BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028F01

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589035.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    128   5e-31   
ref|XP_009589032.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    129   5e-31   Nicotiana tomentosiformis
ref|XP_009797353.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    127   1e-30   Nicotiana sylvestris
ref|XP_009797350.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    127   2e-30   Nicotiana sylvestris
ref|XP_010326798.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    123   6e-29   Solanum lycopersicum
ref|XP_006340880.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    121   3e-28   
ref|XP_002528338.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    120   6e-28   
ref|XP_011091352.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    118   4e-27   
ref|XP_002311699.2|  GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family p...    114   1e-25   
ref|XP_011029735.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    113   2e-25   Populus euphratica
ref|XP_010650169.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    113   2e-25   Vitis vinifera
gb|KJB38439.1|  hypothetical protein B456_006G255000                    112   3e-25   Gossypium raimondii
gb|KJB38438.1|  hypothetical protein B456_006G255000                    112   5e-25   Gossypium raimondii
ref|XP_011041462.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    108   1e-24   Populus euphratica
ref|XP_011041460.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    108   3e-24   Populus euphratica
ref|XP_010264847.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    109   5e-24   Nelumbo nucifera [Indian lotus]
gb|KCW63541.1|  hypothetical protein EUGRSUZ_G01176                     108   7e-24   Eucalyptus grandis [rose gum]
gb|KCW60134.1|  hypothetical protein EUGRSUZ_H02859                     108   1e-23   Eucalyptus grandis [rose gum]
gb|KCW63539.1|  hypothetical protein EUGRSUZ_G01176                     108   1e-23   Eucalyptus grandis [rose gum]
gb|KCW63540.1|  hypothetical protein EUGRSUZ_G01176                     108   1e-23   Eucalyptus grandis [rose gum]
ref|XP_010065851.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    108   1e-23   Eucalyptus grandis [rose gum]
gb|KHN21619.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B, ch...    107   2e-23   Glycine soja [wild soybean]
ref|XP_003525222.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    107   2e-23   Glycine max [soybeans]
gb|EYU43758.1|  hypothetical protein MIMGU_mgv1a003561mg                107   5e-23   Erythranthe guttata [common monkey flower]
gb|KHN16523.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B, ch...    105   6e-23   Glycine soja [wild soybean]
ref|XP_007035291.1|  GLU-ADT subunit B isoform 1                        105   1e-22   
ref|XP_003530925.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    105   1e-22   Glycine max [soybeans]
ref|XP_007160438.1|  hypothetical protein PHAVU_002G322100g             105   2e-22   Phaseolus vulgaris [French bean]
ref|XP_008224027.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    104   3e-22   Prunus mume [ume]
ref|XP_008224029.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    104   3e-22   Prunus mume [ume]
ref|XP_007223309.1|  hypothetical protein PRUPE_ppa003810mg             104   3e-22   
ref|XP_010667083.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    102   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011462425.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    102   2e-21   Fragaria vesca subsp. vesca
ref|XP_010667086.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    101   4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667085.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    100   1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002314512.2|  hypothetical protein POPTR_0010s07520g           99.4    2e-20   
ref|XP_010110683.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B    99.0    2e-20   
ref|XP_008340732.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  96.7    3e-20   
ref|XP_009357958.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  99.0    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_008340674.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  98.2    9e-20   
ref|XP_010527184.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  95.1    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_008460666.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  94.0    1e-18   Cucumis melo [Oriental melon]
ref|XP_010467088.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  93.6    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006418762.1|  hypothetical protein EUTSA_v10002467mg           92.8    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_006297361.1|  hypothetical protein CARUB_v10013381mg           92.8    4e-18   Capsella rubella
ref|NP_973990.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B       92.0    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973991.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B       92.0    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490131.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  92.0    6e-18   Cicer arietinum [garbanzo]
