BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028G17

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN79509.1|  hypothetical protein VITISV_038336                     126   7e-31   Vitis vinifera
ref|XP_004245125.1|  PREDICTED: protein EARLY FLOWERING 3-like          129   1e-30   Solanum lycopersicum
ref|XP_010049159.1|  PREDICTED: protein EARLY FLOWERING 3               127   5e-30   Eucalyptus grandis [rose gum]
gb|KDP34132.1|  hypothetical protein JCGZ_07703                         127   9e-30   Jatropha curcas
ref|XP_006355312.1|  PREDICTED: protein EARLY FLOWERING 3-like          126   1e-29   
ref|XP_002278577.1|  PREDICTED: protein EARLY FLOWERING 3               126   2e-29   
emb|CBI20609.3|  unnamed protein product                                125   2e-29   Vitis vinifera
ref|XP_009629368.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    123   8e-29   Nicotiana tomentosiformis
ref|XP_009629366.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    124   1e-28   Nicotiana tomentosiformis
ref|XP_002516480.1|  conserved hypothetical protein                     121   1e-27   Ricinus communis
emb|CDP08210.1|  unnamed protein product                                120   2e-27   Coffea canephora [robusta coffee]
gb|AIN75607.1|  EARLY FLOWERING 3                                       119   7e-27   Dimocarpus longan [longan]
gb|KHN29734.1|  Protein EARLY FLOWERING 3                               117   2e-26   Glycine soja [wild soybean]
gb|ACU18593.1|  unknown                                                 110   2e-26   Glycine max [soybeans]
ref|XP_006340248.1|  PREDICTED: protein EARLY FLOWERING 3-like          117   2e-26   Solanum tuberosum [potatoes]
ref|XP_011095302.1|  PREDICTED: protein EARLY FLOWERING 3-like          117   2e-26   Sesamum indicum [beniseed]
ref|XP_009594922.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    115   7e-26   Nicotiana tomentosiformis
ref|XP_009784952.1|  PREDICTED: protein EARLY FLOWERING 3-like          115   8e-26   Nicotiana sylvestris
ref|XP_003523640.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    114   2e-25   Glycine max [soybeans]
ref|XP_009782254.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    113   3e-25   Nicotiana sylvestris
ref|XP_009782253.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    113   4e-25   Nicotiana sylvestris
ref|XP_007160974.1|  hypothetical protein PHAVU_001G032900g             114   4e-25   Phaseolus vulgaris [French bean]
ref|XP_004251173.1|  PREDICTED: protein EARLY FLOWERING 3-like          112   1e-24   Solanum lycopersicum
ref|XP_010244364.1|  PREDICTED: protein EARLY FLOWERING 3               112   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_003550290.1|  PREDICTED: protein EARLY FLOWERING 3-like          111   3e-24   Glycine max [soybeans]
ref|XP_011081715.1|  PREDICTED: LOW QUALITY PROTEIN: protein EARL...    110   4e-24   Sesamum indicum [beniseed]
ref|XP_011019541.1|  PREDICTED: protein EARLY FLOWERING 3               110   7e-24   Populus euphratica
ref|XP_006342510.1|  PREDICTED: protein EARLY FLOWERING 3-like          109   1e-23   Solanum tuberosum [potatoes]
gb|AFZ78447.1|  early flowering 3                                       108   2e-23   Lens culinaris
gb|KDO79983.1|  hypothetical protein CISIN_1g004928mg                   105   3e-23   Citrus sinensis [apfelsine]
ref|XP_010097101.1|  hypothetical protein L484_019540                   108   3e-23   Morus notabilis
gb|KDO79981.1|  hypothetical protein CISIN_1g004928mg                   105   3e-23   Citrus sinensis [apfelsine]
gb|KDO79980.1|  hypothetical protein CISIN_1g004928mg                   105   3e-23   Citrus sinensis [apfelsine]
ref|XP_002309522.1|  EARLY FLOWERING 3 family protein                   108   3e-23   
gb|KDO79982.1|  hypothetical protein CISIN_1g004928mg                   105   4e-23   Citrus sinensis [apfelsine]
ref|XP_008797900.1|  PREDICTED: protein EARLY FLOWERING 3               107   5e-23   Phoenix dactylifera
gb|KJB07439.1|  hypothetical protein B456_001G024100                    106   1e-22   Gossypium raimondii
gb|AFR60580.1|  early flowering 3/high response                         106   1e-22   Pisum sativum subsp. sativum
ref|XP_010669115.1|  PREDICTED: protein EARLY FLOWERING 3               106   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400544.1|  PREDICTED: protein EARLY FLOWERING 3-like          106   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009594920.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    105   2e-22   Nicotiana tomentosiformis
ref|XP_003603108.1|  Protein EARLY FLOWERING                            104   5e-22   Medicago truncatula
gb|AAQ73529.1|  early flowering 3                                       104   6e-22   Mesembryanthemum crystallinum
gb|KDO79979.1|  hypothetical protein CISIN_1g004928mg                   104   7e-22   Citrus sinensis [apfelsine]
ref|XP_006475975.1|  PREDICTED: protein EARLY FLOWERING 3-like          104   7e-22   Citrus sinensis [apfelsine]
ref|XP_006450775.1|  hypothetical protein CICLE_v10007592mg             104   7e-22   Citrus clementina [clementine]
gb|KHF99548.1|  Protein EARLY FLOWERING 3 -like protein                 104   7e-22   Gossypium arboreum [tree cotton]
ref|XP_008220435.1|  PREDICTED: protein EARLY FLOWERING 3               104   7e-22   Prunus mume [ume]
gb|KJB07438.1|  hypothetical protein B456_001G024000                    103   1e-21   Gossypium raimondii
ref|XP_004253100.1|  PREDICTED: protein EARLY FLOWERING 3               103   2e-21   Solanum lycopersicum
ref|XP_010924961.1|  PREDICTED: protein EARLY FLOWERING 3-like          103   2e-21   Elaeis guineensis
gb|KHG06245.1|  Protein EARLY FLOWERING 3 -like protein                 102   3e-21   Gossypium arboreum [tree cotton]
ref|XP_010915307.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    102   4e-21   Elaeis guineensis
gb|AAM97051.1|  unknown protein                                       99.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008807710.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    102   5e-21   
gb|KJB35029.1|  hypothetical protein B456_006G096400                    102   5e-21   Gossypium raimondii
gb|KJB56855.1|  hypothetical protein B456_009G138600                    102   5e-21   Gossypium raimondii
ref|XP_008806826.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    102   6e-21   Phoenix dactylifera
ref|XP_008806834.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    102   6e-21   Phoenix dactylifera
ref|XP_004291013.1|  PREDICTED: protein EARLY FLOWERING 3               101   6e-21   Fragaria vesca subsp. vesca
ref|XP_010910484.1|  PREDICTED: protein EARLY FLOWERING 3               100   1e-20   Elaeis guineensis
ref|XP_007012227.1|  Hydroxyproline-rich glycoprotein family prot...    100   1e-20   
gb|KHN17209.1|  Protein EARLY FLOWERING 3                               100   2e-20   Glycine soja [wild soybean]
ref|XP_004501482.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  98.6    7e-20   Cicer arietinum [garbanzo]
ref|XP_007221988.1|  hypothetical protein PRUPE_ppa002858mg           98.2    8e-20   
ref|XP_002303218.2|  hypothetical protein POPTR_0003s04040g           95.1    2e-19   
ref|NP_180164.1|  protein EARLY FLOWERING 3                           95.9    5e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72719.1|  nematode responsive protein                          95.5    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008357349.1|  PREDICTED: protein EARLY FLOWERING 3-like        95.1    1e-18   
gb|KDP40820.1|  hypothetical protein JCGZ_24819                       95.1    1e-18   Jatropha curcas
ref|XP_007024385.1|  Hydroxyproline-rich glycoprotein family prot...  95.1    1e-18   
ref|XP_009337143.1|  PREDICTED: protein EARLY FLOWERING 3-like        94.7    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_010654568.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X2  94.0    2e-18   
gb|AFR60581.1|  early flowering 3/high response                       87.4    2e-18   Pisum sativum subsp. sativum
ref|XP_009361544.1|  PREDICTED: protein EARLY FLOWERING 3-like        94.4    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_002276544.3|  PREDICTED: protein EARLY FLOWERING 3 isoform X1  94.0    3e-18   Vitis vinifera
ref|XP_011011714.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  93.6    3e-18   Populus euphratica
ref|XP_011011712.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  93.6    3e-18   Populus euphratica
emb|CAN65004.1|  hypothetical protein VITISV_023490                   94.0    5e-18   Vitis vinifera
ref|XP_009401962.1|  PREDICTED: protein EARLY FLOWERING 3-like        93.2    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI35994.3|  unnamed protein product                              92.8    7e-18   Vitis vinifera
ref|XP_002878908.1|  hypothetical protein ARALYDRAFT_481449           92.4    8e-18   
gb|EPS65488.1|  hypothetical protein M569_09288                       85.1    8e-18   Genlisea aurea
ref|XP_008351957.1|  PREDICTED: protein EARLY FLOWERING 3-like        91.3    2e-17   
ref|XP_002515898.1|  hypothetical protein RCOM_1486170                91.7    2e-17   Ricinus communis
ref|XP_008393666.1|  PREDICTED: protein EARLY FLOWERING 3             91.3    2e-17   
ref|XP_008462380.1|  PREDICTED: protein EARLY FLOWERING 3             90.9    3e-17   
dbj|BAL45488.1|  early flowering 3                                    90.9    3e-17   Fagopyrum esculentum
ref|XP_010915306.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  90.9    3e-17   Elaeis guineensis
ref|XP_004168028.1|  PREDICTED: protein EARLY FLOWERING 3-like        90.5    4e-17   
ref|XP_004143036.1|  PREDICTED: protein EARLY FLOWERING 3-like        90.5    4e-17   Cucumis sativus [cucumbers]
ref|XP_008444497.1|  PREDICTED: protein EARLY FLOWERING 3             90.5    4e-17   Cucumis melo [Oriental melon]
ref|XP_010097103.1|  hypothetical protein L484_019542                 88.6    8e-17   
ref|XP_006293368.1|  hypothetical protein CARUB_v10022728mg           89.4    9e-17   Capsella rubella
ref|XP_010526158.1|  PREDICTED: protein EARLY FLOWERING 3-like        89.4    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_010267081.1|  PREDICTED: protein EARLY FLOWERING 3-like        87.8    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010472622.1|  PREDICTED: protein EARLY FLOWERING 3-like        88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_004141800.1|  PREDICTED: uncharacterized protein LOC101208149  88.6    2e-16   Cucumis sativus [cucumbers]
ref|XP_010417373.1|  PREDICTED: protein EARLY FLOWERING 3-like        87.8    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010267078.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  87.8    4e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008807709.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  87.4    4e-16   
ref|XP_010106119.1|  hypothetical protein L484_003122                 87.8    4e-16   
ref|XP_010429612.1|  PREDICTED: protein EARLY FLOWERING 3-like        87.4    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006853900.1|  hypothetical protein AMTR_s00036p00168840        87.4    5e-16   Amborella trichopoda
ref|XP_010526070.1|  PREDICTED: protein EARLY FLOWERING 3             86.7    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_009117036.1|  PREDICTED: protein EARLY FLOWERING 3             85.9    1e-15   
ref|NP_001288828.1|  protein EARLY FLOWERING 3                        85.9    1e-15   Brassica rapa
ref|XP_006426449.1|  hypothetical protein CICLE_v10024969mg           85.9    1e-15   Citrus clementina [clementine]
gb|KDO58686.1|  hypothetical protein CISIN_1g004483mg                 85.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_006466166.1|  PREDICTED: protein EARLY FLOWERING 3-like        85.9    1e-15   Citrus sinensis [apfelsine]
emb|CDY11505.1|  BnaA09g40710D                                        84.0    5e-15   Brassica napus [oilseed rape]
emb|CDX76735.1|  BnaC08g33210D                                        83.6    7e-15   
gb|EYU29309.1|  hypothetical protein MIMGU_mgv1a022839mg              83.2    9e-15   Erythranthe guttata [common monkey flower]
gb|AEK05755.1|  early flowering 3                                     81.6    1e-14   Populus balsamifera [balsam poplar]
gb|AEK05745.1|  early flowering 3                                     81.6    1e-14   Populus balsamifera [balsam poplar]
gb|AEK05746.1|  early flowering 3                                     81.6    1e-14   Populus balsamifera [balsam poplar]
gb|AEK05742.1|  early flowering 3                                     81.3    2e-14   Populus balsamifera [balsam poplar]
gb|AEK05739.1|  early flowering 3                                     81.3    2e-14   Populus balsamifera [balsam poplar]
gb|EPS62660.1|  hypothetical protein M569_12130                       79.3    2e-14   Genlisea aurea
gb|AEK05754.1|  early flowering 3                                     80.9    2e-14   Populus balsamifera [balsam poplar]
ref|XP_004960992.1|  PREDICTED: protein EARLY FLOWERING 3-like        82.0    3e-14   Setaria italica
ref|XP_007216534.1|  hypothetical protein PRUPE_ppa026719mg           82.0    3e-14   Prunus persica
ref|XP_008244742.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X1  81.3    4e-14   Prunus mume [ume]
ref|XP_008244743.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X2  81.3    4e-14   Prunus mume [ume]
ref|XP_003567779.1|  PREDICTED: protein EARLY FLOWERING 3-like        81.3    5e-14   Brachypodium distachyon [annual false brome]
gb|AEK05743.1|  early flowering 3                                     78.2    2e-13   Populus balsamifera [balsam poplar]
gb|AEZ53983.1|  early flowering protein 3 mutant eam8.k               74.7    2e-13   Hordeum vulgare [barley]
ref|XP_010062565.1|  PREDICTED: protein EARLY FLOWERING 3-like        79.0    3e-13   Eucalyptus grandis [rose gum]
ref|XP_004498925.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  78.6    3e-13   
ref|XP_004498928.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  78.6    3e-13   
gb|AEW48250.1|  early flowering 3                                     76.6    4e-13   Hordeum vulgare [barley]
gb|KFK29903.1|  early flowering 3                                     78.2    4e-13   Arabis alpina [alpine rockcress]
dbj|BAD97868.1|  ELF3 homologue                                       77.8    4e-13   Lemna aequinoctialis
ref|XP_006408833.1|  hypothetical protein EUTSA_v10001926mg           78.2    5e-13   Eutrema salsugineum [saltwater cress]
ref|XP_008650078.1|  PREDICTED: protein EARLY FLOWERING 3-like        77.8    5e-13   Zea mays [maize]
ref|XP_002440379.1|  hypothetical protein SORBIDRAFT_09g030700        77.8    7e-13   Sorghum bicolor [broomcorn]
gb|KEH39954.1|  EARLY flowering protein, putative                     76.3    2e-12   Medicago truncatula
ref|NP_001043361.1|  Os01g0566100                                     75.5    2e-12   
gb|KEH39956.1|  EARLY flowering protein, putative                     76.3    2e-12   Medicago truncatula
dbj|BAJ96537.1|  predicted protein                                    75.9    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94845.1|  predicted protein                                    75.9    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEZ53982.1|  early flowering protein 3                             75.9    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEW48248.1|  early flowering 3                                     75.9    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004969003.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  75.5    3e-12   Setaria italica
gb|ABL11477.1|  ELF3 protein                                          75.1    4e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010546508.1|  PREDICTED: uncharacterized protein LOC104818577  70.5    5e-12   Tarenaya hassleriana [spider flower]
gb|AGT16850.1|  hydroxyproline-rich glycoprotein family protein       74.7    6e-12   Saccharum hybrid cultivar R570
gb|AGT16064.1|  hydroxyproline-rich glycoprotein family protein       74.7    7e-12   Saccharum hybrid cultivar R570
gb|KEH18269.1|  early flowering protein, putative                     74.3    7e-12   Medicago truncatula
gb|EEE54823.1|  hypothetical protein OsJ_02258                        73.9    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056770.2|  Os06g0142600                                     73.2    1e-11   
ref|XP_006646013.1|  PREDICTED: protein EARLY FLOWERING 3-like        73.6    1e-11   
gb|KHN11326.1|  Protein FAR1-RELATED SEQUENCE 11                      73.9    1e-11   Glycine soja [wild soybean]
ref|XP_007135598.1|  hypothetical protein PHAVU_010G142900g           73.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_007135599.1|  hypothetical protein PHAVU_010G142900g           73.2    2e-11   Phaseolus vulgaris [French bean]
ref|NP_001169653.1|  uncharacterized protein LOC100383534             73.2    2e-11   Zea mays [maize]
ref|XP_008244744.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X3  72.8    3e-11   
gb|KHN39274.1|  Protein EARLY FLOWERING 3                             72.8    3e-11   Glycine soja [wild soybean]
gb|AGT17012.1|  hydroxyproline-rich glycoprotein family protein       72.0    4e-11   Saccharum hybrid cultivar R570
gb|EEC70910.1|  hypothetical protein OsI_02465                        72.0    4e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAL63008.1|  Hd17                                                 72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AGW16337.1|  Hd-q                                                  72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAM09631.1|  ELF3-like protein                                    72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA83571.1|  putative early flowering 3                           72.0    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAL63009.1|  Hd17                                                 72.0    4e-11   Oryza sativa Indica Group [Indian rice]
gb|EAY99610.1|  hypothetical protein OsI_21588                        72.0    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006583033.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  71.6    7e-11   Glycine max [soybeans]
ref|XP_006583036.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  71.2    7e-11   Glycine max [soybeans]
ref|XP_006583035.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  71.2    7e-11   Glycine max [soybeans]
ref|XP_006585544.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  70.9    1e-10   Glycine max [soybeans]
dbj|BAD97872.1|  ELF3 homologue                                       70.1    1e-10   Lemna gibba
emb|CDY35321.1|  BnaA04g15260D                                        69.7    3e-10   Brassica napus [oilseed rape]
ref|XP_002458017.1|  hypothetical protein SORBIDRAFT_03g025560        69.7    3e-10   Sorghum bicolor [broomcorn]
ref|XP_009140718.1|  PREDICTED: protein EARLY FLOWERING 3             69.3    3e-10   Brassica rapa
ref|XP_004969002.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  69.3    3e-10   
emb|CDY66493.1|  BnaCnng51090D                                        68.6    6e-10   Brassica napus [oilseed rape]
ref|XP_004510333.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  68.6    6e-10   
gb|KJB18568.1|  hypothetical protein B456_003G060800                  65.5    6e-10   Gossypium raimondii
emb|CDO97951.1|  unnamed protein product                              67.8    1e-09   Coffea canephora [robusta coffee]
ref|XP_009778080.1|  PREDICTED: protein EARLY FLOWERING 3-like        67.0    2e-09   Nicotiana sylvestris
ref|XP_002974988.1|  hypothetical protein SELMODRAFT_415241           67.0    2e-09   
ref|XP_004242270.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  65.9    5e-09   Solanum lycopersicum
ref|XP_002978467.1|  hypothetical protein SELMODRAFT_443909           65.5    5e-09   
dbj|BAL49856.1|  arabidopsis ELF3 homolog                             65.1    7e-09   Fagopyrum urophyllum
ref|XP_001753903.1|  predicted protein                                65.1    9e-09   
gb|ABP81864.1|  EARLY FLOWERING 3                                     63.9    1e-08   Pisum sativum [garden pea]
ref|XP_002970302.1|  hypothetical protein SELMODRAFT_411196           63.5    2e-08   
ref|XP_001766802.1|  predicted protein                                63.2    4e-08   
ref|XP_002977406.1|  hypothetical protein SELMODRAFT_443557           62.4    4e-08   
ref|XP_009625226.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  62.0    7e-08   Nicotiana tomentosiformis
dbj|BAL49858.1|  arabidopsis ELF3 homolog                             60.5    2e-07   Fagopyrum tataricum [Kangra buckwheat]
dbj|BAL49855.1|  self-incompatibility locus early-flowering 3         60.1    3e-07   Fagopyrum cymosum
gb|KEH18268.1|  hypothetical protein MTR_8g015470                     54.7    1e-06   Medicago truncatula
ref|XP_006357460.1|  PREDICTED: protein EARLY FLOWERING 3-like        58.2    2e-06   
ref|XP_011080316.1|  PREDICTED: protein EARLY FLOWERING 3-like        57.8    2e-06   
ref|XP_010536213.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  55.8    8e-06   Tarenaya hassleriana [spider flower]
ref|XP_011072464.1|  PREDICTED: protein EARLY FLOWERING 3-like        53.1    6e-05   Sesamum indicum [beniseed]
gb|EPS67106.1|  hypothetical protein M569_07670                       49.7    7e-04   Genlisea aurea



