric G protein beta subunit 2 [Brassica nigra]
Length=378

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LRERL+++R+ LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRERLRQRRIQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSS  176



>ref|NP_974683.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86380.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=347

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  176



>gb|KJB79195.1| hypothetical protein B456_013G037500 [Gossypium raimondii]
Length=377

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH AA + VN LRERLK++R  LLD DVA YARS G++ ++FGPTDLVCCR 
Sbjct  1    MSVAELKERHAAAIEAVNDLRERLKQRRQQLLDADVAGYARSLGRSQVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE++RIVSASQDGRLIVWNA TSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct  61   LQGHTGKVYSLDWTPERDRIVSASQDGRLIVWNAQTSQKTHAIKLPCAWVMTCAFSPTGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLD +CSIFNLN   D DGN  VS TL+GHKGYVS CQYVP+ED H+ITSS
Sbjct  121  SVACGGLDGMCSIFNLNSATDRDGNLPVSVTLNGHKGYVSCCQYVPDEDIHIITSS  176



>ref|XP_006412223.1| hypothetical protein EUTSA_v10025475mg [Eutrema salsugineum]
 gb|ESQ53676.1| hypothetical protein EUTSA_v10025475mg [Eutrema salsugineum]
Length=377

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVAKYSVAQGRTPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSS  176



>dbj|BAJ34135.1| unnamed protein product [Thellungiella halophila]
Length=377

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA Y+ +QG+TP+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVAKYSVAQGRTPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSS  176



>gb|ACX43274.1| GTP binding protein beta subunit [Brassica napus]
Length=377

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSS  176



>gb|KFK30072.1| hypothetical protein AALP_AA7G213100 [Arabis alpina]
Length=379

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            +SV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+SFG TDLVCCR 
Sbjct  3    VSVSELKERHAIATETVNNLRDRLRQRRLQLLDTDVSNYSVAQGRSPVSFGATDLVCCRT  62

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  63   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  122

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L    D DG   VSR LSGH+GYVS CQYVPNEDAHLITSS
Sbjct  123  SVACGGLDSVCSIFSLTSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSS  178



>ref|XP_002867119.1| hypothetical protein ARALYDRAFT_491213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43378.1| hypothetical protein ARALYDRAFT_491213 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  176



>gb|AAV85721.1| At4g34460 [Arabidopsis thaliana]
Length=375

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  176



>ref|NP_195172.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 sp|P49177.1|GBB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta; 
AltName: Full=AGB1; AltName: Full=transducin [Arabidopsis 
thaliana]
 gb|AAA50445.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 emb|CAA18825.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 emb|CAB80163.1| GTP binding protein beta subunit [Arabidopsis thaliana]
 gb|AEE86381.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=377

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  176



>emb|CDX69061.1| BnaC01g03920D [Brassica napus]
Length=377

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH AAT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAAATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSS  176



>ref|XP_009138296.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Brassica rapa]
Length=378

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSS  176



>gb|AIO11831.1| heterotrimeric G-protein beta subunit 1 [Brassica rapa]
Length=378

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSS  176



>ref|XP_006283934.1| hypothetical protein CARUB_v10005053mg [Capsella rubella]
 gb|EOA16832.1| hypothetical protein CARUB_v10005053mg [Capsella rubella]
Length=377

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT TVN+LR+RL+++RL LLDTDVA+Y+ +QG+TP+SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDRLRQRRLQLLDTDVASYSAAQGRTPVSFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
             VACGGLDSVCSIF+L    D DG   VS+ L+GHKGYVS CQYVPNED HLITSS
Sbjct  121  LVACGGLDSVCSIFSLTSTADKDGTVPVSKMLTGHKGYVSCCQYVPNEDTHLITSS  176



>ref|XP_008783473.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Phoenix 
dactylifera]
Length=383

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            M VAELKERHMAAT TVN LRERLK++R  LLDTDVA YA+S GKT ISFG TDLVCCR 
Sbjct  1    MYVAELKERHMAATATVNGLRERLKQRRQALLDTDVAGYAKSHGKTAISFGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  Q
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLYCAWVMTCAFAPNSQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  L+TSS
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPVSRILTGHKGYVSSCQYVPDQETRLLTSS  176



>gb|AIS73132.1| heterotrimeric G protein beta subunit 3 [Brassica nigra]
Length=377

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDAHLITSS  176



>gb|AIO11833.1| heterotrimeric G-protein beta subunit 3 [Brassica rapa]
Length=377

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLQQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSS  176



>ref|XP_009112299.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Brassica 
rapa]
Length=377

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLQQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSS  176



>emb|CDX75436.1| BnaA01g02660D [Brassica napus]
Length=377

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPNEDA LITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNEDARLITSS  176



>ref|XP_010942027.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X3 [Elaeis guineensis]
Length=371

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT S
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGS  176



>gb|AIS73130.1| heterotrimeric G protein beta subunit 1 [Brassica nigra]
Length=378

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVAKYSVAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSR LSGH+GYVS CQYVPN DAHLITSS
Sbjct  121  TVACGGLDSVCSIFSLSSTADKDGTVPVSRMLSGHRGYVSCCQYVPNGDAHLITSS  176



>ref|XP_010942026.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X2 [Elaeis guineensis]
Length=379

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT S
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGS  176



>ref|XP_010942025.1| PREDICTED: guanine nucleotide-binding protein subunit beta isoform 
X1 [Elaeis guineensis]
Length=392

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT  VN+LRERLK++R  LLDTDVA YA+S GKT I FG TDLVCCR 
Sbjct  1    MSVAELKERHIAATANVNALRERLKQRRQELLDTDVAGYAKSHGKTAIGFGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQ+VP+++  LIT S
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRVLTGHKGYVSSCQFVPDQETRLITGS  176



>ref|XP_009406753.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406754.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT TVNSLRERLK++R LLLDTDVA +A+SQG++ ISF  TDL+CCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRRQLLLDTDVAAFAKSQGRSAISFNSTDLICCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVMTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYV +CQYVP+++  LITSS
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPVSRILTGHKGYVYSCQYVPDQETRLITSS  176



>gb|ABR17717.1| unknown [Picea sitchensis]
Length=377

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAEL+ERH+AAT  VN+LRER+K+KR  LLDTDVATYA + G+TPISF  TDLVCCR 
Sbjct  1    MSVAELRERHVAATAKVNALRERIKDKRRQLLDTDVATYASNNGRTPISFSFTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF LN   D DG+   SR LSGH+GYVS+CQYVP+ D H+IT S
Sbjct  121  AVACGGLDSVCSIFQLNSQIDRDGHLPASRILSGHRGYVSSCQYVPDGDTHVITGS  176



>ref|XP_009108730.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Brassica rapa]
Length=378

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL ++RL LLDTDVA Y  +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDRLIQRRLQLLDTDVAKYTAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKV+SLDWTPE NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGG L+SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSS
Sbjct  121  TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSS  177



>ref|XP_009416786.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=379

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT TVNSLRERLK+++ LL+DTD+A Y RSQG++ ISFG TDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRQQLLVDTDMAAYGRSQGRSAISFGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WV+TCAF+P GQ
Sbjct  61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVVTCAFAPNGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGL+S CSIFNLN   D DGN  VS+ L+GHKGYV +CQYVP+++  LITSS
Sbjct  121  SVACGGLNSACSIFNLNSQVDRDGNIPVSQILTGHKGYVYSCQYVPDQETRLITSS  176



>ref|XP_004982216.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X3 [Setaria italica]
Length=380

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSS  177



>ref|XP_004982214.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Setaria italica]
Length=427

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSS  177



>gb|AHJ60245.1| heterotrimeric G-protein beta subunit [Picea abies]
Length=377

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAEL+ERH+ AT  VN+LRER+K+KR  LLDTDVATYA + G+TPISF  TDLVCCR 
Sbjct  1    MSVAELRERHVVATAKVNALRERIKDKRRQLLDTDVATYASNNGRTPISFSFTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct  61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF LN   D DG+   SR LSGH+GYVS+CQYVP+ D H+IT S
Sbjct  121  AVACGGLDSVCSIFQLNSQIDRDGHLPASRILSGHRGYVSSCQYVPDGDTHVITGS  176



>emb|CDX72483.1| BnaC07g45050D [Brassica napus]
Length=885

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVNSLR++L+++RL LLDTDVA Y+ +QG++P+ FG TDLVCCR 
Sbjct  508  MSVSELKERHAVATETVNSLRDKLRQRRLQLLDTDVAKYSAAQGRSPVKFGATDLVCCRT  567