ref|XP_004169939.1|  PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRN...  92.4    6e-18   
gb|KGN61558.1|  hypothetical protein Csa_2G170810                     92.4    6e-18   Cucumis sativus [cucumbers]
ref|XP_004147167.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  92.4    6e-18   
ref|NP_564530.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B       91.7    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010412724.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  91.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010490175.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  91.3    1e-17   
gb|KDO52268.1|  hypothetical protein CISIN_1g043020mg                 90.9    2e-17   Citrus sinensis [apfelsine]
ref|XP_006420387.1|  hypothetical protein CICLE_v10004652mg           90.9    2e-17   
emb|CDX93007.1|  BnaA03g37290D                                        90.9    2e-17   
ref|XP_009135887.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  90.9    2e-17   Brassica rapa
emb|CDX94828.1|  BnaC03g43600D                                        90.9    2e-17   
gb|KFK39734.1|  hypothetical protein AALP_AA3G281100                  90.1    3e-17   Arabis alpina [alpine rockcress]
gb|AAF79700.1|AC020889_8  T1N15.14                                    89.4    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003614593.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  89.0    8e-17   Medicago truncatula
ref|XP_006480233.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  87.4    2e-16   Citrus sinensis [apfelsine]
ref|XP_010532821.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  86.3    7e-16   Tarenaya hassleriana [spider flower]
ref|XP_006854350.1|  hypothetical protein AMTR_s00039p00150510        84.7    2e-15   Amborella trichopoda
ref|XP_010936074.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  83.6    6e-15   Elaeis guineensis
ref|XP_010936076.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  83.6    6e-15   Elaeis guineensis
gb|EPS62098.1|  hypothetical protein M569_12692                       82.4    1e-14   Genlisea aurea
ref|NP_001068056.2|  Os11g0544800                                     80.9    4e-14   
ref|XP_008796400.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  80.9    4e-14   Phoenix dactylifera
ref|XP_009420258.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  77.8    8e-14   
ref|XP_007137464.1|  hypothetical protein PHAVU_009G129000g           75.9    9e-14   Phaseolus vulgaris [French bean]
gb|ADE76344.1|  unknown                                               79.7    1e-13   Picea sitchensis
sp|A2ZF53.1|GATB_ORYSI  RecName: Full=Glutamyl-tRNA(Gln) amidotra...  77.8    4e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001167978.1|  hypothetical protein                             75.1    4e-13   
gb|EMS48922.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  77.0    8e-13   Triticum urartu
gb|ESV64564.1|  gatB/GatE catalytic domain protein                    73.9    9e-13   Mycobacteroides abscessus MAB_091912_2446
ref|XP_002450901.1|  hypothetical protein SORBIDRAFT_05g020870        76.6    1e-12   Sorghum bicolor [broomcorn]
gb|AFW64900.1|  hypothetical protein ZEAMMB73_511569                  76.6    1e-12   
gb|AEI54824.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.6    1e-12   Mycobacteroides chelonae
gb|AEI54822.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.6    1e-12   Mycobacteroides franklinii
ref|WP_030094130.1|  glutamyl-tRNA amidotransferase                   76.6    1e-12   Mycobacteroides
gb|AEI54825.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.3    1e-12   Mycobacteroides immunogenum
gb|AEI54823.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.3    1e-12   Mycobacteroides abscessus subsp. bolletii
ref|WP_005077118.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  76.3    1e-12   Mycobacteroides abscessus
gb|AEI54821.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.3    1e-12   Mycobacteroides abscessus
gb|AEI54826.1|  aspartyl/glutamyl-tRNA amidotransferase B subunit     76.3    1e-12   Mycobacteroides abscessus subsp. massiliense
ref|WP_016891258.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  76.3    1e-12   Mycobacteroides abscessus
gb|EMS55713.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  76.6    1e-12   Triticum urartu
ref|WP_043078637.1|  glutamyl-tRNA amidotransferase                   76.3    1e-12   Mycobacteroides immunogenum
ref|WP_017207721.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  76.3    1e-12   
ref|WP_005069760.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  76.3    1e-12   Mycobacteroides abscessus
ref|WP_005093966.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  76.3    1e-12   Mycobacteroides abscessus
ref|WP_005056810.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  76.3    1e-12   Mycobacteroides abscessus
gb|ACY99093.1|  glutamyl-tRNA(Gln) amidotransferase, B subunit        76.3    1e-12   Thermomonospora curvata DSM 43183
ref|WP_041439968.1|  glutamyl-tRNA amidotransferase                   76.3    1e-12   Thermomonospora curvata
ref|XP_002972781.1|  hypothetical protein SELMODRAFT_441971           75.9    2e-12   
gb|EMT05438.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  75.9    2e-12   