>emb|CAN79509.1| hypothetical protein VITISV_038336 [Vitis vinifera]
Length=333

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-SP  623
            MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S 
Sbjct  1    MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPASS  60

Query  624  SQGNGHERRMFLPMHLPPS  680
            SQG+GHER +F P H+ PS
Sbjct  61   SQGSGHERGVFFPHHISPS  79



>ref|XP_004245125.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=644

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP +PNN S + PPS 
Sbjct  10   VMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLDPNNTSKMAPPSS  69

Query  624  SQGNGHERRMFLPMHLPPS  680
            SQG+GH+R  +LP+  PPS
Sbjct  70   SQGSGHDRSGYLPIQHPPS  88



>ref|XP_010049159.1| PREDICTED: protein EARLY FLOWERING 3 [Eucalyptus grandis]
 gb|KCW81636.1| hypothetical protein EUGRSUZ_C02997 [Eucalyptus grandis]
Length=698

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  G+LP NPNN+SNL+ P+ 
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFGSGMLPLNPNNSSNLVSPAS  69

Query  624  S-QGNGHERRMFLPMHLPPS  680
            S QG G  R ++ P HLPPS
Sbjct  70   SNQGTGSARNLYFPRHLPPS  89



>gb|KDP34132.1| hypothetical protein JCGZ_07703 [Jatropha curcas]
Length=718

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+H VLP NP+ ASNLIP  S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNHAVLPLNPSKASNLIPAAS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQG+G ER +  P H+PP+
Sbjct  70   SSQGSGFERSLQFPNHVPPT  89



>ref|XP_006355312.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=656

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP +PNN S + PPS 
Sbjct  10   VMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLDPNNTSKMGPPSS  69

Query  624  SQGNGHERRMFLPMHLPPS  680
            SQG+GH+R  + P+  PPS
Sbjct  70   SQGSGHDRGGYFPIQHPPS  88



>ref|XP_002278577.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
 ref|XP_010648311.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
Length=725

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPAS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQG+GHER +F P H+ PS
Sbjct  70   SSQGSGHERGVFFPHHISPS  89



>emb|CBI20609.3| unnamed protein product [Vitis vinifera]
Length=671

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+PSQR + GV+P   NNASNL+PP S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPSQRCNPGVMPLKSNNASNLVPPAS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQG+GHER +F P H+ PS
Sbjct  70   SSQGSGHERGVFFPHHISPS  89



>ref|XP_009629368.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=608

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  620
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP NP NN + L PPS
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLNPNNNTAKLPPPS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             +QG+GHER ++ P+  PPS
Sbjct  70   SNQGSGHERVVYFPVQHPPS  89



>ref|XP_009629366.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009629367.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=650

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  620
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP NP NN + L PPS
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPLNPNNNTAKLPPPS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             +QG+GHER ++ P+  PPS
Sbjct  70   SNQGSGHERVVYFPVQHPPS  89



>ref|XP_002516480.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45821.1| conserved hypothetical protein [Ricinus communis]
Length=720

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 2/81 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIP-P  617
            +MGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF +HG L  NP+ A+NL+P  
Sbjct  14   MMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNNHGALLHNPSKATNLVPAA  73

Query  618  SPSQGNGHERRMFLPMHLPPS  680
            S SQG+G+ER + LP+H+PPS
Sbjct  74   SSSQGSGYERNLHLPLHVPPS  94



>emb|CDP08210.1| unnamed protein product [Coffea canephora]
Length=713

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-SP  623
            MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF HGV+P N N+++N IPP S 
Sbjct  11   MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFKHGVVPINSNSSANGIPPVSS  70