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  568  LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  627

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSS
Sbjct  628  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSS  683



>ref|XP_004982215.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Setaria italica]
Length=396

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDVA Y+++QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRREMLLDTDVARYSKAQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQESRLITSS  177



>gb|EEC75892.1| hypothetical protein OsI_12941 [Oryza sativa Indica Group]
Length=380

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>sp|Q40687.1|GBB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Oryza sativa Japonica Group]
 emb|CAA61889.1| g protein B subunit [Oryza sativa Japonica Group]
 gb|AAP44640.1| guanine nucleotide-binding protein beta subunit [Oryza sativa 
Japonica Group]
 gb|ABF98102.1| Guanine nucleotide-binding protein beta subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01349.1| unnamed protein product [Oryza sativa Japonica Group]
Length=380

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>gb|AEE69019.1| heterotrimeric G protein beta subunit [Oryza sativa Japonica 
Group]
Length=378

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>ref|XP_002466691.1| hypothetical protein SORBIDRAFT_01g012370 [Sorghum bicolor]
 gb|EER93689.1| hypothetical protein SORBIDRAFT_01g012370 [Sorghum bicolor]
Length=380

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRLPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>ref|XP_010935069.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X3 [Elaeis guineensis]
Length=383

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            +QGHTGKVYSLDW PE+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  Q
Sbjct  61   MQGHTGKVYSLDWAPERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQ  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  121  SVACGGLDSACSIFNLNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSS  176



>gb|ACF86117.1| unknown [Zea mays]
Length=380

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRVPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>ref|NP_001105365.1| guanine nucleotide-binding protein subunit beta [Zea mays]
 sp|P49178.1|GBB_MAIZE RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Zea mays]
 gb|AAA50446.1| GTP binding protein beta subunit [Zea mays]
 tpg|DAA50558.1| TPA: guanine nucleotide-binding protein subunit beta [Zea mays]
Length=380

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRVPVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>gb|AIO11832.1| heterotrimeric G-protein beta subunit 2 [Brassica rapa]
Length=378

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 152/177 (86%), Gaps = 1/177 (1%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT TVN+LR++L ++RL LLDTDVA Y   QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDKLIQRRLQLLDTDVAKYTAGQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKV+SLDWTPE NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  120

Query  489  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGG L+SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLIT S
Sbjct  121  TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITGS  177



>ref|XP_009381288.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MS +ELK+RH+AAT TVN+LR+RL +KR  LLDTDVA YA+SQG+T ++F  TDLVCCR 
Sbjct  1    MSFSELKDRHVAATATVNTLRDRLNQKRQQLLDTDVAGYAKSQGRTAVNFSSTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLI+WNALTSQKTHAIKLPCAWVMTCAF+P G 
Sbjct  61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIIWNALTSQKTHAIKLPCAWVMTCAFAPNGH  120

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+C++V ++D  LIT S
Sbjct  121  SVACGGLDSECSIFNLNSQVDRDGNIPVSRVLTGHKGYVSSCEFVRDQDTRLITGS  176



>ref|NP_001078491.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86382.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=372

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 5/176 (3%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR++L+++RL LLDTD A     QG+T +SFG TDLVCCR 
Sbjct  1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDAA-----QGRTRVSFGATDLVCCRT  55

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  56   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  115

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  116  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  171



>gb|ADL27745.1| G protein beta subunit [Oryza sativa Indica Group]
Length=380

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R +LLDTDV  Y+R+QG+TP+SF PTDLVCCR  
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTP  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSS
Sbjct  123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSS  177



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT+TVN+LR+RL+++RL LLDTDV+ Y+ +QG++P+ FG TDLVCCR 
Sbjct  515  MSVSELKERHAVATETVNNLRDRLRQRRLQLLDTDVSKYSAAQGRSPVKFGATDLVCCRT  574

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            L GHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct  575  LLGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ  634

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGGLDSVCSIF+L+   D DG   VSRTLSGH+GYVS CQYVPNEDAHLITSS
Sbjct  635  TVACGGLDSVCSIFSLSSTADKDGTVPVSRTLSGHRGYVSCCQYVPNEDAHLITSS  690



>ref|XP_009416784.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009416785.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=385

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 6/182 (3%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AAT TVNSLRERLK+++ LL+DTD+A Y RSQG++ ISFG TDLVCCR 
Sbjct  1    MSVAELKERHIAATATVNSLRERLKQRQQLLVDTDMAAYGRSQGRSAISFGSTDLVCCRT  60

Query  309  LQGHTGK------VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCA  470
            LQGHTGK      VYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKL C WV+TCA
Sbjct  61   LQGHTGKFQDICQVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLQCPWVVTCA  120

Query  471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT  650
            F+P GQSVACGGL+S CSIFNLN   D DGN  VS+ L+GHKGYV +CQYVP+++  LIT
Sbjct  121  FAPNGQSVACGGLNSACSIFNLNSQVDRDGNIPVSQILTGHKGYVYSCQYVPDQETRLIT  180

Query  651  SS  656
            SS
Sbjct  181  SS  182



>gb|EMT27863.1| hypothetical protein F775_27280 [Aegilops tauschii]
Length=364

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNL+   D DGN  VSR L+GHKGYVS+CQYVP+++  LIT S
Sbjct  123  VACGGLDSACSIFNLSSQADRDGNMPVSRVLTGHKGYVSSCQYVPDQETRLITGS  177



>pdb|3J60|GG Chain g, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC10503.1| G protein beta subunit [Triticum aestivum]
Length=380

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKE+H AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF PTDLVCCR L
Sbjct  3    SVAELKEKHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNPTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMECAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNL+   D DGN  VSR L+GHKGY S+CQYVP+++  LIT S
Sbjct  123  VACGGLDSACSIFNLSSQADRDGNMPVSRVLTGHKGYASSCQYVPDQETRLITGS  177



>ref|XP_003561442.1| PREDICTED: guanine nucleotide-binding protein subunit beta [Brachypodium 
distachyon]
Length=380

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVA+LKE+H AAT +VNSLRERL+++R LLLDTDV  Y+++QG+T +SF  TDLVCCR L
Sbjct  3    SVADLKEKHAAATASVNSLRERLRQRRQLLLDTDVERYSKAQGRTAVSFNQTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LIT S
Sbjct  123  VACGGLDSACSIFNLNSQVDRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITGS  177



>ref|XP_010526923.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Tarenaya hassleriana]
Length=250

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  261  KTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK  440
            +TP+SF PTDLVCCR LQGHTGKVYSLDWTPE+N IVSASQDGRL+VWNALTSQKTHAIK
Sbjct  3    RTPVSFEPTDLVCCRTLQGHTGKVYSLDWTPERNWIVSASQDGRLVVWNALTSQKTHAIK  62

Query  441  LPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQY  620
            LPCAWVM CAFSPTGQSVACGGLDSVCSIFNLN   D DGN  VSR LSGHKGYVS CQY
Sbjct  63   LPCAWVMACAFSPTGQSVACGGLDSVCSIFNLNSTTDKDGNIPVSRMLSGHKGYVSCCQY  122

Query  621  VPNEDAHLITSS  656
            +PNED HLITSS
Sbjct  123  IPNEDTHLITSS  134



>gb|EEE63415.1| hypothetical protein OsJ_18227 [Oryza sativa Japonica Group]
Length=350

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW  404
            DTDV  Y+R+QG+TP+SF PTDLVCCR LQGH+GKVYSLDWTPEKN IVSASQDGRLIVW
Sbjct  4    DTDVERYSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVW  63

Query  405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL  584
            NALTSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNLN   D DGN  VSR L
Sbjct  64   NALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRIL  123

Query  585  SGHKGYVSACQYVPNEDAHLITSS  656
            +GHKGYVS+CQYVP+++  LITSS
Sbjct  124  TGHKGYVSSCQYVPDQETRLITSS  147



>gb|AAC39373.1| G protein beta subunit [Avena fatua]
Length=380

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  132  SVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNL  311
            SVAELKERH AAT +VNSLRERL+++R  LLDTDV  Y+++QG+T +SF  TDLVCCR L
Sbjct  3    SVAELKERHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNQTDLVCCRTL  62

Query  312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS  491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WV+TCAF+P GQS
Sbjct  63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVITCAFAPNGQS  122

Query  492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            VACGGL+S CSIFNLN   D +GN  VS+ L+G KGYV +CQYVP+++  +IT S
Sbjct  123  VACGGLNSACSIFNLNSQVDRNGNMPVSKLLTGPKGYVLSCQYVPDQETRMITGS  177