dbj|BAJ94910.1|  predicted protein                                    75.9    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575991.2|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  75.9    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_004979428.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  75.9    2e-12   Setaria italica
ref|XP_002984359.1|  hypothetical protein SELMODRAFT_120349           75.5    2e-12   
dbj|BAJ96366.1|  predicted protein                                    75.5    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_033340300.1|  glutamyl-tRNA amidotransferase                   75.1    3e-12   Catenuloplanes japonicus
ref|WP_012894456.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  75.1    3e-12   Streptosporangium roseum
ref|WP_030913698.1|  glutamyl-tRNA amidotransferase                   75.1    3e-12   Streptosporangium amethystogenes
ref|WP_013133058.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  75.1    3e-12   Thermobispora bispora
ref|WP_026442077.1|  glutamyl-tRNA amidotransferase                   75.1    3e-12   Acidobacterium ailaaui
ref|WP_036331275.1|  glutamyl-tRNA amidotransferase                   75.1    4e-12   Microbispora sp. ATCC PTA-5024
ref|WP_030456559.1|  glutamyl-tRNA amidotransferase                   74.7    4e-12   Herbidospora cretacea
gb|EMT25645.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  75.1    4e-12   
gb|ABJ88619.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  74.3    5e-12   Candidatus Solibacter usitatus Ellin6076
ref|WP_020574762.1|  hypothetical protein                             74.3    5e-12   Actinopolymorpha alba
ref|WP_041860409.1|  glutamyl-tRNA amidotransferase                   74.3    5e-12   
ref|WP_030506104.1|  glutamyl-tRNA amidotransferase                   74.3    5e-12   Microbispora rosea
ref|WP_037937256.1|  glutamyl-tRNA amidotransferase                   73.6    9e-12   
ref|WP_027343799.1|  glutamyl-tRNA amidotransferase                   73.2    1e-11   Hamadaea tsunoensis
ref|WP_011525511.1|  glutamyl-tRNA amidotransferase subunit B         73.2    1e-11   Candidatus Koribacter versatilis
ref|WP_019145289.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  73.2    1e-11   Aeromicrobium massiliense
ref|WP_005182543.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.8    2e-11   Gordonia amarae
ref|WP_015897906.1|  glutamyl-tRNA amidotransferase subunit B         72.8    2e-11   Acidobacterium capsulatum
ref|WP_020523275.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.8    2e-11   Catelliglobosispora koreensis
ref|XP_006662992.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...  72.8    2e-11   Oryza brachyantha
ref|WP_006554542.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  72.4    2e-11   Rhodococcus
gb|EUA14014.1|  gatB/GatE catalytic domain protein                    69.7    2e-11   Mycobacterium xenopi 4042
ref|XP_001782927.1|  predicted protein                                72.4    2e-11   
ref|WP_022922808.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.4    3e-11   Ornithinimicrobium pekingense
ref|WP_003922147.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.4    3e-11   Mycobacterium xenopi
gb|EUA33956.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,...  71.2    3e-11   Mycobacterium xenopi 3993
ref|WP_020622202.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.0    3e-11   Pseudonocardia
ref|WP_022910338.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.0    3e-11   Aestuariimicrobium kwangyangense
ref|WP_044510611.1|  glutamyl-tRNA amidotransferase                   72.0    3e-11   Mycobacterium simiae
ref|WP_040158353.1|  glutamyl-tRNA amidotransferase                   72.0    3e-11   Mobilicoccus massiliensis
ref|WP_033241269.1|  MULTISPECIES: glutamyl-tRNA amidotransferase     72.0    3e-11   Nocardia carnea
ref|XP_007510369.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  72.0    3e-11   Bathycoccus prasinos
ref|WP_035277884.1|  glutamyl-tRNA amidotransferase                   72.0    3e-11   Actinokineospora spheciospongiae
ref|WP_022363912.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  72.0    4e-11   
ref|WP_012799286.1|  glutamyl-tRNA(Gln) amidotransferase              72.0    4e-11   Slackia heliotrinireducens
ref|WP_009076158.1|  glutamyl-tRNA(Gln) amidotransferase              71.6    4e-11   Slackia sp. CM382
ref|WP_022335033.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  71.6    4e-11   
gb|EEZ60376.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,...  71.6    4e-11   Slackia exigua ATCC 700122
ref|WP_043962246.1|  glutamyl-tRNA amidotransferase                   71.6    4e-11   Micromonospora carbonacea
ref|WP_040836935.1|  glutamyl-tRNA amidotransferase                   71.6    4e-11   Nocardia brevicatena
ref|WP_040619462.1|  glutamyl-tRNA amidotransferase                   71.6    4e-11   Slackia exigua
ref|WP_012950071.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.6    4e-11   Geodermatophilus obscurus
ref|WP_007320107.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.6    4e-11   Gordonia effusa
ref|WP_030448195.1|  glutamyl-tRNA amidotransferase                   71.6    4e-11   Actinocatenispora sera
ref|WP_040791483.1|  glutamyl-tRNA amidotransferase                   71.6    4e-11   Nocardia paucivorans
ref|WP_007075105.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.6    4e-11   Micromonospora sp. ATCC 39149