Query  624  SQGNGHERRMFLPMHLP  674
            SQGNG +R  F    LP
Sbjct  71   SQGNGQQRGAFCSHQLP  87



>gb|AIN75607.1| EARLY FLOWERING 3 [Dimocarpus longan]
Length=726

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF+  VLPPNP+N+S+L+PP S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFNPAVLPPNPSNSSSLVPPGS  69

Query  621  PSQGNGHERRMFLPMHLP  674
             SQG+G ER +  P+ +P
Sbjct  70   SSQGSGPERNVPFPISVP  87



>gb|KHN29734.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=714

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ SIPSQRF+ GVLP NPN +SN +PP S
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQFSIPSQRFNSGVLPLNPNISSNTVPPAS  69

Query  621  PSQGNGHERRMFLPMHLPP  677
             S G   ER    P+HLPP
Sbjct  70   SSLGTVPERNCVYPVHLPP  88



>gb|ACU18593.1| unknown [Glycine max]
Length=152

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  450  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPSQ  629
            GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQ+F+  +LP  PN++SN++PP P+Q
Sbjct  12   GPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQKFNPRLLPRKPNSSSNIVPP-PTQ  70

Query  630  GNGHERRMFLPMHL  671
            GNGHER    P+  
Sbjct  71   GNGHERSYVYPVRF  84



>ref|XP_006340248.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=609

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQR++ G LP N +N++NL PP  
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRYNPGDLPHNSSNSANLFPPHS  69

Query  624  SQGNGHERRMFLPMHLP  674
            SQ N HER +F    LP
Sbjct  70   SQENEHERGVFFSRQLP  86



>ref|XP_011095302.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=678

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF H +LP NPNNAS L+PPS 
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSHQMLPLNPNNAS-LVPPS-  67

Query  624  SQGNGHERRMFLPMHLP  674
             QG  +ER MF    LP
Sbjct  68   DQGLANERGMFYTYQLP  84



>ref|XP_009594922.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=639

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G LP   NN +N +PP  
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGDLP--LNNNTNTVPPYS  67

Query  624  SQGNGHERRMFLPMHLP  674
            SQGN HER +F    LP
Sbjct  68   SQGNDHERGVFFSRQLP  84



>ref|XP_009784952.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=650

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  G LP   NN SN +PP  
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSPGDLP--LNNNSNSVPPYS  67

Query  624  SQGNGHERRMFLPMHLPPS  680
            SQGN HER +F    LP S
Sbjct  68   SQGNEHERVVFFSRQLPAS  86



>ref|XP_003523640.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006578075.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 gb|ACJ61495.1| early flowering 3 [Glycine max]
Length=714

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ SIPSQRF+ GVLP NPN +SN +PP+ 
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQFSIPSQRFNSGVLPLNPNISSNTVPPAS  69

Query  624  SQGNGH-ERRMFLPMHLPP  677
            S      ER    P+HLPP
Sbjct  70   SSLRTVPERNCVYPVHLPP  88



>ref|XP_009782254.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
sylvestris]
Length=598

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 7/79 (9%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN +       
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPANSNNNT-------  62

Query  624  SQGNGHERRMFLPMHLPPS  680
            ++G+GHER ++ P+  PPS
Sbjct  63   AKGSGHERVVYFPVQHPPS  81



>ref|XP_009782253.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 7/79 (9%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN +       
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNSGVLPANSNNNT-------  62

Query  624  SQGNGHERRMFLPMHLPPS  680
            ++G+GHER ++ P+  PPS
Sbjct  63   AKGSGHERVVYFPVQHPPS  81



>ref|XP_007160974.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
 gb|ESW32968.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
Length=713

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP--  617
            + GPMFPRLHVND EKGGPRAPPRNKMALYEQLS+PSQRF+  +LP  PN++SNL+ P  
Sbjct  10   VAGPMFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPSQRFNPRLLPLKPNSSSNLVAPPV  69

Query  618  SPSQGNGHERRMFLPMHLP  674
            S +QGNGHER    P+ LP
Sbjct  70   SSTQGNGHERSYAYPVRLP  88



>ref|XP_004251173.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=603

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRL+VNDTEKGGPRAPPRNKMALYEQLSIPSQR++ G LP N +N++NL+ P P
Sbjct  10   VMGPMFPRLNVNDTEKGGPRAPPRNKMALYEQLSIPSQRYNPGDLPHNSSNSANLVLPHP  69

Query  624  SQGNGHERRMFLPMHLP  674
            SQ N HER +     LP
Sbjct  70   SQENEHERGVLFSRQLP  86



>ref|XP_010244364.1| PREDICTED: protein EARLY FLOWERING 3 [Nelumbo nucifera]
Length=786

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 4/82 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            IMGP+FPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ G    LP  PNNASNL+P
Sbjct  10   IMGPLFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNSGLAPTLPLPPNNASNLVP  69

Query  615  -PSPSQGNGHERRMFLPMHLPP  677
              S SQG  HER +F  +++ P
Sbjct  70   STSSSQGGAHERSVFSQIYVSP  91



>ref|XP_003550290.1| PREDICTED: protein EARLY FLOWERING 3-like [Glycine max]
 gb|KHN37008.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=713

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  450  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPSQ  629
            GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQ+F+  +LP  PN++SN++PP P+Q
Sbjct  12   GPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQKFNPRLLPRKPNSSSNIVPP-PTQ  70

Query  630  GNGHERRMFLPMHL  671
            GNGHER    P+  
Sbjct  71   GNGHERSYVYPVRF  84



>ref|XP_011081715.1| PREDICTED: LOW QUALITY PROTEIN: protein EARLY FLOWERING 3 [Sesamum 
indicum]
Length=694

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF H V+P +P+N++  + P  
Sbjct  10   MMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSHPVMPCDPSNSAANLVPRL  69

Query  624  SQGNGHERRMFLPMHLPP  677
            SQG G++R M     +PP
Sbjct  70   SQGGGNDRGMCFSRQVPP  87



>ref|XP_011019541.1| PREDICTED: protein EARLY FLOWERING 3 [Populus euphratica]
Length=713

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            IMGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+  VLP N +N S+L P  S
Sbjct  10   IMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNPDVLPRNSSNTSDLAPTGS  69

Query  621  PSQGNGHERRMFLPMHLPP  677
             SQG+G ER    P ++PP
Sbjct  70   SSQGSGLERHFPYPHYVPP  88



>ref|XP_006342510.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=719

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 61/79 (77%), Gaps = 8/79 (10%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF HG+   NPNNA N+     
Sbjct  10   LMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFKHGI-SNNPNNA-NI-----  62

Query  624  SQGNGHERRMFLPMHLPPS  680
             QGNG E   F  + LPPS
Sbjct  63   -QGNGRENDDFFSVQLPPS  80



>gb|AFZ78447.1| early flowering 3 [Lens culinaris]
Length=702

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 4/79 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PNN++N +PP S
Sbjct  10   MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNNSTNSVPPAS  66

Query  621  PSQGNGHERRMFLPMHLPP  677
             SQG  HER    P HL P
Sbjct  67   SSQGTVHERNYIFPGHLTP  85



>gb|KDO79983.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
 gb|KDO79984.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=365

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>ref|XP_010097101.1| hypothetical protein L484_019540 [Morus notabilis]
 gb|EXB66902.1| hypothetical protein L484_019540 [Morus notabilis]
Length=727

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 3/82 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD--HGVLPPNPNNASNLIP-  614
            I+GPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQR +   GV+P NPN ++N++P 
Sbjct  10   IVGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRGNSASGVVPLNPNFSANMVPS  69

Query  615  PSPSQGNGHERRMFLPMHLPPS  680
             + SQ +G ER +  P HLPPS
Sbjct  70   ATSSQASGVERYLVYPRHLPPS  91



>gb|KDO79981.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=388

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>gb|KDO79980.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=368

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>ref|XP_002309522.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
 gb|EEE93045.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
Length=663

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            IMGPMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+  VLP N +N S+L P  S
Sbjct  10   IMGPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNPDVLPRNSSNTSDLAPTGS  69

Query  621  PSQGNGHERRMFLPMHLP  674
             SQG+G ER    P ++P
Sbjct  70   SSQGSGLERHFPYPHYVP  87



>gb|KDO79982.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=435

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>ref|XP_008797900.1| PREDICTED: protein EARLY FLOWERING 3 [Phoenix dactylifera]
Length=757

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 3/80 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIP-  614
            IMGP+FPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+     +P  P NAS L+P 
Sbjct  10   IMGPLFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSAASSVPLPPPNASTLVPS  69

Query  615  PSPSQGNGHERRMFLPMHLP  674
             S SQG GHER ++ P ++P
Sbjct  70   ASSSQGCGHERNVYSPFYMP  89



>gb|KJB07439.1| hypothetical protein B456_001G024100 [Gossypium raimondii]
Length=704

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-SP  623
            M PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G+LP N +N+S+L+PP S 
Sbjct  11   MEPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGLLPLNTSNSSSLVPPTSS  70

Query  624  SQGNGHERRMF  656
            SQG+  + R+F
Sbjct  71   SQGSCLQNRLF  81



>gb|AFR60580.1| early flowering 3/high response [Pisum sativum subsp. sativum]
Length=702

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 61/79 (77%), Gaps = 4/79 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP S
Sbjct  10   MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPPAS  66

Query  621  PSQGNGHERRMFLPMHLPP  677
             SQG  HER    P HL P
Sbjct  67   SSQGTVHERNYVFPGHLTP  85



>ref|XP_010669115.1| PREDICTED: protein EARLY FLOWERING 3 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP-PS  620
            IMGPMFPRLHVNDT KGGPRAPPRNKMALYEQL+IPSQR++ G +P + NN++   P  S
Sbjct  10   IMGPMFPRLHVNDTGKGGPRAPPRNKMALYEQLTIPSQRYNSGAMPLHQNNSNTTAPSTS  69

Query  621  PSQGNGHERRMFLPMH  668
             +QG  HE+ M+ P++
Sbjct  70   TTQGTSHEQNMYFPLY  85



>ref|XP_009400544.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=754

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  617
            +MGP+FPRLHVND +KGGPRAPPRNKMALYEQLS+PSQRF+     LP  P N+SNL+P 
Sbjct  10   VMGPLFPRLHVNDPDKGGPRAPPRNKMALYEQLSVPSQRFNSASSTLPFPPRNSSNLVPS  69

Query  618  SP-SQGNGHERRMFLPMHLPP  677
             P SQG GH + MF P+++ P
Sbjct  70   LPSSQGCGHRKNMFSPLYMTP  90



>ref|XP_009594920.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=654

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 62/92 (67%), Gaps = 17/92 (18%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G LP   NN +N +PP  
Sbjct  10   VMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGDLP--LNNNTNTVPPYS  67

Query  624  SQ---------------GNGHERRMFLPMHLP  674
            SQ               GN HER +F    LP
Sbjct  68   SQEDAIQLCRCDSIFLKGNDHERGVFFSRQLP  99



>ref|XP_003603108.1| Protein EARLY FLOWERING [Medicago truncatula]
 gb|AES73359.1| early flowering protein [Medicago truncatula]
Length=688

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPP-NPNNASNLIPP-  617
            +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LPP +PN + N +PP 
Sbjct  10   VMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPPHHPNTSINTVPPS  66

Query  618  SPSQGNGHERRMFLPMHLPP  677
            S SQG  HER    P HL P
Sbjct  67   SSSQGAVHERNYVFPGHLTP  86



>gb|AAQ73529.1| early flowering 3 [Mesembryanthemum crystallinum]
Length=705

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  620
            IMGPMFPRLHVNDTE+GGPRAPPRNKMALYEQL++PSQR++ G +P +P  N+S     S
Sbjct  10   IMGPMFPRLHVNDTERGGPRAPPRNKMALYEQLTVPSQRYNTGAVPHHPSKNSSLNSSTS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             +QG GHER M++P++  PS
Sbjct  70   TNQGTGHERDMYIPLYRTPS  89



>gb|KDO79979.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=723

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>ref|XP_006475975.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=723

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>ref|XP_006450775.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
 gb|ESR64015.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
Length=723

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN-ASNLIPPS  620
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP+QRF  GVLP NP+N +S + P S
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPTQRFSTGVLPLNPSNSSSLVPPVS  69