>emb|CAN73515.1| hypothetical protein VITISV_027042 [Vitis vinifera]
Length=366

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 147/176 (84%), Gaps = 11/176 (6%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERHMAAT+TVNSLRERLK+KRLLLLDTDVA YAR+QGK+P++FGPTDLVCCR 
Sbjct  1    MSVAELKERHMAATETVNSLRERLKQKRLLLLDTDVAGYARAQGKSPVTFGPTDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNAL   +            +C  +  GQ
Sbjct  61   LQGHTGKVYSLDWTTEKNRIVSASQDGRLIVWNALNKPEN-----------SCHKAAFGQ  109

Query  489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            SVACGGLDSVCSIFNLN P D DGN  +S+ LSGHKGYVS+CQYVP+ED HLITSS
Sbjct  110  SVACGGLDSVCSIFNLNSPTDKDGNLAISKMLSGHKGYVSSCQYVPDEDTHLITSS  165



>ref|XP_010935070.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X4 [Elaeis guineensis]
Length=376

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 151/221 (68%), Gaps = 45/221 (20%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  309  LQGHTGKVY---------------------------------------------SLDWTP  353
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  354  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  533
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  534  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSS  221



>ref|XP_010935068.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X2 [Elaeis guineensis]
Length=390

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 151/221 (68%), Gaps = 45/221 (20%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  309  LQGHTGKVY---------------------------------------------SLDWTP  353
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  354  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  533
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  534  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSS  221



>ref|XP_010935067.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
isoform X1 [Elaeis guineensis]
Length=428

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 151/221 (68%), Gaps = 45/221 (20%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSVAELKERH+AA  TVN LRERLK++R  LLDTDV  YA+S GKT IS G TDLVCCR 
Sbjct  1    MSVAELKERHIAAKATVNGLRERLKQRRQALLDTDVVGYAKSHGKTAISLGSTDLVCCRT  60

Query  309  LQGHTGKVY---------------------------------------------SLDWTP  353
            +QGHTGKVY                                             SLDW P
Sbjct  61   MQGHTGKVYVRIAELEKPDVMRKYRGKDVSNDCLSHNAHKKKCVKLSWFAAKVYSLDWAP  120

Query  354  EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFN  533
            E+NRIVSASQDGRLIVWNALTSQKTHAIKL CAWVMTCAF+P  QSVACGGLDS CSIFN
Sbjct  121  ERNRIVSASQDGRLIVWNALTSQKTHAIKLHCAWVMTCAFAPYSQSVACGGLDSACSIFN  180

Query  534  LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            LN   D DGN  +SR L+GHKGYVS+CQYVP++++ LITSS
Sbjct  181  LNSQVDRDGNIPISRILTGHKGYVSSCQYVPDQESRLITSS  221



>gb|EMS45783.1| Guanine nucleotide-binding protein subunit beta [Triticum urartu]
Length=1344

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  234   VATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL  413
             V  Y+++QG+T +SF PTDLVCCR LQGH+GKVYSLDWTPEKN IVSASQDGRLIVWNAL
Sbjct  1005  VEKYSKAQGRTAVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNAL  1064

Query  414   TSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGH  593
             TSQKTHAIKL C WVMTCAF+P GQSVACGGLDS CSIFNL+   D DGN  VSR L+GH
Sbjct  1065  TSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLSSQADRDGNMPVSRVLTGH  1124

Query  594   KGYVSACQYVPNEDAHLITSS  656
             KGYVS+CQYVP+++  LIT S
Sbjct  1125  KGYVSSCQYVPDQETRLITGS  1145



>ref|XP_009779362.1| PREDICTED: guanine nucleotide-binding protein subunit beta-2-like 
isoform X2 [Nicotiana sylvestris]
Length=337

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  330  VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGL  509
            VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP G SVACGGL
Sbjct  28   VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPFGHSVACGGL  87

Query  510  DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            DSVCSIFNLN P D +GN  +SR LSGHKGYVSACQYVP+E+ H+IT S
Sbjct  88   DSVCSIFNLNSPTDKEGNLPLSRMLSGHKGYVSACQYVPDEEGHMITGS  136



>ref|NP_849494.2| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
 gb|AEE86379.1| guanine nucleotide-binding protein subunit beta [Arabidopsis 
thaliana]
Length=315

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  327  KVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGG  506
            +VYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQSVACGG
Sbjct  5    QVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGG  64

Query  507  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            LDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSS
Sbjct  65   LDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSS  114



>emb|CDX76284.1| BnaA08g11160D [Brassica napus]
Length=344

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 124/177 (70%), Gaps = 31/177 (18%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH  AT TVN+LR++L ++RL LLDTDVA Y   QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAVATDTVNNLRDKLIQRRLQLLDTDVAKYTAGQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKV+SLDWTPE NRIVSASQDGRLI                              
Sbjct  61   LQGHTGKVHSLDWTPESNRIVSASQDGRLI------------------------------  90

Query  489  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGG L+SVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPNEDAHLITSS
Sbjct  91   TVACGGLLESVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNEDAHLITSS  147



>emb|CDY46247.1| BnaC03g66080D [Brassica napus]
Length=348

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 126/177 (71%), Gaps = 31/177 (18%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRN  308
            MSV+ELKERH AAT+TVN+LR+RL ++RL LLDTDVA Y  +QG++P+ FG TDLVCCR 
Sbjct  1    MSVSELKERHAAATETVNNLRDRLIQRRLQLLDTDVAKYTAAQGRSPVKFGATDLVCCRT  60

Query  309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ  488
            LQGHTGKV+SLDWT E NRIVSASQDGRLI                              
Sbjct  61   LQGHTGKVHSLDWTLESNRIVSASQDGRLI------------------------------  90

Query  489  SVACGG-LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            +VACGG LDSVCSIF+L+   D DG   VSR LSGHKGYVS C+YVPN+DAHLITSS
Sbjct  91   TVACGGLLDSVCSIFSLSSTADKDGTVPVSRMLSGHKGYVSCCRYVPNDDAHLITSS  147



>ref|XP_001753169.1| GPB1 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
 emb|CAD21857.2| putative heterotrimeric G protein beta subunit [Physcomitrella 
patens]
 gb|EDQ82210.1| GPB1 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
Length=377

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  129  MSVAE-LKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  305
            MSVA+ ++ER+  +   V SLRE+L EKR  LLDTD   +  +     ISF    +VC R
Sbjct  1    MSVADSVRERYEVSKAEVQSLREQLHEKRASLLDTDGGPFIPADFVVVISF--VFMVCVR  58

Query  306  NLQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
             LQGHTGK+YSLDW   E +RIVSASQDGRLIVWNA++SQKT+++KL CAWV   A SP 
Sbjct  59   TLQGHTGKIYSLDWAYRETSRIVSASQDGRLIVWNAISSQKTYSLKLACAWVKAAAISPG  118

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G +VACGGLD+VCSIFNL+  PD +GN  VS TL+GH GY+S+C+Y+P ++ H++TSS
Sbjct  119  GNTVACGGLDNVCSIFNLSSVPDKEGNLPVSGTLAGHTGYLSSCKYMPTQEKHIVTSS  176



>ref|XP_002967710.1| hypothetical protein SELMODRAFT_440157 [Selaginella moellendorffii]
 gb|EFJ31057.1| hypothetical protein SELMODRAFT_440157 [Selaginella moellendorffii]
Length=375

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 123/177 (69%), Gaps = 4/177 (2%)
 Frame = +3

Query  129  MSVAELKERHMAATQ-TVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCR  305
            M+V  + +R + A Q  V+ LR  L+  R  L DT +A YAR+ G+  I F        R
Sbjct  1    MAVNGVSQRDILAAQDEVDRLRSALQATRRRLQDTTLAEYARAHGRGDIGFAADRFKSRR  60

Query  306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  485
             L GHTGKVY+LDW+ E++ IVSASQDGRLIVWNA+TSQKTHAIKL C WVM CAFSP G
Sbjct  61   MLSGHTGKVYALDWS-ERDTIVSASQDGRLIVWNAMTSQKTHAIKLLCPWVMACAFSPDG  119

Query  486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            ++VACGGLD++ SIF L    D+ GN   S  L+GHKGY+S C+YVP + A ++TSS
Sbjct  120  ETVACGGLDNLVSIFRLR-SFDSTGNHAPSAVLTGHKGYISCCRYVPRK-AQILTSS  174



>ref|XP_002964323.1| hypothetical protein SELMODRAFT_142121 [Selaginella moellendorffii]
 gb|EFJ34656.1| hypothetical protein SELMODRAFT_142121 [Selaginella moellendorffii]
Length=375

