BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028F08

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    174   4e-47   Nicotiana tomentosiformis
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    173   1e-46   Solanum tuberosum [potatoes]
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    172   1e-46   Solanum tuberosum [potatoes]
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    171   7e-46   Nicotiana sylvestris
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    170   1e-45   Solanum lycopersicum
emb|CDP07209.1|  unnamed protein product                                168   5e-45   Coffea canephora [robusta coffee]
gb|KJB25097.1|  hypothetical protein B456_004G177500                    160   3e-43   Gossypium raimondii
gb|KJB25101.1|  hypothetical protein B456_004G177500                    161   2e-42   Gossypium raimondii
gb|KJB25099.1|  hypothetical protein B456_004G177500                    160   2e-42   Gossypium raimondii
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg                160   3e-42   Erythranthe guttata [common monkey flower]
gb|KJB25098.1|  hypothetical protein B456_004G177500                    160   3e-42   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                    160   6e-42   Gossypium raimondii
ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...    159   1e-41   Sesamum indicum [beniseed]
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...    159   1e-41   Sesamum indicum [beniseed]
ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...    158   2e-41   Sesamum indicum [beniseed]
gb|KJB25104.1|  hypothetical protein B456_004G177500                    157   4e-41   Gossypium raimondii
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                     157   4e-41   Eucalyptus grandis [rose gum]
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                    157   7e-41   Arabis alpina [alpine rockcress]
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...    156   1e-40   
emb|CDP07210.1|  unnamed protein product                                156   2e-40   Coffea canephora [robusta coffee]
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...    155   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967    155   2e-40   Camelina sativa [gold-of-pleasure]
gb|EPS61566.1|  hypothetical protein M569_13228                         152   4e-40   Genlisea aurea
gb|KHF98530.1|  hypothetical protein F383_12515                         153   8e-40   Gossypium arboreum [tree cotton]
emb|CDX84192.1|  BnaC04g09540D                                          153   1e-39   
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343    153   1e-39   Brassica rapa
emb|CDY31704.1|  BnaA05g08430D                                          153   1e-39   Brassica napus [oilseed rape]
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666             152   3e-39   
gb|KJB51494.1|  hypothetical protein B456_008G219000                    149   4e-39   Gossypium raimondii
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...    152   4e-39   Populus euphratica
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg             152   4e-39   Capsella rubella
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...    151   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987    151   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007040866.1|  Xyloglucanase 113 isoform 2                        150   6e-39   
ref|NP_850250.1|  xyloglucanase 113                                     151   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31566.1|  hypothetical protein JCGZ_15383                         151   7e-39   Jatropha curcas
ref|XP_007040867.1|  Xyloglucanase 113 isoform 3                        150   8e-39   
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321    150   9e-39   Camelina sativa [gold-of-pleasure]
dbj|BAH19600.1|  AT2G35610                                              150   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609    150   1e-38   Fragaria vesca subsp. vesca
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                        150   2e-38   
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...    150   2e-38   Populus euphratica
emb|CDY32116.1|  BnaC04g44500D                                          150   2e-38   Brassica napus [oilseed rape]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...    150   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg             149   2e-38   Eutrema salsugineum [saltwater cress]
gb|KJB51493.1|  hypothetical protein B456_008G219000                    149   4e-38   Gossypium raimondii
gb|KHG12902.1|  hypothetical protein F383_16835                         149   5e-38   Gossypium arboreum [tree cotton]
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g             148   6e-38   
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...    148   6e-38   Brassica rapa
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...    148   6e-38   Brassica rapa
emb|CDY40459.1|  BnaA04g20580D                                          148   7e-38   Brassica napus [oilseed rape]
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...    145   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346    144   2e-36   Glycine max [soybeans]
gb|KHN27499.1|  hypothetical protein glysoja_018611                     144   2e-36   Glycine soja [wild soybean]
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg             143   4e-36   Prunus persica
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...    143   5e-36   
emb|CDP12730.1|  unnamed protein product                                142   7e-36   Coffea canephora [robusta coffee]
gb|KHG12903.1|  hypothetical protein F383_16835                         141   2e-35   Gossypium arboreum [tree cotton]
emb|CDP12729.1|  unnamed protein product                                140   3e-35   Coffea canephora [robusta coffee]
ref|XP_007156343.1|  hypothetical protein PHAVU_003G278500g             139   3e-35   Phaseolus vulgaris [French bean]
emb|CDP12731.1|  unnamed protein product                                140   7e-35   Coffea canephora [robusta coffee]
ref|XP_010676706.1|  PREDICTED: uncharacterized protein LOC104892...    139   7e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...    139   9e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519934.1|  reticulon3-A3, putative                            139   9e-35   Ricinus communis
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897    139   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...    139   1e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg             139   2e-34   Citrus clementina [clementine]
gb|KHN03113.1|  hypothetical protein glysoja_049543                     138   2e-34   Glycine soja [wild soybean]
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032    139   2e-34   Glycine max [soybeans]
ref|XP_010111777.1|  hypothetical protein L484_008781                   138   3e-34   Morus notabilis
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601    138   4e-34   Cicer arietinum [garbanzo]
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...    140   5e-34   Glycine soja [wild soybean]
emb|CAN79199.1|  hypothetical protein VITISV_040773                     138   5e-34   Vitis vinifera
ref|XP_008782814.1|  PREDICTED: uncharacterized protein LOC103702...    133   7e-34   Phoenix dactylifera
emb|CBI29197.3|  unnamed protein product                                137   9e-34   Vitis vinifera
ref|XP_008782812.1|  PREDICTED: uncharacterized protein LOC103702...    133   9e-34   Phoenix dactylifera
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017    137   9e-34   Vitis vinifera
gb|EPS61907.1|  hypothetical protein M569_12886                         131   1e-33   Genlisea aurea
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                   135   3e-33   Citrus sinensis [apfelsine]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765    135   3e-33   Citrus sinensis [apfelsine]
gb|AAD15452.2|  unknown protein                                         132   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463    133   2e-32   Glycine max [soybeans]
ref|XP_006878624.1|  hypothetical protein AMTR_s00011p00260650          133   2e-32   Amborella trichopoda
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...    133   3e-32   Medicago truncatula
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                  132   3e-32   
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338    132   5e-32   Glycine max [soybeans]
gb|KHN05539.1|  hypothetical protein glysoja_020504                     132   6e-32   Glycine soja [wild soybean]
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                  132   7e-32   
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...    132   7e-32   Medicago truncatula
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624    131   1e-31   Cucumis melo [Oriental melon]
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g             129   6e-31   Phaseolus vulgaris [French bean]
gb|KJB25103.1|  hypothetical protein B456_004G177500                    127   8e-31   Gossypium raimondii
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732    128   1e-30   Cucumis sativus [cucumbers]
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789    128   1e-30   Setaria italica
ref|NP_001143144.1|  hypothetical protein                               126   5e-30   Zea mays [maize]
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...    125   1e-29   Elaeis guineensis
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...    125   1e-29   Elaeis guineensis
gb|EMS55953.1|  hypothetical protein TRIUR3_26709                       124   3e-29   Triticum urartu
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590          124   3e-29   Sorghum bicolor [broomcorn]
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...    122   7e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389    123   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311    122   1e-28   
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257    121   3e-28   
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970    120   6e-28   Brachypodium distachyon [annual false brome]
ref|NP_001050567.1|  Os03g0586300                                       115   1e-26   
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914    117   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75649.1|  hypothetical protein OsI_12401                          114   9e-26   Oryza sativa Indica Group [Indian rice]
gb|ABF97349.1|  expressed protein                                       114   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002991425.1|  glycosyltransferase-like protein                   111   1e-24   
ref|XP_002988322.1|  glycosyltransferase-like protein                   110   2e-24   
ref|XP_001761094.1|  predicted protein                                  102   2e-21   
emb|CDX84232.1|  BnaC04g09940D                                        97.1    2e-21   
gb|EPS68350.1|  hypothetical protein M569_06419                         101   3e-21   Genlisea aurea
ref|XP_006650304.1|  PREDICTED: uncharacterized protein LOC102706084    100   1e-20   Oryza brachyantha
ref|XP_005843950.1|  hypothetical protein CHLNCDRAFT_37217            63.5    2e-08   Chlorella variabilis
ref|XP_005649227.1|  hypothetical protein COCSUDRAFT_62105            62.0    6e-08   Coccomyxa subellipsoidea C-169
ref|XP_005852062.1|  hypothetical protein CHLNCDRAFT_133059           61.6    9e-08   Chlorella variabilis
ref|XP_005758156.1|  hypothetical protein EMIHUDRAFT_77405            61.2    1e-07   Emiliania huxleyi CCMP1516
ref|XP_002956226.1|  hypothetical protein VOLCADRAFT_97156            60.5    2e-07   Volvox carteri f. nagariensis
gb|KDD76569.1|  nucleotide-diphospho-sugar transferase                60.5    2e-07   Helicosporidium sp. ATCC 50920
ref|XP_011398427.1|  hypothetical protein F751_0558                   57.8    1e-06   Auxenochlorella protothecoides
ref|XP_005760837.1|  hypothetical protein EMIHUDRAFT_465597           58.2    1e-06   Emiliania huxleyi CCMP1516
ref|XP_003078397.1|  unnamed protein product                          57.8    1e-06   
emb|CEF97310.1|  Nucleotide-diphospho-sugar transferase               57.0    3e-06   Ostreococcus tauri
ref|XP_011397700.1|  hypothetical protein F751_1691                   54.7    1e-05   Auxenochlorella protothecoides
gb|KIZ02110.1|  hypothetical protein MNEG_5845                        53.9    3e-05   Monoraphidium neglectum
ref|XP_007509006.1|  predicted protein                                53.9    3e-05   Bathycoccus prasinos
ref|XP_005772161.1|  hypothetical protein EMIHUDRAFT_117868           53.1    5e-05   Emiliania huxleyi CCMP1516
ref|XP_002506735.1|  glycosyltransferase family 77 protein            53.1    6e-05   Micromonas commoda
ref|XP_007512211.1|  predicted protein                                52.8    8e-05   Bathycoccus prasinos
ref|XP_005709932.1|  glycosyl transferase family GT77 cell wall p...  52.4    8e-05   Chondrus crispus [carageen]
ref|XP_001692787.1|  predicted protein                                52.0    1e-04   Chlamydomonas reinhardtii
ref|XP_011395852.1|  hypothetical protein F751_0343                   52.0    1e-04   Auxenochlorella protothecoides