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQGNG ER +     + PS
Sbjct  70   SSQGNGLERNLLFAHSVHPS  89



>gb|KHF99548.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=733

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            +M PMFPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF+   LP  PNN ++L+P  S
Sbjct  12   VMSPMFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFN-SALPLPPNNTNSLVPSIS  70

Query  621  PSQGNGHERRMFLPMH  668
             S G G+E  MF+P  
Sbjct  71   SSHGEGNESSMFMPFE  86



>ref|XP_008220435.1| PREDICTED: protein EARLY FLOWERING 3 [Prunus mume]
Length=731

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS-  620
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+  V+P NPN+ S+++P + 
Sbjct  9    VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPVVMPLNPNSTSSVVPSAF  68

Query  621  PSQGNGHERRMFLPMHLPPS  680
             SQG+  E  + +P+H+ PS
Sbjct  69   SSQGSRSEGNLPVPLHVRPS  88



>gb|KJB07438.1| hypothetical protein B456_001G024000 [Gossypium raimondii]
Length=705

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  626
            M PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF+ G+LP N +N+ +L+PP+ +
Sbjct  11   MEPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFNPGLLPHNTSNSGSLVPPTST  70

Query  627  QGNGHERRMFLPMHL  671
                  + M  P H+
Sbjct  71   SQGSSLQNMLFPSHV  85



>ref|XP_004253100.1| PREDICTED: protein EARLY FLOWERING 3 [Solanum lycopersicum]
Length=722

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 58/79 (73%), Gaps = 8/79 (10%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF +G+   N NNA        
Sbjct  10   LMGPMFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFKYGI-SNNRNNAD-------  61

Query  624  SQGNGHERRMFLPMHLPPS  680
             QGNG E   F  + LPPS
Sbjct  62   IQGNGRENDDFFSVQLPPS  80



>ref|XP_010924961.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
 ref|XP_010924963.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
Length=754

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 3/79 (4%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLIP-P  617
            MGP+FPRLHVND++KGGPRAPPRNKMALYEQLSIPSQRF+     LP  P+NAS L+P  
Sbjct  11   MGPLFPRLHVNDSDKGGPRAPPRNKMALYEQLSIPSQRFNSTASALPFPPHNASTLVPLA  70

Query  618  SPSQGNGHERRMFLPMHLP  674
            S S G GHER ++ P ++P
Sbjct  71   SSSLGCGHERSVYSPFYMP  89



>gb|KHG06245.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=701

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 4/78 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            +M PMFPRLHVND EKGGP+APPRNKMALYEQLSI SQRF+ G   +LP  PNN++ L+P
Sbjct  18   VMNPMFPRLHVNDAEKGGPKAPPRNKMALYEQLSITSQRFNSGSQSMLPFPPNNSNILVP  77

Query  615  P-SPSQGNGHERRMFLPM  665
              S S G G+ER MF+P+
Sbjct  78   SMSSSHGGGNERNMFMPL  95



>ref|XP_010915307.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Elaeis 
guineensis]
Length=752

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIP  614
            IM PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     VLP  P+NAS L+ 
Sbjct  11   IMNPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSTAASVLPLPPHNASILVS  70

Query  615  PSPSQGNGHERRMFLPMHLP  674
             + SQ  GHER +  P + P
Sbjct  71   TASSQECGHERSVSSPYYTP  90



>gb|AAM97051.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15504.1| unknown protein [Arabidopsis thaliana]
Length=339

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  620
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG +    NN S L+ P 
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSNNTSTLVHPG  69

Query  621  P-SQGNGHERRMFLPMHLPPS  680
            P SQ  G ER + +  HL  S
Sbjct  70   PSSQPCGVERNLSV-QHLDSS  89



>ref|XP_008807710.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Phoenix 
dactylifera]
Length=684

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIPP  617
            M PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     V P  P+NAS  +  
Sbjct  1    MRPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSKAASVFPLPPHNASTPVSS  60

Query  618  SPSQGNGHERRMFLPMHLPP  677
            + +QG GHER +  P ++PP
Sbjct  61   ASNQGGGHERSVLSPYYIPP  80



>gb|KJB35029.1| hypothetical protein B456_006G096400 [Gossypium raimondii]
 gb|KJB35030.1| hypothetical protein B456_006G096400 [Gossypium raimondii]
Length=694

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 4/78 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            +M PMFPRLHVND EKGGP+APPRNKMALYEQLSI SQRF+ G   +LP  PNN++ L+P
Sbjct  12   VMNPMFPRLHVNDAEKGGPKAPPRNKMALYEQLSITSQRFNSGSQSMLPFPPNNSNILVP  71

Query  615  P-SPSQGNGHERRMFLPM  665
              S S G G+ER MF+P 
Sbjct  72   SMSSSHGGGNERNMFMPF  89



>gb|KJB56855.1| hypothetical protein B456_009G138600 [Gossypium raimondii]
Length=731

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP-S  620
            +M PMFPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF+   LP  PNN ++L+P  S
Sbjct  12   VMSPMFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFN-SALPLPPNNTNSLVPSIS  70

Query  621  PSQGNGHERRMFLPMH  668
               G G+E  MF+P  
Sbjct  71   SRHGEGNESSMFMPFE  86



>ref|XP_008806826.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Phoenix 
dactylifera]
Length=762

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLI-PP  617
            MGP+FPRLHVNDT+KGGPRAPPRNKMALYE+LSIPSQRF+     LPP P NA  L+   
Sbjct  23   MGPLFPRLHVNDTDKGGPRAPPRNKMALYERLSIPSQRFNSTASALPPCPRNARTLVSSA  82

Query  618  SPSQGNGHERRMFLPMHLP  674
            S SQG G ER ++ P ++P
Sbjct  83   SLSQGCGQERSVYSPFYMP  101



>ref|XP_008806834.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Phoenix 
dactylifera]
Length=759

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 3/79 (4%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLI-PP  617
            MGP+FPRLHVNDT+KGGPRAPPRNKMALYE+LSIPSQRF+     LPP P NA  L+   
Sbjct  23   MGPLFPRLHVNDTDKGGPRAPPRNKMALYERLSIPSQRFNSTASALPPCPRNARTLVSSA  82

Query  618  SPSQGNGHERRMFLPMHLP  674
            S SQG G ER ++ P ++P
Sbjct  83   SLSQGCGQERSVYSPFYMP  101



>ref|XP_004291013.1| PREDICTED: protein EARLY FLOWERING 3 [Fragaria vesca subsp. vesca]
Length=704

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQR +HG +P + N+ S++  P+ 
Sbjct  11   VMGPMFPRLHVNDPDKGGPRAPPRNKMALYEQLSIPSQRSNHGAMPLHQNSNSSMGSPAL  70

Query  624  S-QGNGHERRMFLPMHLPPS  680
            S QGNG ER +  P+H  P+
Sbjct  71   SNQGNGPERNLPFPVHARPA  90



>ref|XP_010910484.1| PREDICTED: protein EARLY FLOWERING 3 [Elaeis guineensis]
Length=755

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 3/80 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV--LPPNPNNASNLIP-  614
            +MGP+FPRLHVNDT+KGGPRAPPRNKMALYEQLSIPSQRF+     +P  P N S L+P 
Sbjct  10   MMGPLFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSQRFNSTASSVPLPPPNTSTLVPS  69

Query  615  PSPSQGNGHERRMFLPMHLP  674
             S SQG GH+R +  P ++P
Sbjct  70   ASSSQGCGHDRSVHSPFYVP  89



>ref|XP_007012227.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY29846.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=714

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLI  611
            IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF   VLP NP+N S+L+
Sbjct  10   IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFSPAVLPLNPSNKSSLV  65



>gb|KHN17209.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=697

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 5/69 (7%)
 Frame = +3

Query  450  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD-HGVLPPNPNNASNLIPP--S  620
            GPMFPRLHVND EKGGPRAPPRNKMALYEQ SIPSQRF+ H  LP  PN++SN++PP  S
Sbjct  12   GPMFPRLHVNDAEKGGPRAPPRNKMALYEQFSIPSQRFNPH--LPRKPNSSSNIVPPPTS  69

Query  621  PSQGNGHER  647
             ++GNG ER
Sbjct  70   STEGNGRER  78



>ref|XP_004501482.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
Length=699

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PPS 
Sbjct  11   MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSTNTVPPSS  67

Query  624  S-QGNGHERRMFLPMHL  671
            S QG   ER      HL
Sbjct  68   SIQGTVLERNYVFRGHL  84



>ref|XP_007221988.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
 gb|EMJ23187.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
Length=626

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP  614
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+  V+P NPNN S+++P
Sbjct  9    VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPVVMPLNPNNTSSVVP  65



>ref|XP_002303218.2| hypothetical protein POPTR_0003s04040g [Populus trichocarpa]
 gb|EEE78197.2| hypothetical protein POPTR_0003s04040g [Populus trichocarpa]
Length=417

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLI  611
            +  PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S   
Sbjct  10   MTSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAP  69

Query  612  PPSPSQGNGHERRMFLPMHLPPS  680
              S S G GHER +F P+   P+
Sbjct  70   SISSSHGTGHERSVFTPVSNSPT  92



>ref|NP_180164.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
 sp|O82804.1|ELF3_ARATH RecName: Full=Protein EARLY FLOWERING 3; AltName: Full=Nematode-responsive 
protein [Arabidopsis thaliana]
 gb|AAC31242.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15042.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07774.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
Length=695

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  620
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG +    NN S L+ P 
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSNNTSTLVHPG  69

Query  621  P-SQGNGHERRMFLPMHLPPS  680
            P SQ  G ER + +  HL  S
Sbjct  70   PSSQPCGVERNLSV-QHLDSS  89



>emb|CAA72719.1| nematode responsive protein [Arabidopsis thaliana]
Length=702

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  620
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG      NN S L+ P 
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTRNSRSNNTSTLVHPG  69

Query  621  P-SQGNGHERRMFLPMHLPPS  680
            P SQ  G ER + +  HL  S
Sbjct  70   PSSQPCGVERNLSV-QHLDSS  89



>ref|XP_008357349.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=674

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 10/79 (13%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN         
Sbjct  9    VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN---------  59

Query  624  SQGNGHERRMFLPMHLPPS  680
             QG+  +  +  P+H  PS
Sbjct  60   -QGSRSDGNLPFPLHGHPS  77



>gb|KDP40820.1| hypothetical protein JCGZ_24819 [Jatropha curcas]
Length=766

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF---DHGVLPPNPNNASNLIP  614
            IM P+FPRLHVNDTEKGGP+APPRNKMALYEQLSIPSQRF      +LP  PNN + LIP
Sbjct  10   IMSPIFPRLHVNDTEKGGPKAPPRNKMALYEQLSIPSQRFSSGSSSMLPLPPNNGNKLIP  69

Query  615  P-SPSQGNGHERRMFL  659
              + SQG   ER  F 
Sbjct  70   SMALSQGGSFERSTFC  85



>ref|XP_007024385.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY27007.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=774

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP----NNASNLI  611
            +M PMFPRLHVNDTE+GGPRAPPRNKMALYEQLSIPSQRF+ G LP  P    +N+S + 
Sbjct  11   VMSPMFPRLHVNDTERGGPRAPPRNKMALYEQLSIPSQRFNSGSLPVLPLPPNSNSSLVP  70

Query  612  PPSPSQGNGHERRMFLPM  665
              S S G G+ R MF+P 
Sbjct  71   SISSSHGGGNGRSMFMPF  88



>ref|XP_009337143.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=674

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 10/79 (13%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN         
Sbjct  9    VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN---------  59

Query  624  SQGNGHERRMFLPMHLPPS  680
             QG+  +  +  P+H  PS
Sbjct  60   -QGSRSDGNLPFPLHGHPS  77



>ref|XP_010654568.1| PREDICTED: protein EARLY FLOWERING 3 isoform X2 [Vitis vinifera]
Length=540

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  620
            +M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +
Sbjct  10   VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSA  69

Query  621  PS-QGNGHERRMFLPMHLPPS  680
            PS QG+GHER +  P    P+
Sbjct  70   PSTQGSGHERNVVTPFCYTPT  90



>gb|AFR60581.1| early flowering 3/high response [Pisum sativum subsp. sativum]
Length=85