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = +3

Query  225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW  404
            DT +A YAR+ G+  I F        R L GHTGKVY+LDW+ E++ IVSASQDGRLIVW
Sbjct  34   DTTLAEYARTHGRGDIGFAADRFKSRRMLSGHTGKVYALDWS-ERDTIVSASQDGRLIVW  92

Query  405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL  584
            NA+TSQKTHAIKL C WVM CAFSP G++VACGGLD++ SIF L    D+ GN   S  L
Sbjct  93   NAMTSQKTHAIKLLCPWVMACAFSPDGETVACGGLDNLVSIFRLR-SFDSTGNHAPSAVL  151

Query  585  SGHKGYVSACQYVPNEDAHLITSS  656
            +GHKGY+S C+YVP + A ++TSS
Sbjct  152  TGHKGYISCCRYVPRK-AQVLTSS  174



>ref|XP_001757493.1| GPB2 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
 gb|EDQ77550.1| GPB2 heterotrimeric G protein beta subunit protein [Physcomitrella 
patens]
Length=252

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +3

Query  330  VYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGG  506
            +YSLDW   E +RIVS SQDGRLIVWNA++SQKTH+ KL CAWVM  A SP+G +VACGG
Sbjct  12   IYSLDWAYRETSRIVSTSQDGRLIVWNAISSQKTHSFKLACAWVMAAAISPSGNTVACGG  71

Query  507  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            LD+VCSIFNL+  PD + N  VS TL+GH GY+S C+Y+P ++ H++TSS
Sbjct  72   LDNVCSIFNLSSAPDKEDNLPVSGTLTGHAGYLSCCKYIPTQEEHIVTSS  121



>gb|KEZ45296.1| hypothetical protein SAPIO_CDS2093 [Scedosporium apiospermum]
Length=359

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT + + A+ Q   PIS     +
Sbjct  4    QGPNDVSPEAMQARIQQARREAENLKDRIKRKKDELADTTLRSVAQ-QAHEPISKNQM-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            SP+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  +ITS
Sbjct  122  SPSGNYVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIITS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|KDE07792.1| guanine nucleotide-binding protein subunit beta [Microbotryum 
violaceum p1A1 Lamole]
 gb|KDE07793.1| guanine nucleotide-binding protein subunit beta, variant [Microbotryum 
violaceum p1A1 Lamole]
Length=346

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 115/177 (65%), Gaps = 11/177 (6%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  305
            MS  E++E+  AA +   +L+E+++ KR  L DT + + A      P I+  P      R
Sbjct  1    MSATEIQEKIAAARREAENLKEKIRAKREQLADTSLRSMAHEIDPLPRIAMRPR-----R  55

Query  306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  485
             L+GH  K+Y++ W+ +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G
Sbjct  56   TLKGHLAKIYAMHWSQDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSG  115

Query  486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
              VACGGLD+VCSI+NL      +G + V+R LS H GY+S C+++   D  ++TSS
Sbjct  116  NFVACGGLDNVCSIYNLR---SKEGTAKVARELSAHTGYLSCCRFL--NDRQVLTSS  167



>gb|EZF44104.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 100081]
Length=257

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>ref|XP_003017524.1| hypothetical protein ARB_04406 [Arthroderma benhamiae CBS 112371]
 gb|EFE36879.1| hypothetical protein ARB_04406 [Arthroderma benhamiae CBS 112371]
Length=240

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  5    RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  65   GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  117



>gb|EZF68383.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
soudanense CBS 452.61]
Length=260

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>gb|EZF25118.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR850]
Length=262

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>gb|EZF79069.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR1448]
Length=272

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>gb|EZF28331.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
interdigitale H6]
 gb|EZF54801.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 288.86]
 gb|EZF65419.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 289.86]
 gb|EZF97452.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum MR1459]
 gb|KDB28245.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum D6]
Length=275

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>gb|EZG11290.1| guanine nucleotide-binding protein subunit beta, partial [Trichophyton 
rubrum CBS 202.88]
Length=276

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>ref|XP_007807978.1| G protein beta subunit [Metarhizium acridum CQMa 102]
 gb|EFY92367.1| G protein beta subunit [Metarhizium acridum CQMa 102]
Length=294

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGAHDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTSLRVVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|EJU00042.1| guanine nucleotide binding protein beta subunit 2 [Dacryopinax 
sp. DJM-731 SS1]
Length=350

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R+L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+
Sbjct  57   RSLKGHLAKIYAMHWAQDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPS  116

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL   PD +G S V + LS H GY+S C+++  +D  ++TSS
Sbjct  117  GNFVACGGLDNICSIYNLRQRPDTNGKSNV-KELSAHTGYLSCCRFI--DDRKIVTSS  171



>gb|EFX00034.1| guanine nucleotide-binding protein beta subunit [Grosmannia clavigera 
kw1407]
Length=320

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>gb|KFG82472.1| G protein beta subunit [Metarhizium anisopliae]
Length=318

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGAHDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTSLRVVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_006693118.1| G protein beta subunit-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS20822.1| G protein beta subunit-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=359

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTKVARELSGHAGYLSCCRFI--NDRSIITSS  178



>gb|KEF53104.1| guanine nucleotide-binding protein subunit beta [Exophiala aquamarina 
CBS 119918]
Length=308

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_007595151.1| guanine nucleotide-binding protein subunit beta [Colletotrichum 
fioriniae PJ7]
 gb|ENH86503.1| guanine nucleotide-binding protein beta subunit [Colletotrichum 
orbiculare MAFF 240422]
 gb|EXF81240.1| guanine nucleotide-binding protein subunit beta [Colletotrichum 
fioriniae PJ7]
Length=359

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 120/183 (66%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG+  +S   ++ R   A +   +L++R+K K+  L DT + T A+ Q   PI   P + 
Sbjct  4    QGQNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRTVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     +G + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNYVACGGLDNICSIYNLN--QQREGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>emb|CCX14452.1| Similar to Guanine nucleotide-binding protein subunit beta; acc. 
no. O14435 [Pyronema omphalodes CBS 100304]
Length=346

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 118/174 (68%), Gaps = 8/174 (5%)
 Frame = +3

Query  135  VAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQ  314
            ++++++R  AA +   +L+ R+K K+  L D D+   A+   +T      T++   +NL+
Sbjct  1    MSDIQDRIAAARREAENLKARIKAKKEELADADLRQVAK---ETLEPLPRTNMKVRKNLK  57

Query  315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV  494
            GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  V
Sbjct  58   GHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNFV  117

Query  495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            ACGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  ACGGLDNICSVYNLST---RDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  166



>ref|XP_003655108.1| hypothetical protein THITE_2118396 [Thielavia terrestris NRRL 
8126]
 gb|AEO68772.1| hypothetical protein THITE_2118396 [Thielavia terrestris NRRL 
8126]
Length=359

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+SP+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYSPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QSRDGPTRVARELSGHAGYLSCCRFI--NDRTIITSS  178



>ref|XP_003663156.1| hypothetical protein MYCTH_2304670 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO57911.1| hypothetical protein MYCTH_2304670 [Myceliophthora thermophila 
ATCC 42464]
Length=359

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  125  GNFVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSIITSS  178



>gb|ENH75085.1| Guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. cubense race 1]
Length=367

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG + +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI   P + 
Sbjct  4    QGNSDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>ref|XP_004349142.1| guanine nucleotide-binding protein beta subunit [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91226.1| guanine nucleotide-binding protein beta subunit [Capsaspora owczarzaki 
ATCC 30864]
Length=341

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  279  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  458
            G   L   R L+GH  KVY++ W  ++ RIVSA+QDG+LI+W+A    K HAI L  +WV
Sbjct  42   GRIQLKNRRTLKGHLAKVYAMQWANDRRRIVSAAQDGKLIIWDAFKMHKHHAIALRSSWV  101

Query  459  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  638
            MTCA+SP+GQ VACGGLD+VC+++++    D    + + RTLSGH G++S C+++PNE  
Sbjct  102  MTCAYSPSGQFVACGGLDNVCTLYSIREGED----ARIYRTLSGHDGFISCCRFLPNE-R  156

Query  639  HLITSS  656
             +IT+S
Sbjct  157  QIITAS  162



>gb|EMT65914.1| Guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. cubense race 4]
Length=367