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 129/176 (73%), Gaps = 8/176 (5%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +EMANSKPLFLTIYATV +G+VFS  YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
              A   +Q  N S     G       Q +SK LKPIWI PP GS+MP LE+FRL+KEL +
Sbjct  60   AKAEPSSQASNFSRLQADGDSTPLNPQLQSKLLKPIWIVPPAGSKMPYLESFRLSKELVE  119

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ERV  NV++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PV
Sbjct  120  ERVIGNVVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPV  175



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 129/176 (73%), Gaps = 9/176 (5%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +EMANSKPLFLTIYATV +G+VFS  YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
            V A    Q  N S +    +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL Q
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ERV DN+++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PV
Sbjct  119  ERVTDNIVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPV  174



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 129/176 (73%), Gaps = 9/176 (5%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +EMANSKPLFLTIYATV +G+VFS  YVFSA+YSS  ++ S           +APS S D
Sbjct  8    KEMANSKPLFLTIYATVLIGIVFSSVYVFSAIYSSPNSTFS---------LSMAPSTSSD  58

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
            V A    Q  N S +    +    K Q +SK LKPIW  PP GS+M  LETF+L+KEL Q
Sbjct  59   VKAEPSVQASNFSHRQVDDASIPVKPQHQSKLLKPIWKVPPAGSKMLDLETFKLSKELVQ  118

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ERV DN+++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PV
Sbjct  119  ERVTDNIVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPV  174



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +EMANSKPLF+TIYATV +G+VFS  YVFSA+YSS  +S+ +          IAPS S D
Sbjct  8    KEMANSKPLFMTIYATVLIGIVFSSVYVFSAIYSSPHSSTFS--------LSIAPSASSD  59

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
              A   +Q  N S     G       Q +SK LK IW  PP GS+MP LE+FRL+KEL Q
Sbjct  60   AEAEPSSQASNFSRLQADGHSTPLNPQLQSKLLKAIWTVPPAGSKMPDLESFRLSKELVQ  119

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ERV  NV++VTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+PV
Sbjct  120  ERVIGNVVVVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPV  175



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 126/176 (72%), Gaps = 9/176 (5%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +EMANSKPLFLTIYATV +G+VFS  YVFSA+YSS  ++ S           IAPS S D
Sbjct  8    KEMANSKPLFLTIYATVVIGIVFSSVYVFSAIYSSPNSTFS---------LSIAPSASSD  58

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
              A    Q  N S +         K Q + K LKPIW  PP GS+MP LETF+L+KEL Q
Sbjct  59   EKAEPSVQASNFSHRQVDDVSIPVKPQLQRKLLKPIWEVPPAGSKMPDLETFKLSKELVQ  118

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ERV DN++IVTFGNYAFMDFILTWVKHLTDM V+NLLVGA+DTKLLEALYWKG+P 
Sbjct  119  ERVIDNIVIVTFGNYAFMDFILTWVKHLTDMGVENLLVGAMDTKLLEALYWKGVPA  174



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 136/177 (77%), Gaps = 13/177 (7%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
            +++MAN KP+FLTIYATV VGVV S FYVFSAVYSSS++SSS+  +S +        +SP
Sbjct  8    IKDMANYKPVFLTIYATVVVGVVVSSFYVFSAVYSSSSSSSSSSSSSLW--------FSP  59

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
                 V  Q+ N S    V       +Q +SKS+KPIW +PP GS+MP L+TFRLTKEL 
Sbjct  60   -----VQNQVSNSSHVTVVNVSLGSTSQTQSKSMKPIWEAPPSGSKMPPLKTFRLTKELV  114

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            Q+RV+DNVI+VTFGNYAFMDFILTWVKHLTD+ VDNLLVGA+DTKL+EALYWKG+PV
Sbjct  115  QQRVKDNVIVVTFGNYAFMDFILTWVKHLTDLGVDNLLVGAMDTKLVEALYWKGVPV  171



>gb|KJB25097.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=399

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAV------------LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAV------------LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>gb|KJB25099.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
 gb|KJB25100.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=519

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAV------------LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
            ++E+  S+PLFLTIYATV VG++ S FYVFSAV+S S + SS   +S      +  + SP
Sbjct  7    LKEVTTSRPLFLTIYATVIVGILVSSFYVFSAVFSGSNSVSSPWFSSLSPAGDVVRASSP  66

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
                A      N S +  +GS     ++ K   L PIW +PPPGS MP LETFRLTKEL 
Sbjct  67   SFNGA-----SNSSHEVVIGSAPNLPSRPKKTPLSPIWKAPPPGSEMPPLETFRLTKELV  121

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            Q+RV+DNVIIVTFGN+AFMDFILTWVKHL+DM V+N LVGA+DTKL+EALYWKG+PV
Sbjct  122  QQRVKDNVIIVTFGNFAFMDFILTWVKHLSDMGVENFLVGAMDTKLVEALYWKGVPV  178



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAV------------LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAV------------LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP  P +             L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSAPTSTQSISTSWLSSPPLSQNGGSNFSNNISQPTDKASQPGSNQLKTIWEAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
            ++E AN++PLFLTIYATV +G+  S FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPV
Sbjct  122  QQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPV  178



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
            ++E AN++PLFLTIYATV +G+  S FYVFSAV+SSS + SS   ++S     +A + SP
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSPWFSTSPPSGDVAEASSP  66

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
                   +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKEL 
Sbjct  67   S-----FSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKELV  121

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPV
Sbjct  122  QQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPV  178



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 130/179 (73%), Gaps = 10/179 (6%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
            ++E AN++PLFLTIYATV +G+  S FYVFSAV+SSS + SS         F  +P  S 
Sbjct  7    LKEAANARPLFLTIYATVIIGIFVSSFYVFSAVFSSSNSVSSP-------WFSTSPP-SG  58

Query  283  DVPAAV--LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  456
            DV A+    +Q  N S +  V       +    K LKP+W +P PGS+MP LETF+LTKE
Sbjct  59   DVAASSPSFSQPSNASRQIVVSIAPDSASVPGRKFLKPLWKAPLPGSKMPPLETFKLTKE  118

Query  457  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            L Q+RV+DNVI+VTFGN+AFMDFILTWVKHL+DM VDNLLVGA+DTKLLEALYWKGIPV
Sbjct  119  LVQQRVKDNVIVVTFGNFAFMDFILTWVKHLSDMGVDNLLVGAMDTKLLEALYWKGIPV  177



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 112/180 (62%), Gaps = 26/180 (14%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
            YSP  P +  TQ  + S   +    Q   +Q  S  LK IW +PP  S+MP LE+F+LTK
Sbjct  41   YSPSAPTS--TQSISTSWLSSPPLSQNKASQPGSNQLKTIWEAPPSNSKMPPLESFKLTK  98

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTKLLEALYWKG+PV
Sbjct  99   ELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTKLLEALYWKGVPV  158



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 126/193 (65%), Gaps = 33/193 (17%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            K+  QE+A+S+PLFLTIYATV  G+V S  YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  274  YSPDVPAAVLT------------QIHNESLKXTVGSPQ-APKTQAKSKSLKPIWISPPPG  414
             SPD  + + +            Q  N SL  TVG+   AP +Q        +W+ PP  
Sbjct  45   SSPDSTSWLSSPSSLSYVDSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKS  103

Query  415  SRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDT  594
            S+MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DT
Sbjct  104  SKMPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDT  163

Query  595  KLLEALYWKGIPV  633
            KLLEALYWKGIPV
Sbjct  164  KLLEALYWKGIPV  176



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 125/192 (65%), Gaps = 29/192 (15%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   +E  NSKPLF+TIYATV +GV+ S FYVFSA+YS                 P   S
Sbjct  6    RNGFREATNSKPLFVTIYATVIIGVLVSSFYVFSAIYS-----------------PSNGS  48

Query  274  YS--PDVPAAVLTQI-HNESLKXTVGSPQAPKTQ---------AKSKSLKPIWISPPPGS  417
            YS     P +   +I H      TV  P AP  Q         A+ KSL  IW+SPP   
Sbjct  49   YSWLSSPPLSTSGRIYHPPQENTTVELPVAPPPQVLPLPTPEEAQGKSLGKIWVSPPRDK  108

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTK
Sbjct  109  KMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTK  168

Query  598  LLEALYWKGIPV  633
            LLEALYWKGIPV
Sbjct  169  LLEALYWKGIPV  180



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 126/191 (66%), Gaps = 31/191 (16%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            K+  QE+A+S+PLFLTIYATV  G+V S  YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  274  YSPDVPAAVLT----------QIHNESLKXTVGSPQ-APKTQAKSKSLKPIWISPPPGSR  420
             SPD  + + +          Q  N SL  TVG+   AP +Q        +W+ PP  S+
Sbjct  45   SSPDSTSWLSSPSSLSYSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKSSK  103

Query  421  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  600
            MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DTKL
Sbjct  104  MPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDTKL  163

Query  601  LEALYWKGIPV  633
            LEALYWKGIPV
Sbjct  164  LEALYWKGIPV  174



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 10/179 (6%)
 Frame = +1

Query  112  MANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapias-----sfsLFPIAPSY  276
            MAN KP+FLTIYA V VGVV S FYVFSAVYSSS++SSS+  +S         + I  ++
Sbjct  1    MANYKPVFLTIYAAVVVGVVVSSFYVFSAVYSSSSSSSSSSSSSLWFSPGTFGYLILLAF  60

Query  277  SPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  456
            SP        Q+ N S    V       +Q +SKS+ PIW  PP GS+MP L+TF+LTKE
Sbjct  61   SP-----AQNQVSNCSHLTVVNVSLGSASQTQSKSMMPIWEVPPSGSKMPPLKTFKLTKE  115

Query  457  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            L Q+RV+DNV++VTFGNYAFMDFILTWVKHLTD+ VDNLLVGA+DTK++EALYWKG+PV
Sbjct  116  LVQQRVKDNVVVVTFGNYAFMDFILTWVKHLTDLGVDNLLVGAMDTKMVEALYWKGVPV  174