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 3/58 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPP  617
            +MGP+FPRLHV DTEKGGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP
Sbjct  10   MMGPLFPRLHVGDTEKGGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPP  64



>ref|XP_009361544.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=701

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNN  596
            +MGPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N NN
Sbjct  9    VMGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSNN  59



>ref|XP_002276544.3| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Vitis vinifera]
Length=740

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 2/81 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  620
            +M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +
Sbjct  10   VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSA  69

Query  621  PS-QGNGHERRMFLPMHLPPS  680
            PS QG+GHER +  P    P+
Sbjct  70   PSTQGSGHERNVVTPFCYTPT  90



>ref|XP_011011714.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Populus 
euphratica]
Length=764

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 58/85 (68%), Gaps = 8/85 (9%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG------VLPPNPNNASN  605
            +M PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G      VLP   N++S 
Sbjct  10   MMSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLP--KNDSSL  67

Query  606  LIPPSPSQGNGHERRMFLPMHLPPS  680
                S S G GHER +F P+   P+
Sbjct  68   APSISSSYGTGHERSVFTPVSNSPT  92



>ref|XP_011011712.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011011713.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
Length=780

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 58/85 (68%), Gaps = 8/85 (9%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG------VLPPNPNNASN  605
            +M PMFPRLHVND EKGGPRAPPRNKMALYEQL IPSQRF  G      VLP   N++S 
Sbjct  10   MMSPMFPRLHVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLP--KNDSSL  67

Query  606  LIPPSPSQGNGHERRMFLPMHLPPS  680
                S S G GHER +F P+   P+
Sbjct  68   APSISSSYGTGHERSVFTPVSNSPT  92



>emb|CAN65004.1| hypothetical protein VITISV_023490 [Vitis vinifera]
Length=1255

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPS  620
            +M P+FPRLHVND EKGGPRAPPRNKMALYEQ S+P        +LP  PNN+ +L+P +
Sbjct  531  VMSPLFPRLHVNDAEKGGPRAPPRNKMALYEQFSVPKVPSRSTVILPLLPNNSGSLVPSA  590

Query  621  PS-QGNGHERRMFLPMHLPPS  680
            PS QG+GHER +  P    P+
Sbjct  591  PSTQGSGHERNVVTPFCYTPT  611



>ref|XP_009401962.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=736

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLIPP  617
            IMGP+FPRLHVND +KGGPRAPPRNKMALYEQ S+PSQR +     LP    NA  L+P 
Sbjct  10   IMGPLFPRLHVNDADKGGPRAPPRNKMALYEQHSVPSQRLNRSSSALPLPHQNACLLVPS  69

Query  618  SP-SQGNGHERRMFLPMHLP  674
            +P SQG G ER +  P  +P
Sbjct  70   NPLSQGCGQERNVLSPFFMP  89



>emb|CBI35994.3| unnamed protein product [Vitis vinifera]
Length=730

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQ-RFDHGVLPPNPNNASNLIPPSP  623
            M P+FPRLHVND EKGGPRAPPRNKMALYEQLS+P        +LP  PNN+ +L+P +P
Sbjct  1    MSPLFPRLHVNDAEKGGPRAPPRNKMALYEQLSVPKVPSRSTVILPLLPNNSGSLVPSAP  60

Query  624  S-QGNGHERRMFLPMHLPPS  680
            S QG+GHER +  P    P+
Sbjct  61   STQGSGHERNVVTPFCYTPT  80



>ref|XP_002878908.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55167.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
Length=686

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  620
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG L    NN S L+ P 
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTL--RSNNTSTLVHPG  67

Query  621  PSQGNGHERRMFLPMHLPPS  680
            PS       R     HL  S
Sbjct  68   PSNQPCGVERNLSAQHLDSS  87



>gb|EPS65488.1| hypothetical protein M569_09288, partial [Genlisea aurea]
Length=70

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP  614
            ++GPMFPRLHVND +KGGPRAPPRNKMALYEQ SI SQRF +  L    + A+N  P
Sbjct  10   MVGPMFPRLHVNDVDKGGPRAPPRNKMALYEQFSISSQRFSNSALSQTSSTAANSFP  66



>ref|XP_008351957.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=713

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 10/79 (13%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            ++GPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N  N         
Sbjct  9    VVGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSIN---------  59

Query  624  SQGNGHERRMFLPMHLPPS  680
             QG+  +  +  P+H  PS
Sbjct  60   -QGSRSDGNLAFPLHGHPS  77



>ref|XP_002515898.1| hypothetical protein RCOM_1486170 [Ricinus communis]
 gb|EEF46318.1| hypothetical protein RCOM_1486170 [Ricinus communis]
Length=783

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 60/91 (66%), Gaps = 12/91 (13%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL IPS++   G   +LP  PNN S  +P
Sbjct  11   MISPMFPRLHVNDTEKGGPRAPPRNKMALYEQLGIPSRKVSSGSASMLPLPPNNGSTFVP  70

Query  615  P---------SPSQGNGHERRMFLPMHLPPS  680
                      S SQ +G+ER +F P    P+
Sbjct  71   KMLPSHVTSDSCSQVSGNERSVFTPFCNSPA  101



>ref|XP_008393666.1| PREDICTED: protein EARLY FLOWERING 3 [Malus domestica]
Length=713

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 10/79 (13%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            ++GPMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+ GVLP N  N         
Sbjct  9    VVGPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNPGVLPLNSIN---------  59

Query  624  SQGNGHERRMFLPMHLPPS  680
             QG+  +  +  P+H  PS
Sbjct  60   -QGSRSDGNLAFPLHGHPS  77



>ref|XP_008462380.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462381.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462382.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=694

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASN-LIPPS  620
            ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL+IP+QRF  G     P  +S    P S
Sbjct  10   LLSPMFPRLHVNDTEKGGPRAPPRNKMALYEQLTIPTQRFSSGSASATPLPSSTPATPTS  69

Query  621  PSQGNGHERRMF  656
            PS   G +R +F
Sbjct  70   PSHCAGQKRGIF  81



>dbj|BAL45488.1| early flowering 3 [Fagopyrum esculentum]
Length=691

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  626
            MGPMFPRLHVNDTE+GGPRAPPRNKMALYEQL+IPS R        NP N         S
Sbjct  11   MGPMFPRLHVNDTERGGPRAPPRNKMALYEQLTIPSNRH-------NPGNTRLNQHSGAS  63

Query  627  QGNGHERRMFLPMHLPP  677
            QG+ HER  + P + PP
Sbjct  64   QGSSHERITYFPSYQPP  80



>ref|XP_010915306.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Elaeis 
guineensis]
Length=779

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIP  614
            IM PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     VLP  P+NAS L+ 
Sbjct  11   IMNPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSTAASVLPLPPHNASILVS  70

Query  615  PSPSQ  629
             + SQ
Sbjct  71   TASSQ  75



>ref|XP_004168028.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
Length=715

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASN-LIPPS  620
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS
Sbjct  10   TMEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPS  69

Query  621  PSQGNGHERRMFLPMHL  671
             SQG G +  + LP++L
Sbjct  70   SSQGTGADGNLRLPLNL  86



>ref|XP_004143036.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
 gb|KGN62407.1| hypothetical protein Csa_2G352370 [Cucumis sativus]
Length=716

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASN-LIPPS  620
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS
Sbjct  10   TMEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPS  69

Query  621  PSQGNGHERRMFLPMHL  671
             SQG G +  + LP++L
Sbjct  70   SSQGTGADGNLRLPLNL  86



>ref|XP_008444497.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008444498.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=717

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASN-LIPPS  620
             M PMFPRLHVNDTEKG PRAPPRNKMALYEQ ++PS+R   GVLP   N +S  +  PS
Sbjct  10   TMEPMFPRLHVNDTEKGWPRAPPRNKMALYEQFTVPSKRSSPGVLPLKTNISSKPVAIPS  69

Query  621  PSQGNGHERRMFLPMHL  671
             SQG G +  + LP++L
Sbjct  70   SSQGTGADGNLRLPLNL  86



>ref|XP_010097103.1| hypothetical protein L484_019542 [Morus notabilis]
 gb|EXB66904.1| hypothetical protein L484_019542 [Morus notabilis]
Length=464

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD--HGVLPPNPN-NASNLIP  614
            I GPMFPRLHVN  +KGGPRAPPRNKMALYEQLSIPSQR +   GV+P NP  +A+++  
Sbjct  10   IAGPMFPRLHVNYADKGGPRAPPRNKMALYEQLSIPSQRGNSASGVVPLNPKFSANSVPS  69

Query  615  PSPSQGNGHERRMFLPMHLPPS  680
             SPSQG+G ER +F P HLPPS
Sbjct  70   SSPSQGSGFERNLFFPRHLPPS  91



>ref|XP_006293368.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
 gb|EOA26266.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
Length=722

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPS  620
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DHG L  N  +++  +   
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGGLSHNSRSSTTTLVHP  69

Query  621  PSQGNGHERRM  653
             SQ  G ER +
Sbjct  70   GSQSCGVERNL  80



>ref|XP_010526158.1| PREDICTED: protein EARLY FLOWERING 3-like [Tarenaya hassleriana]
Length=664

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 11/73 (15%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-GVLPPNPNNASNLIPPS  620
            IM P+FPRLHV D +KGGPRAPPRNKMALYEQLSIPSQRF+H G+LPP P+N        
Sbjct  10   IMEPLFPRLHVKDADKGGPRAPPRNKMALYEQLSIPSQRFNHQGMLPPGPSN--------  61

Query  621  PSQGNGHERRMFL  659
              Q  G ER  + 
Sbjct  62   --QARGMERNRYF  72



>ref|XP_010267081.1| PREDICTED: protein EARLY FLOWERING 3-like [Nelumbo nucifera]
Length=468

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPP-RNKMALYEQLSIPSQRFDHGVLPP---NPNNASNLI  611
            IMGP+FPRLHVNDTEKGG R PP R KM LYEQL+I SQ  +  + P     P+NA   +
Sbjct  10   IMGPLFPRLHVNDTEKGGLREPPRRRKMTLYEQLNISSQGLNSSLAPTLSLLPDNACTSV  69

Query  612  PP-SPSQGNGHERRMFLPMHLPP  677
            P  S SQG GHER +F P ++PP
Sbjct  70   PSISLSQGGGHERSVFSPFYVPP  92



>ref|XP_010472622.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=714

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNP-NNASNLIPP  617
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  ++ + LI P
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLIHP  69

Query  618  SPSQGNGHERRM  653
              SQ  G ER +
Sbjct  70   PGSQSCGVERNL  81



>ref|XP_004141800.1| PREDICTED: uncharacterized protein LOC101208149 [Cucumis sativus]
 ref|XP_004155977.1| PREDICTED: uncharacterized LOC101208149 [Cucumis sativus]
 gb|KGN45548.1| hypothetical protein Csa_7G452030 [Cucumis sativus]
Length=694

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPN-NASNLIPPS  620
            ++ PMFPRLHVNDTEKGGPRAPPRNKMALYEQL+IP+QRF  G     P  + +   P S
Sbjct  10   LLSPMFPRLHVNDTEKGGPRAPPRNKMALYEQLTIPTQRFTSGSASATPLPSGTPATPTS  69

Query  621  PSQGNGHERRMF  656
            PS   G +R +F
Sbjct  70   PSHFAGQKRGIF  81



>ref|XP_010417373.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=713

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNP-NNASNLIPP  617
            I+ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  ++ + L+ P
Sbjct  10   ILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLVHP  69

Query  618  SPSQGNGHERRM  653
              SQ  G ER +
Sbjct  70   PGSQSCGVERNL  81



>ref|XP_010267078.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nelumbo 
nucifera]
Length=796

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 61/83 (73%), Gaps = 6/83 (7%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGV-----LPPNPNNASNL  608
            I GP+FPRLHVNDTEKGGPRAPPRNKMALYE LSIPSQRF+  +     LPPN N+ +++
Sbjct  10   ITGPLFPRLHVNDTEKGGPRAPPRNKMALYELLSIPSQRFNPRLAPTLPLPPN-NSCTSV  68

Query  609  IPPSPSQGNGHERRMFLPMHLPP  677
               S SQ  GHER +  P +L P
Sbjct  69   SSISSSQSGGHERSVLSPFYLQP  91



>ref|XP_008807709.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Phoenix 
dactylifera]
Length=711