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG + +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI   P + 
Sbjct  4    QGNSDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>dbj|BAB69489.1| guanine nucleotide-binding protein beta subunit [Fusarium oxysporum]
 gb|AAO91808.1| G protein beta subunit [Fusarium oxysporum f. sp. lycopersici]
 dbj|BAE94377.1| G-protein beta-subunit [Fusarium sacchari]
 gb|EGU74780.1| hypothetical protein FOXB_14719 [Fusarium oxysporum Fo5176]
 emb|CCT73640.1| probable guanine nucleotide-binding protein beta subunit [Fusarium 
fujikuroi IMI 58289]
 gb|EWY85347.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
FOSC 3-a]
 gb|EWZ35795.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
Fo47]
 gb|EWZ96207.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. lycopersici MN25]
 gb|EXA37927.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. pisi HDV247]
 gb|EXK30053.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. melonis 26406]
 gb|EXK90182.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. raphani 54005]
 gb|EXL55333.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. radicis-lycopersici 26381]
 gb|EXL81855.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. conglutinans race 2 54008]
 gb|EXM05578.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. cubense tropical race 4 54006]
 gb|EXM27123.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. vasinfectum 25433]
Length=359

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG + +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI   P + 
Sbjct  4    QGNSDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>ref|XP_008597057.1| heterotrimeric G protein beta subunit [Beauveria bassiana ARSEF 
2860]
 gb|EJP67164.1| heterotrimeric G protein beta subunit [Beauveria bassiana ARSEF 
2860]
 gb|KGQ04726.1| Guanine nucleotide-binding protein subunit beta [Beauveria bassiana 
D1-5]
Length=359

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG+  +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGQNDVSPEAMQARIQQARREAENLKDRIKRKKDELADTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|AFJ79447.1| G protein beta subunit [Verticillium dahliae]
 gb|AHA86231.1| G protein beta subunit 1 [Verticillium dahliae]
Length=359

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            Q    +S   ++ R   A +   +L++R+K K+  L DT + + A+ Q   PI  G   +
Sbjct  4    QSPNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRSVAQ-QAHEPIPRGQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|ELQ39060.1| guanine nucleotide-binding protein subunit beta [Magnaporthe 
oryzae Y34]
 gb|ELQ66060.1| guanine nucleotide-binding protein subunit beta [Magnaporthe 
oryzae P131]
Length=359

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            Q   ++S   ++ R   A +   +L++R+K K+  L DT + T A+ Q   PI      +
Sbjct  4    QRSNEVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRTVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>emb|CCA67815.1| related to G-protein beta subunit Bpp1 [Piriformospora indica 
DSM 11827]
Length=349

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 110/177 (62%), Gaps = 8/177 (5%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  305
            MS  +++ER  +A +  +SL+E+++ K+    DT +   A      P I   P      R
Sbjct  1    MSANDIQERIASARREADSLKEKIRAKKEATADTSLRAMAAEVETLPRIVMKPR-----R  55

Query  306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  485
             L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G
Sbjct  56   ALKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSG  115

Query  486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
              VACGGLD++CSI+NL       G+   +R LS H GY+S C+++   D  ++TSS
Sbjct  116  NFVACGGLDNICSIYNLRSKEGGIGSVKGARELSAHSGYLSCCRFI--NDRQIVTSS  170



>dbj|BAC01165.1| heterotrimeric G-protein beta subunit [Magnaporthe grisea]
Length=359

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            Q   ++S   ++ R   A +   +L++R+K K+  L DT + T A+ Q   PI      +
Sbjct  4    QRSNEVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRTVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_001542437.1| guanine nucleotide-binding protein beta subunit [Histoplasma 
capsulatum NAm1]
 gb|EDN06005.1| guanine nucleotide-binding protein beta subunit [Histoplasma 
capsulatum NAm1]
Length=287

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFI--NDRRIITSS  172



>gb|AAL90861.1|AF484341_1 G-protein beta subunit [Sporothrix schenckii]
 gb|AAL90862.1|AF484342_1 G-protein beta subunit [Sporothrix schenckii]
 gb|ERT00727.1| guanine nucleotide-binding protein subunit beta [Sporothrix schenckii 
ATCC 58251]
 gb|KIH92156.1| guanine nucleotide binding protein (G protein), beta 1 [Sporothrix 
brasiliensis 5110]
Length=359

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            Q ++ +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PIS     +
Sbjct  4    QRQSDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRAVAQ-QAHEPISRNQM-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KPKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_009166447.1| hypothetical protein T265_13295, partial [Opisthorchis viverrini]
 gb|KER29817.1| hypothetical protein T265_13295, partial [Opisthorchis viverrini]
Length=165

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 86/118 (73%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct  5    RTLRGHLAKIYAMHWSTDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D+ ++TSS
Sbjct  65   GNYVACGGLDNICSIYNLKT---REGNVRVSRELPGHTGYLSCCRFI--DDSQIVTSS  117



>gb|KIE01589.1| G protein beta subunit, partial [Metarhizium majus ARSEF 297]
Length=359

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGAHDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTSLRVVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_009251519.1| hypothetical protein FPSE_00124 [Fusarium pseudograminearum CS3096]
 ref|XP_011321532.1| guanine nucleotide-binding protein subunit beta [Fusarium graminearum 
PH-1]
 gb|ABE67098.1| heterotrimeric G protein beta subunit [Fusarium verticillioides]
 gb|EKJ79670.1| hypothetical protein FPSE_00124 [Fusarium pseudograminearum CS3096]
 gb|ESU09033.1| guanine nucleotide-binding protein subunit beta [Fusarium graminearum 
PH-1]
 gb|EWG51237.1| guanine nucleotide-binding protein subunit beta [Fusarium verticillioides 
7600]
 gb|EYB32355.1| hypothetical protein FG05_04104 [Fusarium graminearum]
 emb|CEF79053.1| unnamed protein product [Fusarium graminearum]
Length=359

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 118/183 (64%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI   P + 
Sbjct  4    QGNNDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>ref|XP_003044802.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU39089.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=359

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG + +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI   P + 
Sbjct  4    QGPSDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>ref|XP_007818659.2| G protein beta subunit [Metarhizium robertsii ARSEF 23]
 gb|EXV06141.1| WD40 domain protein [Metarhizium robertsii]
 gb|EFZ02888.2| G protein beta subunit [Metarhizium robertsii ARSEF 23]
 gb|KID62286.1| G protein beta subunit, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID78356.1| G protein beta subunit, partial [Metarhizium brunneum ARSEF 3297]
 gb|KID92618.1| G protein beta subunit [Metarhizium guizhouense ARSEF 977]
Length=359

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGAHDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTSLRVVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|KHO01188.1| G protein beta subunit [Metarhizium album ARSEF 1941]
Length=359

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K ++  L DT +   A+ Q   PI      +
Sbjct  4    QGANDVSPEAMQTRIQQARREAETLKDRIKRRKDELSDTTLRVVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|KIL86703.1| hypothetical protein FAVG1_09959 [Fusarium avenaceum]
Length=362

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGNNDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|KHJ34880.1| putative guanine nucleotide-binding protein beta subunit [Erysiphe 
necator]
Length=355

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  61   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  120

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  121  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRSILTSS  174



>gb|KFH43953.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Acremonium chrysogenum ATCC 11550]
Length=359

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGANDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_002795766.1| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=347

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>emb|CAQ86900.1| G protein beta subunit [Acremonium chrysogenum]
Length=359

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGANDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_003712746.1| guanine nucleotide-binding protein subunit beta [Magnaporthe 
oryzae 70-15]
 gb|EHA52939.1| guanine nucleotide-binding protein subunit beta [Magnaporthe 
oryzae 70-15]
Length=346

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  52   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  111

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  112  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  165



>ref|XP_009656945.1| guanine nucleotide-binding protein subunit beta [Verticillium 
dahliae VdLs.17]
 gb|AEI74592.1| G protein beta subunit 1 [Verticillium dahliae]
 gb|EGY19487.1| guanine nucleotide-binding protein subunit beta [Verticillium 
dahliae VdLs.17]
Length=323

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 93/134 (69%), Gaps = 5/134 (4%)
 Frame = +3

Query  255  QGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHA  434
            Q   PI  G   +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HA
Sbjct  14   QAHEPIPRGQL-MKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHA  72

Query  435  IKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSAC  614
            I L  +WVMTCA++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C
Sbjct  73   IPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCC  130

Query  615  QYVPNEDAHLITSS  656
            +++   D  ++TSS
Sbjct  131  RFI--NDRSILTSS  142



>gb|EPE07329.1| heterotrimeric g-protein beta subunit [Ophiostoma piceae UAMH 
11346]
Length=358

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  64   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  123

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  124  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  177