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 126/193 (65%), Gaps = 33/193 (17%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            K+  QE+A+S+PLFLTIYATV  G+V S  YVFSAV+S                   A  
Sbjct  4    KDSCQEVASSRPLFLTIYATVIAGIVLSSLYVFSAVFS-------------------ANK  44

Query  274  YSPDVPAAVLT------------QIHNESLKXTVGSPQ-APKTQAKSKSLKPIWISPPPG  414
             SPD  + + +            Q  N SL  TVG+   AP +Q        +W+ PP  
Sbjct  45   SSPDSTSWLSSPSSLSYVDSHSGQAFNSSLATTVGAAAPAPSSQHGDALANSMWV-PPKS  103

Query  415  SRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDT  594
            S+MPSL+TFRLTKEL ++RV+DNVIIVTFGNYAFMDFIL+WVKHLTD++V NLLVGA+DT
Sbjct  104  SKMPSLKTFRLTKELVEQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLNVYNLLVGAMDT  163

Query  595  KLLEALYWKGIPV  633
            KLLEALYWKGIPV
Sbjct  164  KLLEALYWKGIPV  176



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MPSLETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPSLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPV  182



>gb|EPS61566.1| hypothetical protein M569_13228, partial [Genlisea aurea]
Length=430

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  370  KSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHL  549
            ++KSL PIW  PPPGS+MP LETFRLTKE+ Q+RVR NVI+VTFGN+AFMDFILTWVKHL
Sbjct  5    QNKSLVPIWQVPPPGSKMPPLETFRLTKEMVQQRVRGNVIVVTFGNFAFMDFILTWVKHL  64

Query  550  TDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +DM+VDN+LVGA+DTKLLEALYW G+PV
Sbjct  65   SDMNVDNILVGAMDTKLLEALYWAGVPV  92



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 112/192 (58%), Gaps = 36/192 (19%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIY T+ VG+V +                          +  +  
Sbjct  5    RNAVQEAAASKPLFLTIYTTIIVGIVATS------------------------FYVFSAI  40

Query  274  YSPD------------VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGS  417
            YSP             + +  L+Q    +    +  P    +Q  S  LK IW +PP  S
Sbjct  41   YSPSASTSTQSISTSWLSSPPLSQNGGSNFSNNISLPTDKASQPGSNQLKTIWQAPPSNS  100

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            +MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTK
Sbjct  101  KMPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTK  160

Query  598  LLEALYWKGIPV  633
            LLEALYWKG+PV
Sbjct  161  LLEALYWKGVPV  172



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAQGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PV
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPV  181



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PV
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPV  181



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAEGKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ NLLVGA+DTKLLEALYWKG+PV
Sbjct  152  HLTDLDISNLLVGAMDTKLLEALYWKGVPV  181



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ +SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  92   EAQGRSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  151

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  152  HLTDLDLSNILVGAMDTKLLEALYWKGVPV  181



>gb|KJB51494.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=391

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 18/180 (10%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV +G V S FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   QE+ANSKPLF+ IYATV +G+VF   YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  274  YSPDVPAAV-LTQIHNESLKXTVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLETFRL  447
             SP +P ++ + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+TFRL
Sbjct  65   SSPPIPTSIDVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLKTFRL  124

Query  448  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  627
            TK+L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGI
Sbjct  125  TKQLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALYWKGI  184

Query  628  PV  633
            PV
Sbjct  185  PV  186



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            + K KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  94   EPKGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  153

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  154  HLTDLDLSNILVGAMDTKLLEALYWKGVPV  183



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 124/180 (69%), Gaps = 15/180 (8%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  V+E  NSKPLF+TIY TV VGV+ S F+VFSA+YS S  SSS   +   S     P 
Sbjct  5    RNAVREATNSKPLFVTIYGTVIVGVIVSSFFVFSAIYSPSNGSSSWLSSPPLSSVGRFPI  64

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             SP    + L              P +P +Q++ KSL PIW+ PP   +MP LETFRLTK
Sbjct  65   QSPSNATSDL--------------PVSPPSQSQGKSLNPIWV-PPQEKKMPPLETFRLTK  109

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL  ERV+DNV+IVTFGN+AFMDFILTWVKHLTD+ + N+LVGA+DTKLLEALYWKGIPV
Sbjct  110  ELVGERVKDNVVIVTFGNFAFMDFILTWVKHLTDLGLSNILVGAMDTKLLEALYWKGIPV  169



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDFILTWVK  152

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPV  182



>ref|XP_007040866.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
 gb|EOY25367.1| Xyloglucanase 113 isoform 2 [Theobroma cacao]
Length=518

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 126/180 (70%), Gaps = 10/180 (6%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV VG+V S FYVFSA+YS SA+++ +   S  S       
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQSVSTSWLS-------  57

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F LTK
Sbjct  58   -SPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSLTK  114

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIP 
Sbjct  115  ELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPA  174



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  153  HLTDLDLSNILVGAMDTKLLEALYWKGVPV  182



>gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 131/182 (72%), Gaps = 7/182 (4%)
 Frame = +1

Query  88   LEKEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIA  267
            L +   Q + N+KPLFLTIYATV VG++FS FYVFSAVYSSS+ S++  ++S  S     
Sbjct  11   LWRNAYQAVVNTKPLFLTIYATVVVGILFSSFYVFSAVYSSSSLSATTWLSSPPSSLSRH  70

Query  268  PSYSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  447
               S ++          E+    V SP     + ++K LKPIW +PP  S+MPS++ FRL
Sbjct  71   IDQSSNIS-------QQEAKSIVVVSPPIKTLRPQTKQLKPIWEAPPGNSKMPSIKKFRL  123

Query  448  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  627
            TK++ +ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+
Sbjct  124  TKKMVEERVQDNVIIVTFGNYAFMDFILTWVKHLTDLGLSNLLVGAMDTKLLEALYWKGV  183

Query  628  PV  633
            PV
Sbjct  184  PV  185



>ref|XP_007040867.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
 gb|EOY25368.1| Xyloglucanase 113 isoform 3 [Theobroma cacao]
Length=546

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 14/181 (8%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV VG+V S FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  274  Y--SPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  447
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  448  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  627
            TKEL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGI
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGI  172

Query  628  P  630
            P
Sbjct  173  P  173



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ER +DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGKSLGKIWVSPPRDKKMPPLETFKLTKELFGERAKDNVIIVTFGNYAFMDFILTWVK  152

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+L+GA+DTKLLEALYWKG+PV
Sbjct  153  HLTDLDLSNILIGAMDTKLLEALYWKGVPV  182



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+  SL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVK
Sbjct  93   EAQGNSLGKIWVSPPRDKKMPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVK  152

Query  544  HLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            HLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  153  HLTDLDLSNILVGAVDTKLLEALYWKGVPV  182



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 13/172 (8%)
 Frame = +1

Query  118  NSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  297
            NSKPLF+ +YATV VG++FS  YV SA+YS  AA+ S            A S+  +V ++
Sbjct  9    NSKPLFVAVYATVIVGIIFSSLYVISAIYSGKAATFS------------ATSFQNNVGSS  56

Query  298  VLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR  477
               Q  N S    V    +P  ++++ S KPIW   P   +MP LETFRLTKEL Q+RV+
Sbjct  57   PSEQALNVSQSAVVQGVPSPNLESRNVSTKPIW-EAPNTKKMPELETFRLTKELVQQRVK  115

Query  478  DNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            DNV+IVTFGNYAFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+PV
Sbjct  116  DNVVIVTFGNYAFMDFILTWVKHLTDLGISNLLVGAMDTKLLEALYWKGVPV  167



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 128/182 (70%), Gaps = 14/182 (8%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV VG+V S FYVFSA+YS SA+++ +          ++ S
Sbjct  5    RNAVQEAAGSKPLFLTIYATVIVGIVVSSFYVFSAIYSPSASTTQS----------VSTS  54

Query  274  Y--SPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRL  447
            +  SP +    ++    +S+   +  P    +Q  S +L+PIW +PP  S+MP L+ F L
Sbjct  55   WLSSPSLSQNGVSLSSGQSI--NISQPSGIASQPGSNNLRPIWEAPPRTSKMPPLKFFSL  112

Query  448  TKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGI  627
            TKEL +ER +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGI
Sbjct  113  TKELVEERAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGI  172

Query  628  PV  633
            P 
Sbjct  173  PA  174



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 131/186 (70%), Gaps = 17/186 (9%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   QE+ANSKPLF+ IYATV +G+VF   YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFYSLYVLSAVYSANSSSSS-----------TSWL  64

Query  274  YSPDVPAAV-----LTQIHNESLKXTVGSPQAPKTQA-KSKSLKPIWISPPPGSRMPSLE  435
             SP +P ++     + Q  N S   T+ +  +P T   ++  +KPIW  PP G++ P L+
Sbjct  65   SSPPIPTSIDNTRHVDQSSNFSKPTTLAAGSSPLTSNPQTMQIKPIWEPPPHGTKFPPLK  124

Query  436  TFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALY  615
            TFRLTK+L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALY
Sbjct  125  TFRLTKQLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALY  184

Query  616  WKGIPV  633
            WKGIPV
Sbjct  185  WKGIPV  190



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 122/188 (65%), Gaps = 23/188 (12%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   +E  NSKPLF+TIYATV +GV+ S FYVFSAVYS +                 + S
Sbjct  6    RNGFREATNSKPLFVTIYATVIIGVLVSSFYVFSAVYSPTNG---------------STS  50

Query  274  YSPDVPAAVLTQIH--------NESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPS  429
            +    P +   +IH        ++SL   +  P   +      SL  IW+SPP   +MP 
Sbjct  51   WLSSPPLSTAGRIHKLSQENATSQSLPVALPPPPPEEEAQGKSSLGKIWVSPPKDKKMPP  110

Query  430  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  609
            LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTKLLEA
Sbjct  111  LEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTKLLEA  170

Query  610  LYWKGIPV  633
            LYWKG+PV
Sbjct  171  LYWKGVPV  178



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 114/176 (65%), Gaps = 10/176 (6%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            Q+ ANSKPLF+TIYATV VG+  S  YVFSA+YS     S           P + S    
Sbjct  7    QDAANSKPLFVTIYATVLVGIALSSVYVFSAIYSGKTIYS----------IPWSSSSLSR  56

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
            V A  L    N S          P +Q +S   KPIW  PPPG++MP L+ FRLTKEL  
Sbjct  57   VDAPQLEHALNFSRPFAGVGVTGPASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTKELVS  116