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 60/107 (56%), Gaps = 30/107 (28%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH---GVLPPNPNNASNLIPP  617
            M PMFPRLHVNDT+KGGPRAPPRNKMALYEQLSIPS RF+     V P  P+NAS  +  
Sbjct  1    MRPMFPRLHVNDTDKGGPRAPPRNKMALYEQLSIPSHRFNSKAASVFPLPPHNASTPVSS  60

Query  618  SPSQ---------------------------GNGHERRMFLPMHLPP  677
            + +Q                           G GHER +  P ++PP
Sbjct  61   ASNQKLSFLFASLIHVDMKSKILKRHWCANKGGGHERSVLSPYYIPP  107



>ref|XP_010106119.1| hypothetical protein L484_003122 [Morus notabilis]
 gb|EXC07678.1| hypothetical protein L484_003122 [Morus notabilis]
Length=789

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 75/130 (58%), Gaps = 9/130 (7%)
 Frame = +3

Query  303  FTLFCELWIFYVRVDFKVGILASGLALDV-----LRL-VesrekmkrgkgeekIMGPMFP  464
            F+   +L ++  ++ F V        L V     LR+ +  +  M+ GK  EK+  PMFP
Sbjct  24   FSGCLDLLLWDSKITFHVWNFKCSCCLFVVLDLHLRVEIVVKRSMRGGKDAEKVTSPMFP  83

Query  465  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIPPSPSQGN  635
            RLHV+DTEKGGPRAPPRNKMALYEQLSIPSQRF  G    LP   N++ +++    S   
Sbjct  84   RLHVSDTEKGGPRAPPRNKMALYEQLSIPSQRFTSGSSSTLPHAQNSSGDMVSSISSGQA  143

Query  636  GHERRMFLPM  665
               R MF P 
Sbjct  144  SAYRNMFPPF  153



>ref|XP_010429612.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=706

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPPNP-NNASNLIPP  617
            ++ PMFPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF DH  L  N  ++ + L+ P
Sbjct  10   VLEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHASLSHNSRSSTTTLVHP  69

Query  618  SPSQGNGHERRM  653
              SQ  G ER +
Sbjct  70   LGSQSCGVERNL  81



>ref|XP_006853900.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
 gb|ERN15367.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
Length=784

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
             MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLS+P+Q+ +      N + +++++  S 
Sbjct  19   TMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSVPAQKSNSFSSLSNRDASNSVLSASS  78

Query  624  SQGNGHERRMFLPMHLP  674
            SQ +GH+R  F P+ +P
Sbjct  79   SQVSGHDRSAFPPLRIP  95



>ref|XP_010526070.1| PREDICTED: protein EARLY FLOWERING 3 [Tarenaya hassleriana]
Length=679

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-GVLPPNPNNAS  602
            +M P+FPRLHVND +KGGPRAPPRNKMALYEQLSIPSQRF+H G +PP  +N +
Sbjct  10   MMEPLFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFNHQGTVPPGSSNQT  63



>ref|XP_009117036.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 49/69 (71%), Gaps = 8/69 (12%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-----GVLPPNPNNASNLIPP  617
            PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF       G LPP   N S L+PP
Sbjct  13   PMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPP---NTSPLLPP  69

Query  618  SPSQGNGHE  644
             PS   G +
Sbjct  70   GPSSNQGTD  78



>ref|NP_001288828.1| protein EARLY FLOWERING 3 [Brassica rapa]
 gb|AEB33726.1| EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 49/69 (71%), Gaps = 8/69 (12%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH-----GVLPPNPNNASNLIPP  617
            PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF       G LPP   N S L+PP
Sbjct  13   PMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPP---NTSPLLPP  69

Query  618  SPSQGNGHE  644
             PS   G +
Sbjct  70   GPSSNQGTD  78



>ref|XP_006426449.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
 gb|ESR39689.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
Length=750

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10   VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  615  PSPSQGNGHERRMFLPMHLPPS  680
               S   GHER +F  +   P+
Sbjct  70   SMSSSNGGHERSVFTQLCNSPA  91



>gb|KDO58686.1| hypothetical protein CISIN_1g004483mg [Citrus sinensis]
Length=750

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10   VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  615  PSPSQGNGHERRMFLPMHLPPS  680
               S   GHER +F  +   P+
Sbjct  70   SMSSSNGGHERSVFTQLCNSPA  91



>ref|XP_006466166.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=750

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIP  614
            +  PMFPRLHVND EKGGPRAPPRNKMALYEQLSIPS R+  G   +LP  P N ++L+ 
Sbjct  10   VTSPMFPRLHVNDKEKGGPRAPPRNKMALYEQLSIPSHRYSSGSAPMLPLPPPNGTSLVS  69

Query  615  PSPSQGNGHERRMFLPMHLPPS  680
               S   GHER +F  +   P+
Sbjct  70   SMSSSNGGHERSVFTQLCNSPA  91



>emb|CDY11505.1| BnaA09g40710D [Brassica napus]
Length=592

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPPSPS  626
            PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF     V    P N S L+PP PS
Sbjct  13   PMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRVGGSLPRNTSPLLPPGPS  72

Query  627  QGNG  638
               G
Sbjct  73   SNQG  76



>emb|CDX76735.1| BnaC08g33210D [Brassica napus]
Length=586

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 48/66 (73%), Gaps = 6/66 (9%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH----GVLPPNPNNASNLIPPS  620
            PMFPRLHV D EKGGPRAPPRNKMALYEQLSIPSQRF      G LP   N +S L+PP 
Sbjct  13   PMFPRLHVKDAEKGGPRAPPRNKMALYEQLSIPSQRFTSSDRAGSLP--RNTSSPLLPPG  70

Query  621  PSQGNG  638
            PS   G
Sbjct  71   PSSNQG  76



>gb|EYU29309.1| hypothetical protein MIMGU_mgv1a022839mg [Erythranthe guttata]
Length=621

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/39 (95%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            MGPMFPRLHVNDT+KGGP+APPRNKMALYEQLSIPSQRF
Sbjct  13   MGPMFPRLHVNDTDKGGPKAPPRNKMALYEQLSIPSQRF  51



>gb|AEK05755.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05756.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVSNSPT  74



>gb|AEK05745.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVXNSPT  74



>gb|AEK05746.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVXNSPT  74



>gb|AEK05742.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVCNSPT  74



>gb|AEK05739.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05740.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05741.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05747.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05748.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05749.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05750.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05751.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05753.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVCNSPT  74



>gb|EPS62660.1| hypothetical protein M569_12130, partial [Genlisea aurea]
Length=248

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            M PMFP+LHVND +KGG PRAPPRNKMALYEQL+IPSQR+ +   P   ++ASN++ P P
Sbjct  11   MVPMFPKLHVNDADKGGGPRAPPRNKMALYEQLNIPSQRYSNSAQPKPHSSASNVV-PRP  69

Query  624  SQ  629
            SQ
Sbjct  70   SQ  71



>gb|AEK05754.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EKGGPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKGGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGAG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVSNSPT  74



>ref|XP_004960992.1| PREDICTED: protein EARLY FLOWERING 3-like [Setaria italica]
Length=748

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 56/94 (60%), Gaps = 16/94 (17%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP--------------  581
            +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PS RF                    
Sbjct  14   VMGPLFPRLHVNDTVKGGPRAPPRNKMALYEQFSVPSHRFSAAAAAPAAPAPAPPWHAHR  73

Query  582  PNPNNASNLIP-PSPSQGNGHERRMFLPMHLPPS  680
            P P  A++ +P  S SQ  G +R +F P +  PS
Sbjct  74   PAPGAATSAVPSTSASQAGGSDRPLF-PSYCVPS  106



>ref|XP_007216534.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
 gb|EMJ17733.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
Length=756

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  617
            ++ P+FPR HV+DT+KGGPRAPPRNKMALYEQ SIPSQ F  G   + P P+N   LIPP
Sbjct  10   LISPVFPRFHVDDTDKGGPRAPPRNKMALYEQFSIPSQSFTSGSASMLPRPHNDRRLIPP  69

Query  618  -SPSQGNGHER  647
             S S  + +ER
Sbjct  70   TSWSDVSSNER  80



>ref|XP_008244742.1| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Prunus mume]
Length=750

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  617
            ++ P+FPR HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP
Sbjct  10   LISPVFPRFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPP  69

Query  618  -SPSQGNGHERRMFLP  662
             S S  + +ER +  P
Sbjct  70   TSWSDVSSNERNILTP  85



>ref|XP_008244743.1| PREDICTED: protein EARLY FLOWERING 3 isoform X2 [Prunus mume]
Length=748

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP  617
            ++ P+FPR HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP
Sbjct  10   LISPVFPRFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPP  69

Query  618  -SPSQGNGHERRMFLP  662
             S S  + +ER +  P
Sbjct  70   TSWSDVSSNERNILTP  85



>ref|XP_003567779.1| PREDICTED: protein EARLY FLOWERING 3-like [Brachypodium distachyon]
Length=734

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PSQRF
Sbjct  17   VMGPLFPRLHVNDTLKGGPRAPPRNKMALYEQFSVPSQRF  56



>gb|AEK05743.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05744.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05752.1| early flowering 3, partial [Populus balsamifera]
Length=399

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +3

Query  471  HVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNA-SNLIPPSPSQGNG  638
            HVND EK GPRAPPRNKMALYEQL IPSQRF  G   +LP  PNN  S     S S G G
Sbjct  1    HVNDAEKXGPRAPPRNKMALYEQLCIPSQRFSSGSGSMLPVLPNNGSSLAPSISSSHGTG  60

Query  639  HERRMFLPMHLPPS  680
            HER +F P+   P+
Sbjct  61   HERSVFTPVCNSPT  74



>gb|AEZ53983.1| early flowering protein 3 mutant eam8.k [Hordeum vulgare]
Length=144

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  17   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  64



>ref|XP_010062565.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 ref|XP_010062566.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 gb|KCW69700.1| hypothetical protein EUGRSUZ_F03094 [Eucalyptus grandis]
Length=717

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFD  566
            PMFPR HVNDTEKGGPRAPPRNKMALYEQLSIPSQ F+
Sbjct  5    PMFPRFHVNDTEKGGPRAPPRNKMALYEQLSIPSQSFN  42



>ref|XP_004498925.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498926.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004498927.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=662

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            ++GPMFPRLHVNDT EKGGPRAPPRNKMALYE  ++P QRF       N ++ S+ + PS
Sbjct  15   VVGPMFPRLHVNDTTEKGGPRAPPRNKMALYEHFNVPFQRF---NNNSNSSSNSHPLTPS  71

Query  621  PSQGNGHERRMFLPMHLP  674
             + GN  ER   +P++LP
Sbjct  72   STLGNDPERSYIVPVNLP  89



>ref|XP_004498928.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Cicer arietinum]
Length=626

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            ++GPMFPRLHVNDT EKGGPRAPPRNKMALYE  ++P QRF       N ++ S+ + PS
Sbjct  15   VVGPMFPRLHVNDTTEKGGPRAPPRNKMALYEHFNVPFQRF---NNNSNSSSNSHPLTPS  71

Query  621  PSQGNGHERRMFLPMHLP  674
             + GN  ER   +P++LP
Sbjct  72   STLGNDPERSYIVPVNLP  89



>gb|AEW48250.1| early flowering 3 [Hordeum vulgare]
Length=335

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  18   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  65



>gb|KFK29903.1| early flowering 3 [Arabis alpina]
Length=625

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 2/49 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTE-KGGPRAPPRNKMALYEQLSIPSQRF-DHGVLPP  584
            I+ PMFPRLHVND++ +GGPRAPPRNKMALYEQLSIPSQRF +H ++PP
Sbjct  11   ILEPMFPRLHVNDSDNRGGPRAPPRNKMALYEQLSIPSQRFNNHTLVPP  59



>dbj|BAD97868.1| ELF3 homologue [Lemna paucicostata]
Length=492

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            I  P+FPRLHVND +KGGPRAPPRNKMALYEQ SIPSQRF
Sbjct  10   ISSPLFPRLHVNDADKGGPRAPPRNKMALYEQFSIPSQRF  49