>ref|XP_007797937.1| putative guanine nucleotide-binding protein subunit beta protein 
[Eutypa lata UCREL1]
 gb|EMR62949.1| putative guanine nucleotide-binding protein subunit beta protein 
[Eutypa lata UCREL1]
Length=359

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>ref|XP_009217034.1| guanine nucleotide-binding protein subunit beta [Gaeumannomyces 
graminis var. tritici R3-111a-1]
 gb|EJT81025.1| guanine nucleotide-binding protein subunit beta [Gaeumannomyces 
graminis var. tritici R3-111a-1]
Length=359

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>gb|EWY85348.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
FOSC 3-a]
 gb|EWZ35796.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
Fo47]
 gb|EWZ96208.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. lycopersici MN25]
 gb|EXA37928.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. pisi HDV247]
 gb|EXK30054.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. melonis 26406]
 gb|EXK90183.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. raphani 54005]
 gb|EXL55334.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. radicis-lycopersici 26381]
 gb|EXL81856.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. conglutinans race 2 54008]
 gb|EXM05579.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. cubense tropical race 4 54006]
 gb|EXM27124.1| guanine nucleotide-binding protein subunit beta [Fusarium oxysporum 
f. sp. vasinfectum 25433]
Length=299

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  5    RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  65   GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  118



>ref|XP_007832652.1| Guanine nucleotide-binding protein subunit beta [Pestalotiopsis 
fici W106-1]
 gb|ETS84004.1| Guanine nucleotide-binding protein subunit beta [Pestalotiopsis 
fici W106-1]
Length=359

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>ref|XP_007786191.1| Guanine nucleotide-binding protein subunit beta [Endocarpon pusillum 
Z07020]
 gb|ERF76491.1| Guanine nucleotide-binding protein subunit beta [Endocarpon pusillum 
Z07020]
Length=353

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 116/178 (65%), Gaps = 12/178 (7%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKT--PISFGPTDLVCC  302
            +S  +++ R  AA +    L++R+K K+  L DT ++  A S  +    I   P      
Sbjct  5    LSGEQMQARIQAARREAEGLKDRIKRKKDELADTSLSQVAHSSTEALPRIGMKPR-----  59

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHAGYLSCCRFI--NDRKILTSS  172



>gb|ADE20134.1| heterotrimeric G-protein beta subunit [Colletotrichum hanaui]
 emb|CCF35472.1| guanine nucleotide-binding protein subunit beta [Colletotrichum 
higginsianum]
Length=359

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTD-  290
            QG   +S   ++ R   A +   +L++R+K K+  L DT + T A+ Q   PI   P + 
Sbjct  4    QGPNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRTVAQ-QAHEPI---PKNQ  59

Query  291  -LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC  467
             +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTC
Sbjct  60   LMKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTC  119

Query  468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI  647
            A++P+G  VACGGLD++CSI+NLN     +G + V+R LSGH GY+S C+++   D  ++
Sbjct  120  AYAPSGNYVACGGLDNICSIYNLN--QQREGPTRVARELSGHAGYLSCCRFI--NDRSIL  175

Query  648  TSS  656
            TSS
Sbjct  176  TSS  178



>gb|EQK99388.1| G protein beta subunit [Ophiocordyceps sinensis CO18]
Length=359

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGANDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRAILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>sp|O14435.1|GBB_CRYPA RecName: Full=Guanine nucleotide-binding protein subunit beta 
[Cryphonectria parasitica]
 gb|AAC49838.1| GTP binding protein beta subunit [Cryphonectria parasitica]
Length=359

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>gb|KIM28934.1| hypothetical protein M408DRAFT_328991 [Serendipita vermifera 
MAFF 305830]
Length=349

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 111/177 (63%), Gaps = 8/177 (5%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCR  305
            MS  +++ER  +A +  +SL+E+++ K+    DT +   A      P I   P      R
Sbjct  1    MSANDIQERIASARREADSLKEKIRAKKEATADTSLRAMAGEVETLPRIVMKPR-----R  55

Query  306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG  485
            +L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G
Sbjct  56   SLKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSG  115

Query  486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
              VACGGLD++CSI+NL       G+   +R LS H GY+S C+++   D  ++TSS
Sbjct  116  NFVACGGLDNICSIYNLRSKEGGIGSVKGARELSAHSGYLSCCRFI--NDRQIVTSS  170



>ref|XP_007918102.1| putative guanine nucleotide-binding protein subunit beta protein 
[Togninia minima UCRPA7]
 gb|EON97102.1| putative guanine nucleotide-binding protein subunit beta protein 
[Togninia minima UCRPA7]
Length=362

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  68   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  127

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  128  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  181



>ref|XP_003002364.1| guanine nucleotide-binding protein subunit beta [Verticillium 
alfalfae VaMs.102]
 gb|EEY21713.1| guanine nucleotide-binding protein subunit beta [Verticillium 
alfalfae VaMs.102]
Length=324

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 93/134 (69%), Gaps = 5/134 (4%)
 Frame = +3

Query  255  QGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHA  434
            Q   PI  G   +   R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HA
Sbjct  15   QAHEPIPRGQL-MKAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHA  73

Query  435  IKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSAC  614
            I L  +WVMTCA++P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C
Sbjct  74   IPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCC  131

Query  615  QYVPNEDAHLITSS  656
            +++   D  ++TSS
Sbjct  132  RFI--NDRSILTSS  143



>gb|KIY03752.1| guanine nucleotide-binding protein subunit beta [Fonsecaea multimorphosa 
CBS 102226]
Length=384

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_003021074.1| hypothetical protein TRV_04826 [Trichophyton verrucosum HKI 0517]
 gb|EFE40456.1| hypothetical protein TRV_04826 [Trichophyton verrucosum HKI 0517]
Length=351

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>ref|XP_011117389.1| hypothetical protein AOL_s00004g438 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53779.1| hypothetical protein AOL_s00004g438 [Arthrobotrys oligospora 
ATCC 24927]
Length=348

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 116/173 (67%), Gaps = 8/173 (5%)
 Frame = +3

Query  138  AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQG  317
            ++L++R  AA +    L+E++K K+  L D D+   A+ Q +   +   T +   R L+G
Sbjct  3    SDLQDRITAARREAEGLKEKIKRKKDELADADLRQLAKEQVE---ALPRTLMKNRRTLKG  59

Query  318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  497
            H  K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  60   HLAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVA  119

Query  498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            CGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  120  CGGLDNICSVYNLSA---RDGPTRVARELSGHSGYLSCCRFL--NDRRILTSS  167



>gb|KDB20108.1| guanine nucleotide-binding protein subunit beta [Trichophyton 
interdigitale MR816]
Length=351

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  58   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  117

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  118  GNYVACGGLDNICSIYNLS---SRDGPTRVARELSGHSGYLSCCRFI--NDRRILTSS  170



>gb|EHL03873.1| putative Guanine nucleotide-binding protein subunit beta [Glarea 
lozoyensis 74030]
Length=342

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 114/171 (67%), Gaps = 6/171 (4%)
 Frame = +3

Query  144  LKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQGHT  323
            +++R   A +   SL++R+K K+  L D+ ++  ARSQ +       T +   + L+GH 
Sbjct  13   MQQRIQQARREAESLKDRIKRKKDDLADSTLSNIARSQQEALPK--NTMMKIKKTLKGHL  70

Query  324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG  503
             K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VACG
Sbjct  71   AKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVACG  130

Query  504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            GLD++CSI+NLN     DG   V+R LSGH GY+S C++V   D  ++TSS
Sbjct  131  GLDNICSIYNLNQA--RDGPQKVARELSGHSGYLSCCRFV--NDRVILTSS  177



>ref|XP_010760821.1| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH49542.2| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH22750.2| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
brasiliensis Pb03]
Length=351

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>gb|EEH40417.2| guanine nucleotide-binding protein subunit beta [Paracoccidioides 
sp. 'lutzii' Pb01]
Length=351

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>emb|CCE27519.1| probable guanine nucleotide-binding protein beta subunit [Claviceps 
purpurea 20.1]
Length=359

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGAHDVSPEAMQARIQQARREAETLKDRIKRKKDELSDTTLRVVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|AAZ42332.1| G protein beta subunit [Caenorhabditis remanei]
Length=165

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 95/144 (66%), Gaps = 9/144 (6%)
 Frame = +3

Query  225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW  404
            DT +AT A      PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW
Sbjct  27   DTTLATVA--SNLEPI--GRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVW  82

Query  405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL  584
            ++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L
Sbjct  83   DSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLK---TREGNVRVSREL  139