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             RV+DN+IIVTFGNYAFMDFI+ WVKHLTD+ + N LVGA+DTKLLEALYWKG+PV
Sbjct  117  HRVKDNIIIVTFGNYAFMDFIMNWVKHLTDLGLSNFLVGAMDTKLLEALYWKGVPV  172



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  367  AKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKH  546
            A+ KSL  IW+SPP   +MP LE+F+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKH
Sbjct  95   AQVKSLGKIWVSPPRDKKMPPLESFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKH  154

Query  547  LTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            LTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  155  LTDLDLSNILVGAMDTKLLEALYWKGVPV  183



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 18/180 (10%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV +G V S FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 123/180 (68%), Gaps = 18/180 (10%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +  VQE A SKPLFLTIYATV +G V S FYVFSA+YS +A+             P    
Sbjct  5    RNAVQETAASKPLFLTIYATVILGTVVSSFYVFSAIYSPTAS-------------PTRSI  51

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             S  + A  L+Q +  SL   +  P    +Q +S  L+PIW +P   S+MP L++FRLTK
Sbjct  52   SSSWLLAPPLSQ-NGVSLSSNISQP----SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTK  106

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            EL  +R +DNVIIVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  107  ELVAQRAKDNVIIVTFGNFAFMDFILTWVKHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  166



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 129/180 (72%), Gaps = 19/180 (11%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   QE+ANSKPLF+ IYATV +G+VFS  YV SAVYS++++SSS            +  
Sbjct  16   RNAYQEIANSKPLFVAIYATVFLGIVFSSLYVLSAVYSANSSSSS-----------TSWL  64

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
             SP +P ++      ++ +    SP  P +  ++  +KPIW  PP G++ P L+TFRLTK
Sbjct  65   SSPPIPTSI------DNTRPAGSSP--PTSNPQTMQIKPIWEPPPHGTKFPPLKTFRLTK  116

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +L Q+RV+DNVIIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  117  QLVQQRVKDNVIIVTFGNYAFMDFILSWVKHLTDLGLSNLLVGAMDTKLLEALYWKGIPV  176



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +1

Query  358  KTQAKSKS-LKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILT  534
            + +AK KS L  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILT
Sbjct  86   EEEAKGKSSLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILT  145

Query  535  WVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            WVKHLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  146  WVKHLTDLDLSNILVGAMDTKLLEALYWKGVPV  178



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +1

Query  358  KTQAKSKS-LKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILT  534
            + +AK KS L  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILT
Sbjct  90   EEEAKGKSSLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILT  149

Query  535  WVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            WVKHLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  150  WVKHLTDLDLSNILVGAMDTKLLEALYWKGVPV  182



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +1

Query  358  KTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTW  537
            + Q KS SL  IW+SPP   +MP LE F+LTKELF ERV+DNVIIVTFGNYAFMDFILTW
Sbjct  88   EAQGKS-SLGKIWVSPPKDKKMPPLEAFKLTKELFGERVKDNVIIVTFGNYAFMDFILTW  146

Query  538  VKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            VKHLTD+D+ N+LVGA+DTKLLEALYWKG+PV
Sbjct  147  VKHLTDLDLSNILVGAMDTKLLEALYWKGVPV  178



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 107/176 (61%), Gaps = 28/176 (16%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            Q+ ANSKPLF+TIYATV VG+  S                         ++  +  YS  
Sbjct  7    QDAANSKPLFVTIYATVLVGIALSS------------------------VYVFSAIYSGK  42

Query  286  VPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
               ++     + S     G    P +Q +S   KPIW  PPPG++MP L+ FRLTKEL  
Sbjct  43   TIYSIPWSSSSLSRVGVTG----PASQPQSIWTKPIWEVPPPGTKMPPLKAFRLTKELVS  98

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             RV+DN+IIVTFGNYAFMDFI+ WVKHLTD+ + N LVGA+DTKLLEALYWKG+PV
Sbjct  99   HRVKDNIIIVTFGNYAFMDFIMNWVKHLTDLGLSNFLVGAMDTKLLEALYWKGVPV  154



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 112/195 (57%), Gaps = 39/195 (20%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            ++  +E+ANSKPLFLTIY  V +G+V S                          +  +  
Sbjct  4    RKGFEEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAI  39

Query  274  YSPDVPAA---------------VLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPP  408
            YS + P+A               V  Q  N S    V +   P  + +++S + IW  PP
Sbjct  40   YSANPPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPP  99

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P  +MP L+ FRLTKEL ++RV+DN IIVTFGNYAFMDFILTWVK LTD+ V N LVGA+
Sbjct  100  PNKKMPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDFILTWVKQLTDLGVSNFLVGAM  159

Query  589  DTKLLEALYWKGIPV  633
            DTKLLEALYWKGIPV
Sbjct  160  DTKLLEALYWKGIPV  174



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 112/195 (57%), Gaps = 39/195 (20%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            ++  +E+ANSKPLFLTIY  V +G+V S                          +  +  
Sbjct  4    RKGFEEVANSKPLFLTIYTVVIIGIVVSS------------------------FYVFSAI  39

Query  274  YSPDVPAA---------------VLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPP  408
            YS + P+A               V  Q  N S    V +   P  + +++S + IW  PP
Sbjct  40   YSANPPSAQSSAWLSSISSDATHVTDQTLNVSQSAAVHTVPPPSPRPRNESPRSIWDDPP  99

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P  +MP L+ FRLTKEL ++RV+DN IIVTFGNYAFMDFILTWVK LTD+ V N LVGA+
Sbjct  100  PNKKMPPLKDFRLTKELVRQRVKDNAIIVTFGNYAFMDFILTWVKQLTDLGVSNFLVGAM  159

Query  589  DTKLLEALYWKGIPV  633
            DTKLLEALYWKGIPV
Sbjct  160  DTKLLEALYWKGIPV  174



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 12/172 (7%)
 Frame = +1

Query  118  NSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPDVPAA  297
            N+KP+F+TIYATV +G++FS  YV SA+YS  +A+ S              S+   V + 
Sbjct  9    NAKPVFVTIYATVIIGIIFSSLYVISAIYSGKSAADSTT------------SWLSHVGSP  56

Query  298  VLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR  477
             + Q  N S    V +   P  + +S S +PIW +P    +MP+L+ FRL+KEL QERV+
Sbjct  57   PVEQAPNVSEPAIVQAVPTPSLEPRSMSTRPIWEAPLHTKKMPALKKFRLSKELVQERVK  116

Query  478  DNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            DNVIIVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PV
Sbjct  117  DNVIIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPV  168



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  301  LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  480
            L Q  N S    V +   P    +S S +PIW +PP   +MP L+ FRL+KEL Q+RV+D
Sbjct  58   LEQAPNVSQPEIVQAIATPSLGPQSMSTRPIWEAPPRTKKMPPLKKFRLSKELVQQRVKD  117

Query  481  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            NV+IVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PV
Sbjct  118  NVVIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPV  168



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  301  LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  480
            L +  N S   T     A K +  +K +KP+W  P  GS+MP L+TFRL+K+L Q+RV+D
Sbjct  58   LNKALNSSHMTTENVMLATKPRLHNKLVKPVWEIPSTGSKMPPLKTFRLSKKLVQQRVKD  117

Query  481  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            N++IVT+ NYAFMDF++TWVKHLTD+ V+NLLVGALDTKLLEALYWKGIPV
Sbjct  118  NIVIVTYANYAFMDFVITWVKHLTDLGVENLLVGALDTKLLEALYWKGIPV  168



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  361  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  540
            +Q +S  L+PIW +P   S+MP L++FRLTKEL  +R +DNVIIVTFGN+AFMDFILTWV
Sbjct  67   SQHRSNKLRPIWEAPSRTSKMPRLKSFRLTKELVAQRAKDNVIIVTFGNFAFMDFILTWV  126

Query  541  KHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            KHLTD+ V NLLVGA+DTKLL+ALYWKGIPV
Sbjct  127  KHLTDLGVSNLLVGAMDTKLLKALYWKGIPV  157



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  346  PQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDF  525
            P AP ++ ++K + PIW  PP GS+MP L+ F+L+K+L Q+RV+DN+II+TFGNY FMDF
Sbjct  56   PLAPISRLQNKLVNPIWQVPPAGSKMPPLKAFKLSKKLVQQRVKDNIIIITFGNYGFMDF  115

Query  526  ILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            IL WVKHLT++ ++NLLVGA+D+KLLEALYWKG+PV
Sbjct  116  ILNWVKHLTELSIENLLVGAMDSKLLEALYWKGVPV  151



>ref|XP_007156343.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
 gb|ESW28337.1| hypothetical protein PHAVU_003G278500g, partial [Phaseolus vulgaris]
Length=446

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            ++  +E+ANSKPLFLTIY  V +G+V S FYVFSA+YSS+ +++ +             S
Sbjct  4    RKGCEEVANSKPLFLTIYTVVVIGIVVSSFYVFSAIYSSNPSAAQSSAWL---------S  54

Query  274  YSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTK  453
              P     V  Q  N S       P+ P + A+++  + IW  PP   RMP L  FRLTK
Sbjct  55   SLPSENTRVTDQTLNVSRSAVHFVPR-PSSGAQNEWSRTIWDIPPTNKRMPPLSDFRLTK  113

Query  454  ELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             L Q+RV+DNV+IVTFGNYAFMDFILTWVK L D++V N LVGA+DTKLLEALYWKGIPV
Sbjct  114  ALVQQRVKDNVVIVTFGNYAFMDFILTWVKQLRDLEVSNFLVGAMDTKLLEALYWKGIPV  173



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  PAAVLTQIHNESLKXTVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQ  465
            PA ++    N S     G S  AP ++ ++K  K IW  PP GS+MP L+ F+L+K+L Q
Sbjct  69   PAKIMAS--NSSHTTNTGNSSLAPISRLQNKLAKHIWEVPPAGSKMPPLKAFKLSKKLVQ  126

Query  466  ERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +RV+DN+IIVT+ NYAFMDF+L WVKHLT++ +DNLLVGALDTKLLEALYWKG+PV
Sbjct  127  QRVKDNIIIVTYANYAFMDFVLNWVKHLTELGIDNLLVGALDTKLLEALYWKGVPV  182