>ref|XP_006408833.1| hypothetical protein EUTSA_v10001926mg [Eutrema salsugineum]
 gb|ESQ50286.1| hypothetical protein EUTSA_v10001926mg [Eutrema salsugineum]
Length=672

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF--DHGVLPPNPNNASNLIPP  617
            I+ PMFPRLHVND ++G PRAPPRNKMALYEQLSIPSQRF  D+G L    +N+S L+PP
Sbjct  10   ILEPMFPRLHVNDADRG-PRAPPRNKMALYEQLSIPSQRFSTDNGAL---LHNSSTLVPP  65

Query  618  S--PSQGNGHERRM  653
                SQ  G ER +
Sbjct  66   VGPSSQPCGVERNL  79



>ref|XP_008650078.1| PREDICTED: protein EARLY FLOWERING 3-like [Zea mays]
 gb|AFW79357.1| hypothetical protein ZEAMMB73_525396 [Zea mays]
Length=647

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PS R+
Sbjct  15   VMGPLFPRLHVNDTLKGGPRAPPRNKMALYEQFSVPSHRY  54



>ref|XP_002440379.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
 gb|EES18809.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
Length=745

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVNDT KGGPRAPPRNKMALYEQ S+PS R+
Sbjct  15   VMGPLFPRLHVNDTLKGGPRAPPRNKMALYEQFSVPSHRY  54



>gb|KEH39954.1| EARLY flowering protein, putative [Medicago truncatula]
Length=618

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 7/79 (9%)
 Frame = +3

Query  447  MGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP--P  617
            +GPMFPRLHVNDT EKGGPRAPPRNKMALYEQ S+P QR    + P + +++SN IP   
Sbjct  12   VGPMFPRLHVNDTTEKGGPRAPPRNKMALYEQFSVPFQR----LNPNSHSSSSNSIPLTS  67

Query  618  SPSQGNGHERRMFLPMHLP  674
            S + GN  ER    P+ LP
Sbjct  68   SSTMGNDLERSNIFPVRLP  86



>ref|NP_001043361.1| Os01g0566100 [Oryza sativa Japonica Group]
 dbj|BAD45081.1| nematode responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF05275.1| Os01g0566100 [Oryza sativa Japonica Group]
Length=396

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLI  611
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G   +     + A +  
Sbjct  17   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGALASARGSLARSTS  76

Query  612  PPSPSQGNGHERRMFLPMHLP  674
              S SQ  G +  +F P ++P
Sbjct  77   AASQSQVYGCDMPLFEPFNVP  97



>gb|KEH39956.1| EARLY flowering protein, putative [Medicago truncatula]
Length=654

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 7/79 (9%)
 Frame = +3

Query  447  MGPMFPRLHVNDT-EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIP--P  617
            +GPMFPRLHVNDT EKGGPRAPPRNKMALYEQ S+P QR    + P + +++SN IP   
Sbjct  12   VGPMFPRLHVNDTTEKGGPRAPPRNKMALYEQFSVPFQR----LNPNSHSSSSNSIPLTS  67

Query  618  SPSQGNGHERRMFLPMHLP  674
            S + GN  ER    P+ LP
Sbjct  68   SSTMGNDLERSNIFPVRLP  86



>dbj|BAJ96537.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEW48247.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
 gb|AEW48249.1| early flowering 3 [Hordeum vulgare]
Length=765

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  17   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  64



>dbj|BAJ94845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  17   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  64



>gb|AEZ53982.1| early flowering protein 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  18   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  65



>gb|AEW48248.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF     P
Sbjct  17   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRFAANTAP  64



>ref|XP_004969003.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Setaria 
italica]
Length=735

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF            S +   S
Sbjct  18   VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRFSSSAASTRAAGGSLVTSTS  77

Query  621  PSQGNGHERRMFLPMHLP  674
             SQ   ++R +F P  +P
Sbjct  78   ASQVYSYDRPLFQPFDVP  95



>gb|ABL11477.1| ELF3 protein [Triticum aestivum]
Length=769

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 2/42 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDT--EKGGPRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVNDT  + GGPRAPPRNKMALYEQ S+PSQRF
Sbjct  14   VMGPLFPRLHVNDTTLKGGGPRAPPRNKMALYEQFSVPSQRF  55



>ref|XP_010546508.1| PREDICTED: uncharacterized protein LOC104818577 [Tarenaya hassleriana]
Length=118

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPN  593
            M P+FPRLH+ND  +GGPRAPPRNKMALYE+LS PS RF+H       N
Sbjct  1    MEPLFPRLHMNDAVRGGPRAPPRNKMALYEELSAPSPRFNHQACSMERN  49



>gb|AGT16850.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16896.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13   VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  621  PSQGNGHERRMFLPMHLP  674
             +Q  G++R +F P  +P
Sbjct  73   AAQVYGYDRTLFQPFDVP  90



>gb|AGT16064.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13   VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  621  PSQGNGHERRMFLPMHLP  674
             +Q  G++R +F P  +P
Sbjct  73   AAQVYGYDRTLFQPFDVP  90



>gb|KEH18269.1| early flowering protein, putative [Medicago truncatula]
Length=730

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D EKGGP+APPRNKMALYEQ SIPSQ F
Sbjct  11   ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIPSQSF  49



>gb|EEE54823.1| hypothetical protein OsJ_02258 [Oryza sativa Japonica Group]
Length=742

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLI  611
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF  G   +     + A +  
Sbjct  17   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGALASARGSLARSTS  76

Query  612  PPSPSQGNGHERRMFLPMHLP  674
              S SQ  G +  +F P ++P
Sbjct  77   AASQSQVYGCDMPLFEPFNVP  97



>ref|NP_001056770.2| Os06g0142600 [Oryza sativa Japonica Group]
 dbj|BAF18684.2| Os06g0142600 [Oryza sativa Japonica Group]
Length=416

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>ref|XP_006646013.1| PREDICTED: protein EARLY FLOWERING 3-like [Oryza brachyantha]
Length=721

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSP  623
            MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS R      P +   AS +   S 
Sbjct  1    MGPLFPRLHVSDAVKGGGPRAPPRNKMALYEQFTVPSHR--RFSAPASSPGASTVPSAST  58

Query  624  SQGNGHERRMFLPMHLP  674
            SQ  G +R +F P ++P
Sbjct  59   SQVYGSDRSLFQPFNVP  75



>gb|KHN11326.1| Protein FAR1-RELATED SEQUENCE 11 [Glycine soja]
Length=1393

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            + PMFPRLHV D EK GP+APPRNKMALYEQ SIPSQ F  G     P    N   P+
Sbjct  701  ISPMFPRLHVKDAEKRGPKAPPRNKMALYEQFSIPSQNFAPGSTSLFPLPLRNYTGPT  758



>ref|XP_007135598.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135600.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135601.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07592.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07594.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07595.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=655

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D EKGGP+APPRNKMALYEQ SIPSQ F
Sbjct  14   ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIPSQSF  52



>ref|XP_007135599.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135602.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135603.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07593.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07596.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07597.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=662

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D EKGGP+APPRNKMALYEQ SIPSQ F
Sbjct  14   ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIPSQSF  52



>ref|NP_001169653.1| uncharacterized protein LOC100383534 [Zea mays]
 gb|ACN34402.1| unknown [Zea mays]
 tpg|DAA58596.1| TPA: hypothetical protein ZEAMMB73_752966 [Zea mays]
Length=756

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF           AS +   +
Sbjct  17   VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRFSSPAASARAAGASLVPSTA  76

Query  621  PSQGNGHERRMFLPMHLP  674
             +Q  G++R +F P  +P
Sbjct  77   AAQVYGYDRTLFQPFDVP  94



>ref|XP_008244744.1| PREDICTED: protein EARLY FLOWERING 3 isoform X3 [Prunus mume]
Length=735

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +3

Query  465  RLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG--VLPPNPNNASNLIPP-SPSQGN  635
            R HVNDT+KGGPR PPRNKMALYEQ SIPSQ F  G   + P P+N   L+PP S S  +
Sbjct  2    RFHVNDTDKGGPRPPPRNKMALYEQFSIPSQSFTSGSASMLPLPHNDRRLVPPTSWSDVS  61

Query  636  GHERRMFLP  662
             +ER +  P
Sbjct  62   SNERNILTP  70



>gb|KHN39274.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=685

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D E+GGP+APPRNKMALYEQ SIPSQ F
Sbjct  15   ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSIPSQNF  53



>gb|AGT17012.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPS  620
            +M P+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF           AS +   S
Sbjct  13   VMSPLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSCPAASARAAGASLVPSTS  72

Query  621  PSQGNGHERRMFLPMHLP  674
             +Q  G++R +F P  +P
Sbjct  73   AAQVYGYDRTLFQPFDVP  90



>gb|EEC70910.1| hypothetical protein OsI_02465 [Oryza sativa Indica Group]
Length=745

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  16   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  56



>dbj|BAL63008.1| Hd17 [Oryza sativa Japonica Group]
 dbj|BAM09630.1| ELF3-like protein [Oryza sativa Japonica Group]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>gb|AGW16337.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16343.1| Hd-q [Oryza sativa Japonica Group]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>dbj|BAM09631.1| ELF3-like protein [Oryza sativa Japonica Group]
Length=768

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>dbj|BAA83571.1| putative early flowering 3 [Oryza sativa Japonica Group]
 gb|EAZ35794.1| hypothetical protein OsJ_20086 [Oryza sativa Japonica Group]
 dbj|BAL63007.1| Hd17 [Oryza sativa Japonica Group]
 gb|AGW16338.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16342.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>dbj|BAL63009.1| Hd17 [Oryza sativa Indica Group]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>gb|EAY99610.1| hypothetical protein OsI_21588 [Oryza sativa Indica Group]
 gb|AGW16339.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16340.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16341.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHVND  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  19   VMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRF  59



>ref|XP_006583033.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006583034.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
Length=709

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D E+GGP+APPRNKMALYEQ S+PSQ F
Sbjct  15   ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSLPSQNF  53



>ref|XP_006583036.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Glycine 
max]
Length=679

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D E+GGP+APPRNKMALYEQ S+PSQ F
Sbjct  15   ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSLPSQNF  53



>ref|XP_006583035.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=686

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D E+GGP+APPRNKMALYEQ S+PSQ F
Sbjct  15   ISPMFPRLHVKDAERGGPKAPPRNKMALYEQFSLPSQNF  53



>ref|XP_006585544.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006585545.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 ref|XP_006585546.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=707

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF  563
            + PMFPRLHV D EK GP+APPRNKMALYEQ SIPSQ F
Sbjct  15   ISPMFPRLHVKDAEKRGPKAPPRNKMALYEQFSIPSQNF  53



>dbj|BAD97872.1| ELF3 homologue [Lemna gibba]
Length=470

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP  551
            + GP+FPRLHVND ++GGPRAPPRNKMALYEQ SIP
Sbjct  10   VFGPLFPRLHVNDADQGGPRAPPRNKMALYEQFSIP  45



>emb|CDY35321.1| BnaA04g15260D [Brassica napus]
Length=599

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNA  599
            PMFPRLHVND +KGG PRAPPRNKMALYE L+IPS RF DH    P   N 
Sbjct  14   PMFPRLHVNDADKGGGPRAPPRNKMALYEHLTIPSHRFTDHHSSSPRHTNT  64



>ref|XP_002458017.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
 gb|EES03137.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
Length=782

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRFDH--GVLPPNPNNASNLIP-PS  620
            P+FPRLHV+D  KGG PRAPPRNKMALYEQL++PS RF              ++L+P  S
Sbjct  14   PLFPRLHVSDAGKGGGPRAPPRNKMALYEQLTVPSNRFSSPAPAPARAAGAKASLVPSTS  73

Query  621  PSQGNGHERRMFLPMHLP  674
             +Q  G++R +F P ++P
Sbjct  74   AAQVYGYDRTLFQPFNVP  91



>ref|XP_009140718.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=602

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNA  599
            PMFPRLHVND +KGG PRAPPRNKMALYE L+IPS RF DH    P   N 
Sbjct  15   PMFPRLHVNDADKGGGPRAPPRNKMALYEHLTIPSHRFTDHHSSSPRHTNT  65



>ref|XP_004969002.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Setaria 
italica]
Length=749