Query  585  SGHKGYVSACQYVPNEDAHLITSS  656
             GH GY+S C+++  +D  ++TSS
Sbjct  140  PGHTGYLSCCRFL--DDNQIVTSS  161



>ref|XP_001229630.1| guanine nucleotide-binding protein beta subunit [Chaetomium globosum 
CBS 148.51]
 gb|EAQ91179.1| guanine nucleotide-binding protein beta subunit [Chaetomium globosum 
CBS 148.51]
Length=346

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  52   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  111

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  112  GNFVACGGLDNICSIYNLN--QSRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  165



>gb|EEQ90059.1| small G-beta protein GPB [Blastomyces dermatitidis ER-3]
 gb|EGE83688.1| guanine nucleotide-binding protein subunit beta [Blastomyces 
dermatitidis ATCC 18188]
Length=352

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>gb|KIX08259.1| guanine nucleotide-binding protein subunit beta [Rhinocladiella 
mackenziei CBS 650.93]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|ADN95999.1| GTP binding protein beta subunit [Ustilaginoidea virens]
Length=359

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>ref|XP_002621970.1| small G-beta protein GPB [Blastomyces dermatitidis SLH14081]
 gb|EEQ73595.1| small G-beta protein GPB [Blastomyces dermatitidis SLH14081]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>ref|XP_007740645.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ75143.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
psammophila CBS 110553]
Length=361

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_006963580.1| heterotrimeric G protein, beta subunit [Trichoderma reesei QM6a]
 gb|EGR50145.1| heterotrimeric G protein, beta subunit [Trichoderma reesei QM6a]
 gb|EHK19795.1| heterotrimeric G-protein beta subunit [Trichoderma virens Gv29-8]
 gb|ETS03776.1| heterotrimeric G protein beta subunit TGB1 [Trichoderma reesei 
RUT C-30]
Length=358

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  64   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  123

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  124  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  177



>ref|XP_007721690.1| guanine nucleotide-binding protein subunit beta [Capronia coronata 
CBS 617.96]
 gb|EXJ94196.1| guanine nucleotide-binding protein subunit beta [Capronia coronata 
CBS 617.96]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|KIW85998.1| guanine nucleotide-binding protein subunit beta [Fonsecaea pedrosoi 
CBS 271.37]
Length=389

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|KIV87521.1| guanine nucleotide-binding protein subunit beta [Exophiala sideris]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_007760803.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
yegresii CBS 114405]
 gb|EXJ55693.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
yegresii CBS 114405]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|EHK46560.1| heterotrimeric G protein beta subunit [Trichoderma atroviride 
IMI 206040]
Length=358

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  64   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  123

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  124  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  177



>gb|AAO37685.1| heterotrimeric G protein beta subunit TGB1 [Trichoderma atroviride]
Length=358

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  64   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  123

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  124  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  177



>gb|KIW33780.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
immunda]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>dbj|BAJ94652.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|KIV92928.1| guanine nucleotide-binding protein subunit beta [Exophiala mesophila]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_007733470.1| guanine nucleotide-binding protein subunit beta [Capronia epimyces 
CBS 606.96]
 ref|XP_009153110.1| guanine nucleotide-binding protein subunit beta [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52649.1| guanine nucleotide-binding protein subunit beta [Exophiala dermatitidis 
NIH/UT8656]
 gb|EXJ84485.1| guanine nucleotide-binding protein subunit beta [Capronia epimyces 
CBS 606.96]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|ADB12512.1| GTP binding protein beta subunit [Ustilaginoidea virens]
Length=359

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>gb|AAT40565.1| small G-beta protein GPB [Paracoccidioides brasiliensis]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>ref|XP_008730131.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
carrionii CBS 160.54]
 gb|ETI21250.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
carrionii CBS 160.54]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_008712871.1| guanine nucleotide-binding protein subunit beta [Cyphellophora 
europaea CBS 101466]
 gb|ETN45101.1| guanine nucleotide-binding protein subunit beta [Cyphellophora 
europaea CBS 101466]
Length=353

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNFVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_001239616.1| guanine nucleotide-binding protein beta subunit [Coccidioides 
immitis RS]
 gb|EFW19410.1| guanine nucleotide-binding protein beta subunit [Coccidioides 
posadasii str. Silveira]
 gb|EAS28033.3| guanine nucleotide-binding protein subunit beta [Coccidioides 
immitis RS]
Length=349

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  56   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  115

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  116  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHSGYLSCCRFI--NDRRIITSS  168



>gb|KIW11996.1| guanine nucleotide-binding protein subunit beta [Exophiala spinifera]
Length=351

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_008946720.1| PREDICTED: guanine nucleotide-binding protein G(I)/G(S)/G(T) 
subunit beta-3, partial [Merops nubicus]
Length=165

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +3

Query  279  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV  458
            G   +   R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WV
Sbjct  41   GRIQMRTRRTLRGHLAKIYAMHWSTDSKLMVSASQDGKLIVWDTYTTNKVHAIPLRSSWV  100

Query  459  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA  638
            MTCA++P+G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D 
Sbjct  101  MTCAYAPSGNFVACGGLDNMCSIYNL---KTREGNVKVSRELSAHTGYLSCCRFL--DDN  155

Query  639  HLITSS  656
            +++TSS
Sbjct  156  NIVTSS  161



>ref|XP_001908013.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68686.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP32156.1| Putative guanine nucleotide-binding protein subunit beta [Podospora 
anserina S mat+]
Length=359

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNYVACGGLDNICSIYNLN--QSRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>ref|XP_003067194.1| Guanine nucleotide-binding protein beta subunit, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER25049.1| Guanine nucleotide-binding protein beta subunit, putative [Coccidioides 
posadasii C735 delta SOWgp]
Length=372

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  56   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  115

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  116  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHSGYLSCCRFI--NDRRIITSS  168



>ref|XP_011107440.1| hypothetical protein H072_1448 [Dactylellina haptotyla CBS 200.50]
 gb|EPS44559.1| hypothetical protein H072_1448 [Dactylellina haptotyla CBS 200.50]
Length=347

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 116/173 (67%), Gaps = 8/173 (5%)
 Frame = +3

Query  138  AELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQG  317
            ++L++R  AA +    L+E++K K+  L D D+   A+ Q +   +   T +   + L+G
Sbjct  3    SDLQDRITAARREAEGLKEKIKRKKDELADADLRQLAKDQVE---ALPRTHMKQRKTLKG  59

Query  318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  497
            H  K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VA
Sbjct  60   HLAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVA  119

Query  498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            CGGLD++CS++NL+     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  120  CGGLDNICSVYNLSA---RDGPTRVARELSGHSGYLSCCRFL--NDRRILTSS  167



>gb|KIW60360.1| guanine nucleotide-binding protein subunit beta [Exophiala xenobiotica]
Length=353

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|EQL27839.1| guanine nucleotide-binding protein subunit beta [Blastomyces 
dermatitidis ATCC 26199]
Length=353

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFV--NDRRIITSS  172



>ref|XP_008084030.1| WD40 repeat-like protein [Glarea lozoyensis ATCC 20868]
 gb|EPE29921.1| WD40 repeat-like protein [Glarea lozoyensis ATCC 20868]
Length=358

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 114/171 (67%), Gaps = 6/171 (4%)
 Frame = +3

Query  144  LKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQGHT  323
            +++R   A +   SL++R+K K+  L D+ ++  ARSQ +       T +   + L+GH 
Sbjct  13   MQQRIQQARREAESLKDRIKRKKDDLADSTLSNIARSQQEALPK--NTMMKIKKTLKGHL  70

Query  324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG  503
             K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VACG
Sbjct  71   AKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVACG  130

Query  504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            GLD++CSI+NLN     DG   V+R LSGH GY+S C++V   D  ++TSS
Sbjct  131  GLDNICSIYNLNQA--RDGPQKVARELSGHSGYLSCCRFV--NDRVILTSS  177



>gb|EER38890.1| small G-beta protein GPB [Histoplasma capsulatum H143]
Length=298

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  5    RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  64

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  65   GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFI--NDRRIITSS  117



>gb|KIW64254.1| guanine nucleotide-binding protein subunit beta [Capronia semiimmersa]
Length=353

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>gb|KIW40198.1| guanine nucleotide-binding protein subunit beta [Exophiala oligosperma]
Length=353

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  172



>ref|XP_002584356.1| guanine nucleotide-binding protein beta subunit [Uncinocarpus 
reesii 1704]
 gb|EEP80203.1| guanine nucleotide-binding protein beta subunit [Uncinocarpus 
reesii 1704]
Length=362