>ref|XP_010676706.1| PREDICTED: uncharacterized protein LOC104892459 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             QE A SKPLF+TIYATV +G+ FS  YVFSA+YSS                P     S 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSSVYVFSAIYSSK---------------PPDAEISL  51

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
              P +    +H         +  +P  +++S  LKPIW  P    +MP L++FRLTKEL 
Sbjct  52   SFPHSGGDPLHEAQNSSLSTTSLSP-AKSRSTLLKPIWEPPSKTKKMPPLKSFRLTKELV  110

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  111  EKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYWKGIPV  167



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             QE A SKPLF+TIYATV +G+ FS  YVFSA+YSS                P     S 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSSVYVFSAIYSSK---------------PPDAEISL  51

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
              P +    +H         +  +P  +++S  LKPIW  P    +MP L++FRLTKEL 
Sbjct  52   SFPHSGGDPLHEAQNSSLSTTSLSP-AKSRSTLLKPIWEPPSKTKKMPPLKSFRLTKELV  110

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  111  EKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYWKGIPV  167



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  334  TVGSPQAPKTQAKSKSL--KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGN  507
            TV SP     Q K  S+   PIW  PPP S+M  ++ FRLTK+L ++RV+DNVIIVTFGN
Sbjct  77   TVSSPTTKSQQDKKSSILETPIWEIPPPNSKMLPIKKFRLTKQLVEKRVKDNVIIVTFGN  136

Query  508  YAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +AFMDFILTWVKHLTD+ + NLLVGA+DTKLLEALYWKG+PV
Sbjct  137  FAFMDFILTWVKHLTDLGLSNLLVGAMDTKLLEALYWKGVPV  178



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +1

Query  301  LTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRD  480
            L Q  N S    V +   P     S S +PIW +P    +MP L+ FRL+KEL Q+RV+D
Sbjct  60   LEQAPNVSQPEIVQAISTPSLGPHSMSTRPIWEAPTRTKKMPPLKKFRLSKELVQQRVKD  119

Query  481  NVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            NV+IVTFGNYAFMDFILTWVKHLTD+ + NLL+GA+DTKLLEALYWKG+PV
Sbjct  120  NVVIVTFGNYAFMDFILTWVKHLTDLGLSNLLIGAMDTKLLEALYWKGVPV  170



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             QE A SKPLF+TIYATV +G+ FS  YVFSA+YSS                P     S 
Sbjct  7    CQEAAKSKPLFVTIYATVIIGIFFSSVYVFSAIYSSK---------------PPDAEISL  51

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
              P +    +H         +  +P  +++S  LKPIW  P    +MP L++FRLTKEL 
Sbjct  52   SFPHSGGDPLHEAQNSSLSTTSLSP-AKSRSTLLKPIWEPPSKTKKMPPLKSFRLTKELV  110

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  111  EKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKLLEALYWKGIPV  167



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 131/189 (69%), Gaps = 25/189 (13%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasss---------apiass  246
            +   QE+ NSKPLFLTIY TV VG+VFS FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  247  fsLFPIAPSYSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  426
             S   +AP++SP +  + + +               P+ Q++SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSPTLKVSAIPR---------------PRPQSRSKQVKPIW-EVPQTKRLP  108

Query  427  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  606
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVRRLTDLGLSNILVGALDTKLVK  168

Query  607  ALYWKGIPV  633
            ALYWKG+PV
Sbjct  169  ALYWKGVPV  177



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 113/195 (58%), Gaps = 39/195 (20%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            ++  +E+ANSKPLFLTIY  V +G+V S                          F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  274  YSPDVPAAVL-----------TQIHNESLKXTVGSP----QAPKTQAKSKSLKPIWISPP  408
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P  +MP LE FRLTK+L Q+RV+DN +IVTFGNYAFMDFILTWVK L D+ V N LVGA+
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDFILTWVKQLRDLGVSNFLVGAM  159

Query  589  DTKLLEALYWKGIPV  633
            DTKL+EALYWKGIPV
Sbjct  160  DTKLVEALYWKGIPV  174



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 113/195 (58%), Gaps = 39/195 (20%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            ++  +E+ANSKPLFLTIY  V +G+V S                          F  +  
Sbjct  4    RKGCEEVANSKPLFLTIYTVVIIGIVVSS------------------------FFVFSAI  39

Query  274  YSPDVPAAVL-----------TQIHNESLKXTVGSP----QAPKTQAKSKSLKPIWISPP  408
            YS + P+A             T++ +++LK +  +       P   ++++    IW  PP
Sbjct  40   YSTNPPSAQSSAWLSSISSDETRVTDQTLKVSRSAAVLIVPTPSPGSQNEWPTSIWDDPP  99

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P  +MP LE FRLTK+L Q+RV+DN +IVTFGNYAFMDFILTWVK L D+ V N LVGA+
Sbjct  100  PNKKMPPLEDFRLTKKLVQQRVKDNAVIVTFGNYAFMDFILTWVKQLRDLGVSNFLVGAM  159

Query  589  DTKLLEALYWKGIPV  633
            DTKL+EALYWKGIPV
Sbjct  160  DTKLVEALYWKGIPV  174



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  379  SLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDM  558
             ++PIW +P    +MP L++FRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVKHLTD+
Sbjct  91   GVRPIWEAPSRTKKMPPLKSFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKHLTDL  150

Query  559  DVDNLLVGALDTKLLEALYWKGIPV  633
            ++ N+LVGA+DTKLLEALYWKGIPV
Sbjct  151  NLSNILVGAMDTKLLEALYWKGIPV  175



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 116/196 (59%), Gaps = 40/196 (20%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPS  273
            +   +E+  SKPLFLTIY  V +G+V S                          +     
Sbjct  5    RNGCEEVVQSKPLFLTIYTIVIIGIVVSS------------------------FYVFLAI  40

Query  274  YSPDVPAA-----VLTQIHNES---LKXTVGSPQAPKTQAKS------KSLKP--IWISP  405
            YS + PAA     + + I NE+   +  T+   Q+ K Q  S      +++ P  +W  P
Sbjct  41   YSSNTPAAHSSAWLSSSISNENSRVIDHTLNISQSEKAQTVSTPSPEKQNVWPSFVWEVP  100

Query  406  PPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGA  585
            P   +MP L+TFRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V NLLVGA
Sbjct  101  PSNKKMPPLKTFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSNLLVGA  160

Query  586  LDTKLLEALYWKGIPV  633
            +DTKLLEALYWKG+PV
Sbjct  161  MDTKLLEALYWKGVPV  176



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score =   140 bits (353),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 87/188 (46%), Positives = 111/188 (59%), Gaps = 38/188 (20%)
 Frame = +1

Query  106  QEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSPD  285
            +E+A+S+PLFLTIY  V VGVVFS                         L+  +    P 
Sbjct  4    EEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYPS  39

Query  286  VPAAVLTQIHNESLKXTVGS------------PQAPKTQAKSKSLKPIWISPPPGSRMPS  429
              A+  + + NE ++ T  +            P  P  +A++   +PI   PP   +MPS
Sbjct  40   TNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPP-EARNVKTRPILNIPPRNKKMPS  97

Query  430  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  609
            L TFRLT+EL Q+RV+DN+IIVTFGNYAFMDFILTWV+ L D+ V N LVGA+DTKLLEA
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDTKLLEA  157

Query  610  LYWKGIPV  633
            LYWKGIPV
Sbjct  158  LYWKGIPV  165



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  127  RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  186

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLLVGA+DTKLLEALYW+G+PV
Sbjct  187  SNLLVGAMDTKLLEALYWRGVPV  209



>ref|XP_008782814.1| PREDICTED: uncharacterized protein LOC103702257 isoform X2 [Phoenix 
dactylifera]
Length=286

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +1

Query  280  PDVPAAVLTQIHN---ESLKXTVGSPQAPKTQAKSKSL--KPIWISPPPGSRMPSLETFR  444
            P +P    T+  N   ES      +   P   AK +++  + IW   P G++MP L++FR
Sbjct  58   PRLPDRDFTRKGNGLSESEASRNATANIPPPTAKPRNMFTRGIW-DAPVGTKMPDLKSFR  116

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            LTKE+ + R RDNVIIVTFGNYA+MDFILTWVKHLTD++V NLLVGA+D+K+LEALYWKG
Sbjct  117  LTKEMVEHRARDNVIIVTFGNYAYMDFILTWVKHLTDLNVYNLLVGAMDSKILEALYWKG  176

Query  625  IPV  633
            IPV
Sbjct  177  IPV  179



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  99   RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  158

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLLVGA+DTKLLEALYW+G+PV
Sbjct  159  SNLLVGAMDTKLLEALYWRGVPV  181



>ref|XP_008782812.1| PREDICTED: uncharacterized protein LOC103702257 isoform X1 [Phoenix 
dactylifera]
Length=291

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = +1

Query  313  HNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVII  492
             +E+ +    +   P  + ++   + IW   P G++MP L++FRLTKE+ + R RDNVII
Sbjct  79   ESEASRNATANIPPPTAKPRNMFTRGIW-DAPVGTKMPDLKSFRLTKEMVEHRARDNVII  137

Query  493  VTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            VTFGNYA+MDFILTWVKHLTD++V NLLVGA+D+K+LEALYWKGIPV
Sbjct  138  VTFGNYAYMDFILTWVKHLTDLNVYNLLVGAMDSKILEALYWKGIPV  184



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            +PIW +PP G + PSL+ F+LTK L ++RV+DNVIIVTFGNYAFMDFILTWVKHLTD+ +
Sbjct  88   RPIWEAPPRGEKRPSLKAFQLTKTLVEQRVKDNVIIVTFGNYAFMDFILTWVKHLTDLGI  147

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLLVGA+DTKLLEALYW+G+PV
Sbjct  148  SNLLVGAMDTKLLEALYWRGVPV  170



>gb|EPS61907.1| hypothetical protein M569_12886, partial [Genlisea aurea]
Length=244

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +1

Query  328  KXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGN  507
            + + G      T    K    IW  PP GS MP  E F+LTKEL Q+RV++N+I+VTFGN
Sbjct  57   RSSAGMVSRDSTSLTQKRHGIIWEVPPLGSEMPPREAFKLTKELVQKRVKNNIIVVTFGN  116