ref|WP_038154229.1|  hypothetical protein                             66.6    4e-11   
ref|WP_013673962.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.6    5e-11   Pseudonocardia dioxanivorans
ref|WP_014742435.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.6    5e-11   Modestobacter marinus
ref|WP_036340042.1|  glutamyl-tRNA amidotransferase                   71.6    5e-11   Modestobacter caceresii
ref|WP_007717546.1|  Asp-tRNAAsn/Glu-tRNAGln amidotransferase B s...  67.0    5e-11   
ref|WP_023646468.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.2    6e-11   actinobacterium LLX17
ref|WP_031577466.1|  glutamyl-tRNA amidotransferase                   71.2    6e-11   Proteiniclasticum ruminis
ref|XP_001420207.1|  predicted protein                                71.2    6e-11   Ostreococcus lucimarinus CCE9901
ref|WP_009742277.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.2    6e-11   Frankia sp. QA3
ref|XP_011398000.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  71.2    6e-11   Auxenochlorella protothecoides
ref|WP_011606921.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  71.2    6e-11   Frankia alni
ref|WP_030164576.1|  glutamyl-tRNA amidotransferase                   71.2    6e-11   Spirillospora albida
gb|KJE22073.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  70.9    7e-11   Frankia torreyi
ref|WP_026403873.1|  glutamyl-tRNA amidotransferase                   70.9    7e-11   Actinomadura
ref|WP_029366059.1|  glutamyl-tRNA amidotransferase                   70.9    7e-11   Mycobacterium sp. UM_WWY
emb|CEG00947.1|  Aspartyl/Glutamyl-tRNA(Gln) amidotransferase,sub...  70.9    7e-11   Ostreococcus tauri
ref|WP_022565549.1|  MULTISPECIES: aspartyl/glutamyl-tRNA(Asn/Gln...  70.9    7e-11   Actinobacteria
ref|WP_010228366.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    7e-11   Pseudonocardia
ref|WP_018729841.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_018218868.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_011905123.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  70.9    8e-11   Salinispora tropica
ref|WP_027658896.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Salinispora pacifica
ref|WP_040338263.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Candidatus Blastococcus massiliensis
ref|WP_019871103.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_018743029.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_024101389.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Rhodococcus
ref|WP_019288389.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Rhodococcus biphenylivorans
ref|WP_016932865.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Rhodococcus sp. R1101
ref|WP_016691191.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Rhodococcus rhodochrous
ref|WP_012464030.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Methylacidiphilum infernorum
ref|WP_026856068.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Geodermatophilaceae bacterium URHB0062
ref|WP_018723578.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_014815105.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Mycolicibacterium chubuense
ref|WP_018156521.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Demetria terragena
ref|WP_018820772.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_018253776.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_023963824.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Williamsia sp. D3
ref|WP_039688206.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Coriobacteriaceae bacterium 68-1-3
ref|WP_025617559.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Salinispora pacifica
ref|WP_030172058.1|  MULTISPECIES: glutamyl-tRNA amidotransferase     70.9    8e-11   Actinobacteria
ref|WP_040749810.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Nocardia transvalensis
ref|WP_028569219.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Salinispora tropica
ref|WP_017973960.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Actinopolyspora halophila
ref|WP_009139480.1|  glutamyl-tRNA(Gln) amidotransferase              70.9    8e-11   Slackia piriformis
ref|WP_027654083.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Salinispora pacifica
ref|WP_026848022.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Geodermatophilaceae bacterium URHA0031
ref|WP_018725886.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_024806598.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Nocardia sp. BMG51109
ref|WP_041328718.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   
ref|WP_027645334.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Salinispora pacifica
ref|WP_018220802.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.9    8e-11   Salinispora pacifica
ref|WP_043655346.1|  glutamyl-tRNA amidotransferase                   70.9    8e-11   Nocardia thailandica
ref|WP_010838482.1|  glutamyl-tRNA(Gln) amidotransferase subunit B    70.9    9e-11   Rhodococcus rhodnii
ref|WP_027007235.1|  glutamyl-tRNA amidotransferase                   70.5    9e-11   Conexibacter woesei
ref|WP_010632510.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    9e-11   Sporolactobacillus vineae
ref|WP_006339119.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    9e-11   Gordonia rhizosphera
ref|WP_018640536.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    9e-11   Frankia elaeagni