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF  563
            +MGP+FPRLHV+D  KGG PRAPPRNKMALYEQ ++PS RF
Sbjct  18   VMGPLFPRLHVSDAGKGGGPRAPPRNKMALYEQFTVPSNRF  58



>emb|CDY66493.1| BnaCnng51090D [Brassica napus]
Length=553

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  453  PMFPRLHVNDTEKGG-PRAPPRNKMALYEQLSIPSQRF-DHGVLPPNPNNASNLIPPSPS  626
            PMFPRLHVND +KGG PRAPPRNKMALYE L+ PS RF DH   P + N      P   +
Sbjct  15   PMFPRLHVNDADKGGGPRAPPRNKMALYEHLTTPSHRFTDHSSSPRHTNTLFPPPPGPSN  74

Query  627  QGNGHERRM  653
            Q  G ER +
Sbjct  75   QPCGVERNL  83



>ref|XP_004510333.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004510334.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004510335.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=702

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP  551
            + PMFPRLHV D EKGGP+APPRNKMALYEQ SIP
Sbjct  11   ISPMFPRLHVKDAEKGGPKAPPRNKMALYEQFSIP  45



>gb|KJB18568.1| hypothetical protein B456_003G060800 [Gossypium raimondii]
Length=178

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVL  578
            M PMFPRLHVN T KG P+ PPRNK+ALYEQL++P QRF+ G L
Sbjct  8    MSPMFPRLHVNVTNKG-PKTPPRNKIALYEQLNVPFQRFNLGSL  50



>emb|CDO97951.1| unnamed protein product [Coffea canephora]
Length=758

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVL  578
            M P+FPRLH+ND E  GPRAPPRNKMAL EQ++ PSQRF  G +
Sbjct  11   MDPLFPRLHINDAEGIGPRAPPRNKMALCEQVNAPSQRFSSGSM  54



>ref|XP_009778080.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=767

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 11/85 (13%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP--SQRFDH---------GVLPPNPN  593
            M P+FPRLH+ND +KGGPRAPPRNKMAL EQ SI    QRF            +LP  PN
Sbjct  11   MDPLFPRLHINDADKGGPRAPPRNKMALCEQSSITLSPQRFTSTSSPAPGSMSMLPLAPN  70

Query  594  NASNLIPPSPSQGNGHERRMFLPMH  668
             ++++   S S+  G+++ +F   H
Sbjct  71   GSNSIPAASSSRVGGNKKSLFSLSH  95



>ref|XP_002974988.1| hypothetical protein SELMODRAFT_415241 [Selaginella moellendorffii]
 gb|EFJ23773.1| hypothetical protein SELMODRAFT_415241 [Selaginella moellendorffii]
Length=653

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  450  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH  569
            G +FPRLHV +T+  GPRAPPRNKMALYEQL+IPS RF  
Sbjct  10   GALFPRLHVKETKNAGPRAPPRNKMALYEQLTIPSHRFQQ  49



>ref|XP_004242270.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Solanum 
lycopersicum]
Length=766

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPS-QRFDHGVLPPN----PNNASNLI  611
            M P+FPRLH+NDT+KGGPRAPPRNKMAL EQ S  S Q F     P      PN+ +++ 
Sbjct  11   MDPLFPRLHINDTDKGGPRAPPRNKMALCEQSSSRSPQSFTSSSTPATMQMLPNSGNSIS  70

Query  612  PPSPSQGNGHERRMFL  659
              S +    ++R  FL
Sbjct  71   AASSTLVGCNKRNYFL  86



>ref|XP_002978467.1| hypothetical protein SELMODRAFT_443909 [Selaginella moellendorffii]
 gb|EFJ20453.1| hypothetical protein SELMODRAFT_443909 [Selaginella moellendorffii]
Length=766

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 48/84 (57%), Gaps = 15/84 (18%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF-----DHGVLPP-NPNNASN  605
            +  P+FPR+HV+DT + GP+APPRNKMALYEQL++PSQ F        V PP NP  AS 
Sbjct  34   VAEPLFPRVHVSDT-RNGPKAPPRNKMALYEQLTVPSQHFLQRQASGSVWPPMNPAYASQ  92

Query  606  LIPPSPSQGNGHERRMFLPMHLPP  677
              P             F P  +PP
Sbjct  93   YAP--------FASNCFTPCFVPP  108



>dbj|BAL49856.1| arabidopsis ELF3 homolog [Fagopyrum urophyllum]
Length=666

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNAS  602
            M P+ PRLHV DTEKGG + PPRNKMA+YE+L  PS RF +G   + P  PN AS
Sbjct  1    MEPLLPRLHVKDTEKGGAKPPPRNKMAVYEELITPSSRFINGSTIMQPLQPNGAS  55



>ref|XP_001753903.1| predicted protein [Physcomitrella patens]
 gb|EDQ81225.1| predicted protein [Physcomitrella patens]
Length=960

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  456  MFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLP  581
            +FPRLHV +T+K GPR PPRNKMALYEQL+IPS R+    LP
Sbjct  19   LFPRLHVAETKKAGPRGPPRNKMALYEQLTIPSHRYKMSPLP  60



>gb|ABP81864.1| EARLY FLOWERING 3 [Pisum sativum]
Length=339

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +3

Query  492  GGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPSQ-GNGHERRMFLPMH  668
            GGPRAPPRNKMALYEQ SIPSQRF+   LP +PN ++N +PP   + G+   R    P H
Sbjct  1    GGPRAPPRNKMALYEQFSIPSQRFN---LPLHPNTSNNSVPPGFLEPGDCPRRNYVFPGH  57

Query  669  LPP  677
            L P
Sbjct  58   LTP  60



>ref|XP_002970302.1| hypothetical protein SELMODRAFT_411196 [Selaginella moellendorffii]
 gb|EFJ28432.1| hypothetical protein SELMODRAFT_411196 [Selaginella moellendorffii]
Length=759

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 7/63 (11%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRF----DHGVLPP--NPNNASN  605
            +  P+FPR+HV+DT + GP+APPRNKMALYEQL++PSQ F      G++ P  NP  AS 
Sbjct  34   VAEPLFPRVHVSDT-RNGPKAPPRNKMALYEQLTVPSQHFLQRQTSGLVWPPMNPAYASQ  92

Query  606  LIP  614
              P
Sbjct  93   YAP  95



>ref|XP_001766802.1| predicted protein [Physcomitrella patens]
 gb|EDQ68433.1| predicted protein [Physcomitrella patens]
Length=1796

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 9/78 (12%)
 Frame = +3

Query  456  MFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH--------GVLPPNPNNASNLI  611
            +FPRLHV +T+K GPR PPRNKMALYEQL++PS R+          G +   P+  +++ 
Sbjct  37   LFPRLHVAETKKAGPRGPPRNKMALYEQLAVPS-RYKQSPMLLPSSGRMVTTPSMTTSIF  95

Query  612  PPSPSQGNGHERRMFLPM  665
             P     +   R  ++PM
Sbjct  96   QPQAQASSYDSRYSYMPM  113


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 10/86 (12%)
 Frame = +3

Query  336   VRVDFKV---------GILASG-LALDVLRLVesrekmkrgkgeekIMGPMFPRLHVNDT  485
             V+V+ KV         G+L S  ++   ++   S E    G  ++++   +FPRLHV +T
Sbjct  955   VKVNIKVQCLRQFRGQGVLGSATMSFRNIKTKGSMEGKADGSKQQEVGAALFPRLHVAET  1014

Query  486   EKGGPRAPPRNKMALYEQLSIPSQRF  563
             +K GPR PPRNKMAL EQL+IPS +F
Sbjct  1015  KKAGPRGPPRNKMALSEQLTIPSHKF  1040



>ref|XP_002977406.1| hypothetical protein SELMODRAFT_443557 [Selaginella moellendorffii]
 gb|EFJ21410.1| hypothetical protein SELMODRAFT_443557 [Selaginella moellendorffii]
Length=526

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  450  GPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDH  569
            G +FPRLHV +T+  GPRAPPRNKMALYEQ ++PS R   
Sbjct  10   GALFPRLHVKETKNAGPRAPPRNKMALYEQFTVPSHRCQQ  49



>ref|XP_009625226.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=769

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 13/87 (15%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIP--SQRFDHGVLP-PNPN--------  593
            M P+FPRLH+ND +KGGPRAPPRNKMAL E  S+    QRF     P P P         
Sbjct  11   MDPLFPRLHINDADKGGPRAPPRNKMALCEHSSVTLSPQRFTSTSAPAPAPGSMSMLPLL  70

Query  594  -NASNLIP-PSPSQGNGHERRMFLPMH  668
             N+SN IP PS S    +++ +F   H
Sbjct  71   PNSSNSIPAPSSSLVGCNKKSLFSLSH  97



>dbj|BAL49858.1| arabidopsis ELF3 homolog [Fagopyrum tataricum]
Length=475

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNPNNASNLIPPSPS  626
            M P+FPRL++  TEKGGP+ PPRNKMA++E+   PS RF +G +   P + S  +P S +
Sbjct  1    MEPLFPRLYLKTTEKGGPKPPPRNKMAVHEEPIAPSSRFTNGSITMLPLHPSGGVPISQA  60

Query  627  ----QGNGHERRM  653
                Q NG E++ 
Sbjct  61   GSSRQVNGSEKKT  73



>dbj|BAL49855.1| self-incompatibility locus early-flowering 3 [Fagopyrum cymosum]
Length=670

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 5/74 (7%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG---VLPPNPNNASNLIPP  617
            M P+FPRL++  TEKGGP+ PPRNKMA++E+   PS RF +G   +LP +P+    LI  
Sbjct  1    MEPLFPRLYLKTTEKGGPKPPPRNKMAVHEEPIAPSSRFTNGSITMLPLHPSGGLPLISQ  60

Query  618  SPS--QGNGHERRM  653
            + S  Q NG E++ 
Sbjct  61   AGSSRQVNGSEKKT  74



>gb|KEH18268.1| hypothetical protein MTR_8g015470 [Medicago truncatula]
Length=86

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQL  542
            + P+FPRLH+ D EKGGP++PP NKMALYEQ 
Sbjct  42   ISPIFPRLHIKDLEKGGPKSPPTNKMALYEQF  73



>ref|XP_006357460.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=762

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHG----VLPPNPNNASNLIP  614
            M P+FPRLH+ND +KGGPRAPPRNKMAL EQ S  S           + P P N+ N IP
Sbjct  11   MDPLFPRLHINDADKGGPRAPPRNKMALCEQSSPQSFTSSSTPATMTILPLPPNSGNSIP  70

Query  615  PSPSQGNGHERRMFL  659
             + S   G  +R + 
Sbjct  71   AASSSLVGCNKRNYF  85



>ref|XP_011080316.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080323.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080331.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080336.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080344.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=756

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSI  548
            M P+FPRLH+ND +KGGPR PPRNKMAL EQ ++
Sbjct  11   MDPLFPRLHINDADKGGPRPPPRNKMALCEQYNV  44



>ref|XP_010536213.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Tarenaya 
hassleriana]
Length=497

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSI  548
            ++ P+FPR+H+ DTEKG  RAPPRNKMALYE+ +I
Sbjct  11   LVKPLFPRVHLRDTEKGSYRAPPRNKMALYERFTI  45



>ref|XP_011072464.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=581

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 16/73 (22%)
 Frame = +3

Query  444  IMGPMFPRLHVNDTEKGGPRAPPRNKMALYEQLSIPSQRFDHGVLPPNP-NNASNLIPPS  620
            +M P+FPRLH++D +KGGP+APPRNKMA+               LP  P N+ ++ +P +
Sbjct  10   LMDPLFPRLHIDDADKGGPKAPPRNKMAM---------------LPIQPTNDHTSSLPQA  54

Query  621  PSQGNGHERRMFL  659
             S   GH    F 
Sbjct  55   SSSQVGHRLATFC  67



>gb|EPS67106.1| hypothetical protein M569_07670 [Genlisea aurea]
Length=244

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  447  MGPMFPRLHVNDTEKGGPRAPPRNKMALYEQ  539
            + P+FP+LH+N+ +KGGPRAPPRNKMA+  Q
Sbjct  11   VEPLFPKLHLNEVDKGGPRAPPRNKMAVSHQ  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240