Query  508  YAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             AFMDFIL WVKHLTDM +DNL+VGALD+K+L+ALYWKGIPV
Sbjct  117  LAFMDFILNWVKHLTDMGIDNLIVGALDSKVLKALYWKGIPV  158



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 130/189 (69%), Gaps = 25/189 (13%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasss---------apiass  246
            +   QE+ NSKPLFLTIY TV VG+VFS FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  247  fsLFPIAPSYSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  426
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  427  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  606
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVQRLTDLGLSNILVGALDTKLVK  168

Query  607  ALYWKGIPV  633
            ALYWKG+PV
Sbjct  169  ALYWKGVPV  177



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 130/189 (69%), Gaps = 25/189 (13%)
 Frame = +1

Query  94   KEMVQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasss---------apiass  246
            +   QE+ NSKPLFLTIY TV VG+VFS FYVFSAVYS S+AS++             ++
Sbjct  5    RNWYQELVNSKPLFLTIYTTVIVGIVFSSFYVFSAVYSPSSASANWFSSPPSISHSPVAA  64

Query  247  fsLFPIAPSYSPDVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMP  426
             S   +AP++SP             +LK +   P  P  Q+ SK +KPIW   P   R+P
Sbjct  65   SSYINVAPNFSP-------------TLKVSAIPPPLP--QSSSKQVKPIW-EVPQTKRLP  108

Query  427  SLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLE  606
            SL++F+LTKEL ++RV+DN+II+TFGNYAFMDFIL WV+ LTD+ + N+LVGALDTKL++
Sbjct  109  SLKSFQLTKELVEQRVQDNIIIMTFGNYAFMDFILNWVQRLTDLGLSNILVGALDTKLVK  168

Query  607  ALYWKGIPV  633
            ALYWKG+PV
Sbjct  169  ALYWKGVPV  177



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  421  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  600
            MP LETF+LTKELF ERV+DNVIIVTFGNYAFMDFILTWVKHLTD+D+ N+LVGA+DTKL
Sbjct  1    MPPLETFKLTKELFGERVKDNVIIVTFGNYAFMDFILTWVKHLTDLDLSNILVGAMDTKL  60

Query  601  LEALYWKGIPV  633
            LEALYWKG+PV
Sbjct  61   LEALYWKGVPV  71



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 111/188 (59%), Gaps = 36/188 (19%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             +E+A+S+PLFLTIY  V VGVVFS                         L+  +    P
Sbjct  3    CEEVAHSRPLFLTIYTIVFVGVVFSS------------------------LYVFSAIRYP  38

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKT-----------QAKSKSLKPIWISPPPGSRMPS  429
               A+  + + NE ++ T  +    ++           +A++   +PI   PP   +MPS
Sbjct  39   STNASTWS-LSNEDVRLTEQTLNVSQSGNAHVVPSVPPEARNVKTRPILNIPPRNKKMPS  97

Query  430  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  609
            L TFRLT+EL Q+RV+DN+IIVTFGNYAFMDFILTWV+ L D+ V N LVGA+DTKLLEA
Sbjct  98   LNTFRLTEELVQQRVKDNIIIVTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDTKLLEA  157

Query  610  LYWKGIPV  633
            LYWKGIPV
Sbjct  158  LYWKGIPV  165



>ref|XP_006878624.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +1

Query  310  IHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVI  489
            I N S + T   P + K Q   +  K IW SPP GS+MP L  F+LTK++  +R +DNVI
Sbjct  72   IDNFSDRGTETIPSSSKFQNIWE--KAIWESPPAGSKMPDLNEFQLTKQMVADRAKDNVI  129

Query  490  IVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            IVTFGN+AFMDFILTWVKHLTD+ V NLLVGA+D +LLEALYW+GIPV
Sbjct  130  IVTFGNHAFMDFILTWVKHLTDLGVYNLLVGAMDVQLLEALYWRGIPV  177



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  391  IWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDN  570
            +W  PP   +MP L+ FRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V N
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSN  154

Query  571  LLVGALDTKLLEALYWKGIPV  633
             LVGA+DTKLLEALYWKG+PV
Sbjct  155  FLVGAMDTKLLEALYWKGVPV  175



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  391  IWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDN  570
            +W  PP   +MP L+ FRLTKEL Q+RV+DNV+IVTFGNYAFMDFILTWVK LTD++V N
Sbjct  95   VWEIPPSNKKMPPLKNFRLTKELVQQRVKDNVVIVTFGNYAFMDFILTWVKKLTDLEVSN  154

Query  571  LLVGALDTKLLEALYWKGIPV  633
             LVGA+DTKLLEALYWKG+PV
Sbjct  155  FLVGAMDTKLLEALYWKGVPV  175



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 114/179 (64%), Gaps = 18/179 (10%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             +E+A+S+PLFLTIY  V VG+VFS  YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  283  DVPAAVLT-QIHNESLKXTVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  456
                  LT Q  N S   TV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  457  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            L Q+RV+DN+II+TFGNYAFMDFILTWV+ L D+ V N LVGA+D KLLEALYWKGIPV
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDIKLLEALYWKGIPV  165



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 114/179 (64%), Gaps = 18/179 (10%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             +E+A+S+PLFLTIY  V VG+VFS  YVFSA+   SA               I  ++S 
Sbjct  3    CEEVAHSRPLFLTIYTIVIVGIVFSSLYVFSAIRHPSA---------------IPSTWSL  47

Query  283  DVPAAVLT-QIHNESLKXTVG-SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKE  456
                  LT Q  N S   TV   P  P+ +A+    +PI   PP   +MPSL  FRLTKE
Sbjct  48   SNEDVRLTEQTLNGSQSETVHIVPSVPQ-EARKMRTRPILSVPPRNKKMPSLNAFRLTKE  106

Query  457  LFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            L Q+RV+DN+II+TFGNYAFMDFILTWV+ L D+ V N LVGA+D KLLEALYWKGIPV
Sbjct  107  LVQQRVKDNIIILTFGNYAFMDFILTWVEQLNDLGVSNYLVGAMDIKLLEALYWKGIPV  165



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             +E+A+S+P+FLTIY  V V      F       ++S+A SS             P  S 
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWSSF------------PPLSN  50

Query  283  DVPAAVLTQIHNESLKXTVGSPQA-PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKEL  459
            + P  +        L+     P A P+ Q  S+  KPI   PP   +MP L+ FRLTKEL
Sbjct  51   EDPRLLDRTFDASQLETMHAVPSAFPELQNVSR--KPILNVPPRNKKMPPLKEFRLTKEL  108

Query  460  FQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ V N LVGA+DTKLLEALYWKG+PV
Sbjct  109  VQQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGVSNYLVGAMDTKLLEALYWKGVPV  166



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 107/178 (60%), Gaps = 15/178 (8%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             +E+A+S+P+FLTIY  V V      F       ++S+A SS             P  S 
Sbjct  3    CEEVAHSRPVFLTIYTVVIVVSSLYVFSAIHYSSTTSSAWSSF------------PPLSN  50

Query  283  DVPAAVLTQIHNESLKXTVGSPQA-PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKEL  459
            + P  +        L+     P A P+ Q  S+  KPI   PP   +MP L+ FRLTKEL
Sbjct  51   EDPRLLDRTFDASQLETMHAVPSAFPELQNVSR--KPILNVPPRNKKMPPLKEFRLTKEL  108

Query  460  FQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
             Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ V N LVGA+DTKLLEALYWKG+PV
Sbjct  109  VQQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGVSNYLVGAMDTKLLEALYWKGVPV  166



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  103  VQEMANSKPLFLTIYATvavgvvfsxfyvfsavysssaasssapiassfsLFPIAPSYSP  282
             Q+  N++PLFL IYATV  G+VFS  YVFSAVYSSS   S +    S        S S 
Sbjct  7    CQDGVNTRPLFLVIYATVIAGIVFSSLYVFSAVYSSSNPLSDSSSWFSSPSSEFTNSDS-  65

Query  283  DVPAAVLTQIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELF  462
                 +  Q  + S   T  +P    T   +K  KPIW   P    MP  ETF L+KEL 
Sbjct  66   ---TLIKDQRSDVSEPSTGPTPDFSSTIVHNKGEKPIW-EAPNTKDMPPPETFHLSKELV  121

Query  463  QERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            Q R +DN+IIVTFGNYAFMDFIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  122  QRRAKDNIIIVTFGNYAFMDFILSWVKHLTDLGLTNLLVGAMDTKLLEALYWKGIPV  178



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +1

Query  307  QIHNESLKXTVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNV  486
            Q  N S   TV  P  P  +A+    +PI   PP    MP LE F LTKEL Q+RV+DNV
Sbjct  57   QTLNGSRFATVDVPSVPP-EARDVRTRPILDVPPRNKEMPPLEAFGLTKELIQKRVKDNV  115

Query  487  IIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            IIVTF NYAFMDFILTWV+ L +++V N LVGA+DTKLLEALYWKGIPV
Sbjct  116  IIVTFANYAFMDFILTWVQQLNNLEVSNFLVGAMDTKLLEALYWKGIPV  164



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  421  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  600
            MP LE+F+LTKEL  ER +DNVIIVTFGN+AFMDFILTWVKHLTD+DV NLLVGA+DTKL
Sbjct  1    MPPLESFKLTKELVGERAKDNVIIVTFGNFAFMDFILTWVKHLTDLDVSNLLVGAMDTKL  60

Query  601  LEALYWKGIPV  633
            LEALYWKG+PV
Sbjct  61   LEALYWKGVPV  71



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +1

Query  343  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  522
            +P    T  ++K  +PIW   P    MP  E F L+KEL Q+R +DN+IIVTFGNYAFMD
Sbjct  83   TPDFSNTVVQNKGERPIW-EAPNTKNMPPPEAFNLSKELVQKRAKDNIIIVTFGNYAFMD  141

Query  523  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            FIL+WVKHLTD+ + NLLVGA+DTKLLEALYWKGIPV
Sbjct  142  FILSWVKHLTDLGLTNLLVGAMDTKLLEALYWKGIPV  178



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 73/97 (75%), Gaps = 4/97 (4%)
 Frame = +1

Query  343  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  522
            +P  P+T       +PIW  PP GSRMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  64   APAQPETMYN----RPIWKPPPRGSRMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  119