ref|WP_007534192.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    9e-11   Rhodococcus triatomae
gb|ABG03802.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  70.5    9e-11   Rubrobacter xylanophilus DSM 9941
ref|WP_029432844.1|  glutamyl-tRNA amidotransferase                   70.5    9e-11   Blastococcus sp. URHD0036
ref|WP_020105527.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    1e-10   Nocardia sp. 348MFTsu5.1
ref|WP_040797543.1|  glutamyl-tRNA amidotransferase                   70.5    1e-10   Nocardia higoensis
ref|WP_011210772.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    1e-10   Nocardiaceae
dbj|GAB10695.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...  70.5    1e-10   Gordonia araii NBRC 100433
ref|WP_028652445.1|  glutamyl-tRNA amidotransferase                   70.5    1e-10   Nocardioides halotolerans
ref|WP_007616472.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  70.5    1e-10   Gordonia soli
ref|WP_040523138.1|  glutamyl-tRNA amidotransferase                   70.5    1e-10   Gordonia araii
ref|WP_007077397.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.5    1e-10   Aeromicrobium marinum
ref|WP_019121668.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Brevibacillus massiliensis
ref|WP_040708934.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Nocardia takedensis
ref|WP_013980364.1|  glutamyl-tRNA(Gln) amidotransferase              70.5    1e-10   Eggerthella sp. YY7918
ref|WP_036538506.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Nocardia cyriacigeorgica
ref|WP_005626440.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Mycolicibacterium hassiacum
ref|WP_006592248.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Kineosphaera limosa
ref|WP_014352185.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   
ref|WP_029026659.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Salinispora arenicola
ref|WP_026337226.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   
ref|WP_028075227.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Solirubrobacterales bacterium URHD0059
ref|WP_018806728.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_039070039.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   
ref|WP_029020167.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Salinispora arenicola
ref|WP_003389391.1|  glutamyl-tRNA(Gln) amidotransferase subunit B    70.1    1e-10   Brevibacillus borstelensis
ref|WP_028183904.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Salinispora arenicola
ref|WP_019902083.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_020216556.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_012181331.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_029536616.1|  glutamyl-tRNA amidotransferase                   70.1    1e-10   Salinispora arenicola
ref|WP_020609012.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_018798574.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_016811336.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Salinispora arenicola
ref|WP_014377564.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Blastococcus saxobsidens
ref|WP_005832547.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  70.1    1e-10   Bacillales
ref|WP_009059364.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Methylacidiphilum fumariolicum
ref|WP_003893735.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    1e-10   Mycolicibacterium smegmatis
ref|WP_028984882.1|  glutamyl-tRNA amidotransferase                   70.1    2e-10   
ref|WP_018526987.1|  hypothetical protein                             70.5    2e-10   Alkalispirochaeta alkalica
ref|WP_036388300.1|  glutamyl-tRNA amidotransferase                   70.1    2e-10   Mycolicibacterium
ref|WP_003889203.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  70.1    2e-10   Mycolicibacterium phlei
ref|WP_021978492.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  69.7    2e-10   
ref|WP_019343139.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Mycolicibacterium
ref|WP_030521902.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Nocardia rhamnosiphila
ref|WP_029111418.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycobacterium sp. URHD0025
ref|WP_003881160.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  69.7    2e-10   Mycobacteriaceae
ref|WP_039825960.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Nocardia testacea
ref|WP_036467924.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycobacterium triplex
ref|WP_023556513.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Brevibacillus panacihumi
ref|WP_036354420.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycobacterium asiaticum
ref|WP_039318746.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycolicibacterium setense
ref|WP_015540376.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  69.7    2e-10   Gordonibacter pamelaeae
ref|WP_036439410.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycolicibacterium porcinum
ref|WP_030337181.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Micromonospora parva
ref|WP_009304795.1|  MULTISPECIES: glutamyl-tRNA(Gln) amidotransf...  69.7    2e-10   Eggerthella
ref|WP_016741203.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Bacillales
ref|WP_030487387.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Micromonospora chokoriensis