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  56   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  115

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  116  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHAGYLSCCRFI--NDRRIITSS  168



>ref|XP_001398668.1| guanine nucleotide-binding protein subunit beta [Aspergillus 
niger CBS 513.88]
 emb|CAK47281.1| unnamed protein product [Aspergillus niger]
 gb|EHA18891.1| guanine nucleotide-binding protein beta subunit [Aspergillus 
niger ATCC 1015]
Length=352

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 117/178 (66%), Gaps = 12/178 (7%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKT--PISFGPTDLVCC  302
            MS  +++ +  AA +    L++++K ++  L DT +   A++Q +T   I   P      
Sbjct  4    MSGEQMQAKITAARREAEGLKDKIKRRKDELADTTLRQVAQNQTETLPRIGMKPR-----  58

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  59   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  118

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  119  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHSGYLSCCRFI--NDRRIITSS  171



>gb|EWC48535.1| guanine nucleotide-binding protein subunit beta [Drechslerella 
stenobrocha 248]
Length=347

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 114/172 (66%), Gaps = 8/172 (5%)
 Frame = +3

Query  141  ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDLVCCRNLQGH  320
            +L++R   A +    L++++K K+  L D D+   A+ Q +   +   T++   R L+GH
Sbjct  4    DLQDRISQARREAEGLKDKIKRKKDELADADMRQLAKEQVE---ALPRTNMKNRRTLKGH  60

Query  321  TGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVAC  500
              K+YS+ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+G  VAC
Sbjct  61   LAKIYSMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSGNYVAC  120

Query  501  GGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            GGLD++CS++NL      DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  121  GGLDNICSVYNL---AARDGPTRVARELSGHSGYLSCCRFL--NDRRILTSS  167



>ref|XP_003146986.1| hypothetical protein LOAG_11417 [Loa loa]
Length=165

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +3

Query  276  FGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW  455
             G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +W
Sbjct  40   IGRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSW  99

Query  456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED  635
            VMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D
Sbjct  100  VMTCAYAPSGSYVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DD  154

Query  636  AHLITSS  656
              ++TSS
Sbjct  155  NQIVTSS  161



>gb|EEH10050.1| small G-beta protein GPB [Histoplasma capsulatum G186AR]
 gb|EGC44524.1| small G-beta protein GPB [Histoplasma capsulatum H88]
Length=353

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHTGYLSCCRFI--NDRRIITSS  172



>ref|XP_007280702.1| guanine nucleotide-binding protein beta subunit [Colletotrichum 
gloeosporioides Nara gc5]
 gb|ELA30254.1| guanine nucleotide-binding protein beta subunit [Colletotrichum 
gloeosporioides Nara gc5]
 gb|EQB48520.1| hypothetical protein CGLO_12243 [Colletotrichum gloeosporioides 
Cg-14]
Length=359

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            Q +  +S   ++ R   A +   +L++R+K K+  L DT + T A+ Q   PI      +
Sbjct  4    QSQNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRTVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     +G + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QQREGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>emb|CCU75200.1| G-protein beta subunit [Blumeria graminis f. sp. hordei DH14]
Length=361

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  61   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  120

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  121  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRSILTSS  174



>gb|KIW98040.1| guanine nucleotide-binding protein subunit beta [Cladophialophora 
bantiana CBS 173.52]
Length=383

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            RNL+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  90   RNLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  149

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C++V   D  +ITSS
Sbjct  150  GNYVACGGLDNICSIYNLST---REGPTRVARELSGHSGYLSCCRFV--NDRKIITSS  202



>gb|KEY64274.1| hypothetical protein S7711_09313 [Stachybotrys chartarum IBT 
7711]
 gb|KFA47266.1| hypothetical protein S40293_05472 [Stachybotrys chartarum IBT 
40293]
 gb|KFA61965.1| hypothetical protein S40285_07793 [Stachybotrys chlorohalonata 
IBT 40285]
 gb|KFA77515.1| hypothetical protein S40288_04233 [Stachybotrys chartarum IBT 
40288]
Length=359

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT + + A+ Q   PI      +
Sbjct  4    QGPNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRSVAQ-QAHEPIPRNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KTKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     +G + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QQREGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>gb|EPQ65165.1| G protein beta subunit [Blumeria graminis f. sp. tritici 96224]
Length=361

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  61   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  120

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  121  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRSILTSS  174



>ref|XP_001595393.1| guanine nucleotide-binding protein beta subunit [Sclerotinia 
sclerotiorum 1980]
 gb|EDO01008.1| guanine nucleotide-binding protein beta subunit [Sclerotinia 
sclerotiorum 1980 UF-70]
Length=356

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  62   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  121

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  122  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRAILTSS  175



>dbj|BAD93278.1| G protein beta subunit [Botrytis cinerea]
 emb|CCD33962.1| BcGB1, heterotrimeric Gbeta subunit [Botrytis cinerea T4]
 gb|EMR90491.1| putative guanine nucleotide-binding protein beta subunit protein 
[Botrytis cinerea BcDW1]
Length=358

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  64   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  123

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  124  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRSILTSS  177



>gb|ESZ96322.1| guanine nucleotide-binding protein beta subunit [Sclerotinia 
borealis F-4157]
Length=360

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  66   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  125

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  126  GNYVACGGLDNICSIYNLN--SNRDGPTRVARELSGHSGYLSCCRFI--NDRSILTSS  179



>gb|KDB16485.1| G protein beta subunit [Ustilaginoidea virens]
Length=409

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = +3

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  124

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSS
Sbjct  125  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSS  178



>gb|KIK07337.1| hypothetical protein K443DRAFT_673598 [Laccaria amethystina LaAM-08-1]
Length=349

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 111/174 (64%), Gaps = 12/174 (7%)
 Frame = +3

Query  141  ELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTP-ISFGPTDLVCCRNLQG  317
            +++ER  AA +   SL+E+++ KR    DT +   A      P I   P      R L+G
Sbjct  7    DIQERIAAARREAESLKEKIRAKRESSADTSLRAMAAEVDALPRIVMRPR-----RALRG  61

Query  318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA  497
            H  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+G  VA
Sbjct  62   HLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPSGNFVA  121

Query  498  CGGLDSVCSIFNLNLPPDNDG-NSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            CGGLD++CSI+NLN   + DG N+  +R LS H GY+S C+++   D  ++TSS
Sbjct  122  CGGLDNICSIYNLN---NKDGANAKGARELSAHSGYLSCCRFIS--DRQIVTSS  170



>gb|KDN68001.1| putative guanine nucleotide-binding protein subunit beta [Colletotrichum 
sublineola]
Length=359

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 116/181 (64%), Gaps = 6/181 (3%)
 Frame = +3

Query  114  QGKTKMSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKTPISFGPTDL  293
            QG   +S   ++ R   A +   +L++R+K K+  L DT +   A+ Q   PI      +
Sbjct  4    QGPNDVSPEAMQARIQQARREAETLKDRIKRKKDELADTTLRAVAQ-QAHEPIPKNQL-M  61

Query  294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF  473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct  62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY  121

Query  474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS  653
            +P+G  VACGGLD++CSI+NLN     +G + V+R LSGH GY+S C+++   D  ++TS
Sbjct  122  APSGNYVACGGLDNICSIYNLN--QQREGPTRVARELSGHAGYLSCCRFI--NDRSILTS  177

Query  654  S  656
            S
Sbjct  178  S  178



>ref|XP_001824062.1| guanine nucleotide-binding protein subunit beta [Aspergillus 
oryzae RIB40]
 ref|XP_002381144.1| G-protein complex beta subunit SfaD [Aspergillus flavus NRRL3357]
 dbj|BAE62929.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED49243.1| G-protein complex beta subunit SfaD [Aspergillus flavus NRRL3357]
 gb|EIT82211.1| G-protein beta subunit [Aspergillus oryzae 3.042]
 gb|KDE85784.1| G-protein [Aspergillus oryzae 100-8]
Length=353

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 116/178 (65%), Gaps = 12/178 (7%)
 Frame = +3

Query  129  MSVAELKERHMAATQTVNSlrerlkekrllllDTDVATYARSQGKT--PISFGPTDLVCC  302
            MS  +++ +  AA +    L++R+K ++  L DT +   A++Q  T   I   P      
Sbjct  5    MSGEQMQAKITAARREAEGLKDRIKRRKDELADTTLRQVAQNQTDTLPRIGMKPR-----  59

Query  303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT  482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct  60   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS  119

Query  483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS  656
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSS
Sbjct  120  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHSGYLSCCRFI--NDRRIITSS  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500