Query  523  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            FILTWV+HLTD+ VDNLLVGA+DTKLL  LY +G+PV
Sbjct  120  FILTWVRHLTDLGVDNLLVGAMDTKLLRELYLRGVPV  156



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  361  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  540
             QA++   +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+DFILTWV
Sbjct  63   AQAETMYNRPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLDFILTWV  122

Query  541  KHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +HLTD+ VDNLLVGA+DTKLL  LY++G+PV
Sbjct  123  RHLTDLGVDNLLVGAMDTKLLRELYFRGVPV  153



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +1

Query  355  PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILT  534
            P  + ++   + IW   P G++MP L++FRLTKE+ +   ++NVIIVTFGNYA+MDFILT
Sbjct  88   PTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIVTFGNYAYMDFILT  146

Query  535  WVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            WV+HLTD++V NLLVGA+DTK+LEALYWKGIPV
Sbjct  147  WVRHLTDLNVYNLLVGAMDTKILEALYWKGIPV  179



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +1

Query  355  PKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILT  534
            P  + ++   + IW   P G++MP L++FRLTKE+ +   ++NVIIVTFGNYA+MDFILT
Sbjct  90   PTAKPRNMFTRDIW-DVPVGTKMPELKSFRLTKEMLEHWAKENVIIVTFGNYAYMDFILT  148

Query  535  WVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            WV+HLTD++V NLLVGA+DTK+LEALYWKGIPV
Sbjct  149  WVRHLTDLNVYNLLVGAMDTKILEALYWKGIPV  181



>gb|EMS55953.1| hypothetical protein TRIUR3_26709 [Triticum urartu]
Length=609

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            +PIW  P  GSRMPS   FRLT+++ + R RD VI+VTFGNYAFMDFILTWV+HLT + V
Sbjct  71   RPIWKPPARGSRMPSPRAFRLTRDMVRARARDGVIVVTFGNYAFMDFILTWVRHLTGLGV  130

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
            DNLLVGA+DTKLL  LY  G+PV
Sbjct  131  DNLLVGAMDTKLLRQLYLTGVPV  153



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 4/97 (4%)
 Frame = +1

Query  343  SPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMD  522
            +P  P+T       +PIW  PP  +RMPS   FRLT+++   R RD VI+VTFGNYAF+D
Sbjct  61   TPAQPETMYN----RPIWKPPPRRARMPSPRAFRLTRDMVAARARDGVIVVTFGNYAFLD  116

Query  523  FILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            FILTWV+HLTD+ VDNLLVGA+DTKLL  LY++G+PV
Sbjct  117  FILTWVRHLTDLGVDNLLVGAMDTKLLRELYFRGVPV  153



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  421  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  600
            MP L++FRLTKEL ++RV+DN+IIVTFGNYAFMDFILTWVK LTD+ + NLLVGA+DTKL
Sbjct  1    MPPLKSFRLTKELVEKRVKDNIIIVTFGNYAFMDFILTWVKCLTDLGLSNLLVGAMDTKL  60

Query  601  LEALYWKGIPV  633
            LEALYWKGIPV
Sbjct  61   LEALYWKGIPV  71



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +1

Query  400  SPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLV  579
            +PP   +MP LETFRLTKEL   R +DN++IVTFGN+AFMDFIL WVKHLT + + N+L+
Sbjct  75   APPHDKKMPPLETFRLTKELVGGRAKDNIVIVTFGNFAFMDFILNWVKHLTCLGLSNVLI  134

Query  580  GALDTKLLEALYWKGIPV  633
            GALDTKLLEALYWKGIPV
Sbjct  135  GALDTKLLEALYWKGIPV  152



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +1

Query  334  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYA  513
               +P  P+T       +PIW  PP GSRMP    FRLT+++ + R RD VI+VTFGNYA
Sbjct  84   NASAPAQPETMYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYA  139

Query  514  FMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            F+DFILTWV HLT + VDNLLVGA+DTKLL  LY +G+PV
Sbjct  140  FLDFILTWVHHLTGLGVDNLLVGAMDTKLLRELYLRGVPV  179



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            KP++   P   +MP L+ FRLTKEL Q+RV+DN+IIVTFGNYAFMDFILTWVK L D+ +
Sbjct  79   KPVFDVSPRNKKMPPLKDFRLTKELVQQRVKDNIIIVTFGNYAFMDFILTWVKQLNDLGL  138

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             N LVGA+DTKLLEALY KG+PV
Sbjct  139  SNYLVGAMDTKLLEALYQKGVPV  161



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 4/100 (4%)
 Frame = +1

Query  334  TVGSPQAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYA  513
             V  P  P+T       +PIW  PP GSRMP    FRLT+++ + R RD VI+VTFGNYA
Sbjct  56   NVSGPAQPETIYN----RPIWKPPPRGSRMPPPRAFRLTRDMVRARARDGVIVVTFGNYA  111

Query  514  FMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            F+DFILTW  HLT + VDNLLVGA+DTKLL  LY +G+PV
Sbjct  112  FLDFILTWAHHLTALGVDNLLVGAMDTKLLRELYLRGVPV  151



>ref|NP_001050567.1| Os03g0586300 [Oryza sativa Japonica Group]
 gb|AAT76325.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12481.1| Os03g0586300 [Oryza sativa Japonica Group]
Length=356

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  361  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  540
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  541  KHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PV
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPV  155



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            + +W   P  S+MP L+ F+LTKE+ + R +DN I VTFGN+AF+DFIL WVKHLTD+++
Sbjct  138  RAVW-DVPVSSKMPDLKLFQLTKEMVKHRAKDNFIFVTFGNHAFLDFILNWVKHLTDLNL  196

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             N+LVGA+DTKLLEALYWKGIPV
Sbjct  197  FNILVGAMDTKLLEALYWKGIPV  219



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  361  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  540
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  541  KHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PV
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPV  155



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +1

Query  361  TQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWV  540
             Q ++   +PIW  PP   RMP+   FRLT+E+   R R   I+VTFGN+AF+DFILTWV
Sbjct  65   AQPETMYNRPIWKPPPRRERMPAPRAFRLTREMVGARARGGAIVVTFGNHAFLDFILTWV  124

Query  541  KHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            +HLTD+ VD+LLVGA+DTKLL  LY +G+PV
Sbjct  125  RHLTDLGVDSLLVGAMDTKLLRELYLRGVPV  155



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            K IW  PP GS +P  E F L+KE+ + R + NVI+VTF N+AF DF+LTWV+HLTD+ V
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDFVLTWVRHLTDVGV  67

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLLVGA+D K+LE L+WKG+PV
Sbjct  68   TNLLVGAMDRKILEELFWKGVPV  90



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            K IW  PP GS +P  E F L+KE+ + R + NVI+VTF N+AF DF+LTWV+HLTD+ V
Sbjct  8    KAIWEIPPHGSELPPREAFVLSKEMVEFRAKKNVIMVTFANHAFEDFVLTWVRHLTDVGV  67

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLL+GA+D K+LE L+WKG+PV
Sbjct  68   TNLLIGAMDRKILEELFWKGVPV  90



>ref|XP_001761094.1| predicted protein [Physcomitrella patens]
 gb|EDQ74161.1| predicted protein, partial [Physcomitrella patens]
Length=526

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  421  MPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKL  600
            +P  + F LTKE+ + R + NVI VTF N+AFMDF+L WV+HLTD++V N+LVGA+DTK+
Sbjct  1    LPPRDAFALTKEMIEFRAKKNVIAVTFANFAFMDFVLNWVRHLTDVEVTNILVGAMDTKI  60

Query  601  LEALYWKGIPV  633
            LEAL+WKG+PV
Sbjct  61   LEALFWKGVPV  71



>emb|CDX84232.1| BnaC04g09940D [Brassica napus]
Length=156

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  364  QAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVK  543
            +A+ KSL  IW+SPP   +MP LETF+LTKELF ERV+DNVIIVTFGNY FMDFILTWV+
Sbjct  92   EAEGKSLGKIWVSPPREKKMPPLETFKLTKELFGERVKDNVIIVTFGNYVFMDFILTWVQ  151

Query  544  HL  549
             +
Sbjct  152  WI  153



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  403  PPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVG  582
            P  GS MP  E+FRLT+EL  ER  DNV+++TFGN+AF+DF++ W +HL  + V N LVG
Sbjct  1    PGDGSEMPPPESFRLTRELVAERAEDNVVVITFGNFAFVDFMVNWAEHLMRLGVTNFLVG  60

Query  583  ALDTKLLEALYWKGIPV  633
            A+D K LEALY +G+PV
Sbjct  61   AMDAKALEALYRRGVPV  77



>ref|XP_006650304.1| PREDICTED: uncharacterized protein LOC102706084 [Oryza brachyantha]
Length=618

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  385  KPIWISPPPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDV  564
            +PIW  PP   RMP    FRLT+E+   R R  VI+VTFGN+AF+DFILTWV+HLTD+ V
Sbjct  73   RPIWKPPPRRERMPPPRAFRLTREMVGARARGGVIVVTFGNHAFLDFILTWVRHLTDLGV  132

Query  565  DNLLVGALDTKLLEALYWKGIPV  633
             NLLVGA+DTKL+  LY +G+PV
Sbjct  133  VNLLVGAMDTKLVRELYLRGVPV  155



>ref|XP_005843950.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
 gb|EFN51848.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
Length=631

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            LT++L  +  +DN I+VT+ N+ + DF++ WV+HL     D  +VGA+D KLLE L  K 
Sbjct  101  LTRDLVGKVAKDNTIMVTWANWHYHDFVMNWVEHLQAAGCDAFIVGAMDDKLLEFLVSKN  160

Query  625  IPV  633
            IP 
Sbjct  161  IPA  163



>ref|XP_005649227.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24683.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
Length=857

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  442  RLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWK  621
            +LT  L   R RD +++VT+ + A++DF+  W+ HLT ++V+N L+GA+D ++ E L  +
Sbjct  340  QLTAALANSRSRDGIVLVTWASAAYLDFLRNWIHHLTILEVENFLIGAMDNEVSEYLRQQ  399

Query  622  GIP  630
             IP
Sbjct  400  NIP  402



>ref|XP_005852062.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
 gb|EFN59960.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
Length=727

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            L+++L +   RD +IIVT+ NY F DF+L WV+H+    + N LVGA+D    +AL  +G
Sbjct  131  LSRDLARSHARDGIIIVTWANYHFFDFVLNWVEHMQRHGIKNYLVGAMDVDTGQALAAQG  190

Query  625  IPV  633
            + V
Sbjct  191  LNV  193



>ref|XP_005758156.1| hypothetical protein EMIHUDRAFT_77405 [Emiliania huxleyi CCMP1516]
 gb|EOD05727.1| hypothetical protein EMIHUDRAFT_77405 [Emiliania huxleyi CCMP1516]
Length=581

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query  379  SLKPIWISPPPGSRMPSL--ETFRLTKELFQERVR-DNVIIVTFGNYAFMDFILTWVKHL  549
            S  P   S PP +   S+    +RLT+EL + R    N+I+VTF N+   D+ LTW  H+
Sbjct  25   SHPPETASHPPAASNASVGRAAYRLTRELIRSRCNAHNIILVTFVNFQRCDYGLTWSGHV  84

Query  550  TDMDVDNLLVGALDTKLLEALYWKGIP  630
              + + N LVGA+D K LE L  K +P
Sbjct  85   VRLGLSNYLVGAMDGKALELLASKKVP  111



>ref|XP_002956226.1| hypothetical protein VOLCADRAFT_97156 [Volvox carteri f. nagariensis]
 gb|EFJ42765.1| hypothetical protein VOLCADRAFT_97156 [Volvox carteri f. nagariensis]
Length=658

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +1

Query  442  RLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWK  621
            +++KEL Q   R   +IVT+ N+A  DF+ TW+ H  ++ +DN LVGA+D ++   L   
Sbjct  142  QISKELAQSVARGGAVIVTWANFALWDFVKTWISHTKEVGLDNFLVGAMDAQIGSELVAA  201

Query  622  GIP  630
            G+P
Sbjct  202  GVP  204



>gb|KDD76569.1| nucleotide-diphospho-sugar transferase [Helicosporidium sp. ATCC 
50920]
Length=662

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +1

Query  430  LETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEA  609
            L   RL+K L     RD  I+VT+ NY + DF+  WV H+      N +VGALD ++LE 
Sbjct  131  LRKHRLSKALIAPLSRDGAIVVTWANYHYRDFVNNWVVHIRKAGCQNFVVGALDDRMLEW  190

Query  610  LYWKGIP  630
            L   GIP
Sbjct  191  LVENGIP  197



>ref|XP_011398427.1| hypothetical protein F751_0558 [Auxenochlorella protothecoides]
 gb|KFM25531.1| hypothetical protein F751_0558 [Auxenochlorella protothecoides]
Length=334

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = +1

Query  406  PPGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGA  585
            PP  +   +    L+++L +     N ++VT+ ++   DF+  WV HL       LLVGA
Sbjct  9    PPSGQFKGIRAHLLSRDLVELHASSNHLVVTWSDWDNRDFVRNWVYHLHKAGCSALLVGA  68

Query  586  LDTKLLEALYWKGIPV  633
             DT+LLE L+  GIP 
Sbjct  69   TDTQLLEWLFEAGIPA  84



>ref|XP_005760837.1| hypothetical protein EMIHUDRAFT_465597 [Emiliania huxleyi CCMP1516]
 gb|EOD08408.1| hypothetical protein EMIHUDRAFT_465597 [Emiliania huxleyi CCMP1516]
Length=1547

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query  379   SLKPIWISPPPGSRMPSL--ETFRLTKELFQERVR-DNVIIVTFGNYAFMDFILTWVKHL  549
             S  P   S PP +   S+    +RLT+EL + R    N+I+VTF N+   D+ LTW  H+
Sbjct  991   SHPPETASHPPAASNASVGRAAYRLTRELIRSRCNAHNIILVTFVNFQRCDYGLTWSGHV  1050

Query  550   TDMDVDNLLVGALDTKLLEALYWKGIP  630
               + + N LVGA+D K LE L  K +P
Sbjct  1051  VRLGLSNYLVGAMDGKALELLASKKVP  1077



>ref|XP_003078397.1| unnamed protein product, partial [Ostreococcus tauri]
Length=556

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            ++KEL Q   +D  +IVT+ N  + DF L W++HL  + V+N L+GA+D ++   L   G
Sbjct  36   VSKELVQRVAKDGAVIVTWANSHYYDFALNWLRHLDALGVENYLIGAMDEEMYAKLRKIG  95

Query  625  IPV  633
            +P 
Sbjct  96   VPC  98



>emb|CEF97310.1| Nucleotide-diphospho-sugar transferase [Ostreococcus tauri]
Length=771

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            ++KEL Q   +D  +IVT+ N  + DF L W++HL  + V+N L+GA+D ++   L   G
Sbjct  86   VSKELVQRVAKDGAVIVTWANSHYYDFALNWLRHLDALGVENYLIGAMDEEMYAKLRKIG  145

Query  625  IP  630
            +P
Sbjct  146  VP  147



>ref|XP_011397700.1| hypothetical protein F751_1691 [Auxenochlorella protothecoides]
 gb|KFM24812.1| hypothetical protein F751_1691 [Auxenochlorella protothecoides]
Length=524

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            LT+EL +   +D  I+VT+ N+ + DF+  WV HL        +VGA+D KLL  L   G
Sbjct  133  LTRELIEPLAQDKYIMVTWANWHYRDFVGNWVYHLKKTGCSAFVVGAMDDKLLAWLQENG  192

Query  625  IP  630
            IP
Sbjct  193  IP  194



>gb|KIZ02110.1| hypothetical protein MNEG_5845 [Monoraphidium neglectum]
Length=479

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTKLLEALYWKG  624
            L++EL Q    D  ++VT+ N+ + DF LTWV H+  + +   +VGA+D  +L  L  + 
Sbjct  187  LSRELVQSLAEDGYLVVTWANHHYTDFALTWVYHVQQVGIKGYMVGAMDEAILITLAKRK  246

Query  625  IP  630
            IP
Sbjct  247  IP  248



>ref|XP_007509006.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20092.1| predicted protein [Bathycoccus prasinos]
Length=980

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +1

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P S+ P  E  +L + L +    +N+++VT+ N  + DF+  WVKH+ D  ++N LVGA+
Sbjct  463  PISKRP--EDNQLNEALAKRYSHENIVMVTWANNHYYDFVKNWVKHIRDCGMNNFLVGAM  520

Query  589  DTKLLEALYWKGIP  630
            D +LL  L    +P
Sbjct  521  DNELLVRLIDDKVP  534



>ref|XP_005772161.1| hypothetical protein EMIHUDRAFT_117868 [Emiliania huxleyi CCMP1516]
 gb|EOD19732.1| hypothetical protein EMIHUDRAFT_117868 [Emiliania huxleyi CCMP1516]
Length=585

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +1

Query  421  MPSLETFRLTKELFQERV-RDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            + S ET RLT EL ++   +DN++I T+ N+  +DF LT V HL  M   + LVGA+D +
Sbjct  75   LASAETPRLTAELAKKHASKDNLLIATYVNFNRLDFALTLVMHLLAMGNPHYLVGAMDDQ  134

Query  598  LLEALYWKGI  627
            +  AL  +G+
Sbjct  135  VGHALASRGV  144



>ref|XP_002506735.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
 gb|ACO67993.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
Length=746

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +1

Query  409  PGSRMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGAL  588
            P S++   E  +LT EL      DN+++VT+ N+ + DF+  WV+++    + N +VGA+
Sbjct  207  PKSKLA--EDNQLTAELVGRYAEDNIVMVTWANHHYHDFVRNWVRNVRKCGMRNYMVGAM  264

Query  589  DTKLLEALYWKGIP  630
            D +LLE L    +P
Sbjct  265  DNELLEKLIDDEVP  278



>ref|XP_007512211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66299.1| predicted protein [Bathycoccus prasinos]
Length=750

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  445  LTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTD-MDVDNLLVGALDTKLLEAL  612
            LT E  Q+  +DN IIVT+ N+ ++DF   W+ H+ + + + N ++GA+D K+ E+L
Sbjct  118  LTIEHIQKIAKDNTIIVTWANHHYLDFARNWINHVQNRLGLSNFIIGAMDEKMYESL  174



>ref|XP_005709932.1| glycosyl transferase family GT77 cell wall polysaccharide biosynthesis 
[Chondrus crispus]
 emb|CDF39638.1| glycosyl transferase family GT77 cell wall polysaccharide biosynthesis 
[Chondrus crispus]
Length=555

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = +1

Query  349  QAPKTQAKSKSLKPIWISPPPGSRMPSLETFRLTKELFQERVR-DNVIIVTFGNYAFMDF  525
            Q      ++K+   I I+ P   + PS     LT     ERV  +N +IVT  NY + D 
Sbjct  243  QCGMVSKEAKNDYNIPIAKPGDEKEPSSFGMPLTLPSVSERVAINNTVIVTALNYGYRDI  302

Query  526  ILTWVKHLTDMDVDNLLVGALDTKLLEALYWKGIPV  633
            ++ WV +L  +++ N ++ A D  L E  Y +G+PV
Sbjct  303  MMNWVCNLRHLNITNFIISAFDRDLYEYAYVRGLPV  338



>ref|XP_001692787.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03806.1| predicted protein [Chlamydomonas reinhardtii]
Length=703

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  415  SRMPSLET-FRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALD  591
             ++  L+T ++ T+E+ Q+  ++  ++VT+ N+ + DF+ TWVKH+  + V   +VGA+D
Sbjct  149  GKITELDTQYKPTREMVQKIAQNGYLMVTWANFHYFDFVKTWVKHVQRVGVTGYIVGAMD  208

Query  592  TKLLEAL  612
              LL  +
Sbjct  209  DHLLREM  215



>ref|XP_011395852.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
 gb|KFM22985.1| hypothetical protein F751_0343 [Auxenochlorella protothecoides]
Length=603

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +1

Query  418  RMPSLETFRLTKELFQERVRDNVIIVTFGNYAFMDFILTWVKHLTDMDVDNLLVGALDTK  597
            R+P+ E  +L+KEL         I VT+ N  F DF + W  HL D+ V N+LVGA+D  
Sbjct  41   RVPTDEVPQLSKELAWAAADGGEIFVTWANEHFSDFAVNWALHLKDVGVHNILVGAMDVG  100

Query  598  LLEA  609
              +A
Sbjct  101  AAKA  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500