ref|WP_017249802.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Brevibacillus brevis
ref|WP_012684435.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Brevibacillus brevis
ref|WP_033364570.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Dactylosporangium aurantiacum
ref|WP_024447856.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Mycolicibacterium iranicum
ref|WP_027507018.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Rhodococcus sp. UNC23MFCrub1.1
ref|WP_026214499.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Nonomuraea coxensis
ref|WP_011779346.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  69.7    2e-10   Mycolicibacterium
ref|WP_042436534.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Senegalimassilia anaerobia
gb|EQI15304.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,...  69.7    2e-10   Clostridioides difficile F501
ref|WP_041832812.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   Actinoplanes sp. N902-109
gb|AGL20505.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B     69.7    2e-10   Actinoplanes sp. N902-109
ref|WP_041835344.1|  glutamyl-tRNA amidotransferase                   69.7    2e-10   
gb|ABK52471.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  69.7    2e-10   Acidothermus cellulolyticus 11B
ref|WP_003928698.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Mycolicibacterium vaccae
ref|WP_011291056.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.7    2e-10   Thermobifida fusca
ref|WP_006895927.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  69.3    2e-10   Gordonia
ref|WP_012796364.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_015306169.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...  69.3    2e-10   
ref|WP_036436479.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_040737603.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_035932615.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_009677524.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_029114988.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_022409295.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  69.3    2e-10   
ref|WP_014987188.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_028950402.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_029898445.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_042254046.1|  MULTISPECIES: glutamyl-tRNA amidotransferase     69.3    2e-10   
ref|WP_013138068.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_037045101.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_043618481.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_043729219.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_019930123.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_013076725.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_018600858.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    2e-10   
ref|WP_040860498.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_025351857.1|  glutamyl-tRNA amidotransferase                   69.3    2e-10   
ref|WP_020147318.1|  hypothetical protein                             69.3    3e-10   
gb|AHH20498.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  69.3    3e-10   
ref|WP_015554514.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  69.3    3e-10   
ref|WP_010841333.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  69.3    3e-10   
ref|WP_016700237.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  69.3    3e-10   
gb|AFA74035.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  69.3    3e-10   
dbj|GAB24332.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...  69.3    3e-10   
ref|WP_035728298.1|  glutamyl-tRNA amidotransferase                   69.3    3e-10   
ref|WP_040868530.1|  glutamyl-tRNA amidotransferase                   69.3    3e-10   
gb|ADU48881.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  69.3    3e-10   
ref|WP_027115653.1|  glutamyl-tRNA amidotransferase                   69.3    3e-10   
ref|WP_041308688.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_026920012.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_021658046.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.9    3e-10   
ref|WP_030104021.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_026417158.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_039816201.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_025738314.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_012674285.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_029930147.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_031465231.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_035731267.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_020392867.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_013807995.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_031350746.1|  glutamyl-tRNA amidotransferase                   65.9    3e-10   
ref|WP_020495366.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_012393520.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_020724633.1|  Aspartyl-tRNA(Asn) amidotransferase subunit B    68.9    3e-10   
ref|WP_014787407.1|  glutamyl-tRNA amidotransferase subunit B         68.9    3e-10   
gb|EUA90472.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,...  68.9    3e-10   
ref|WP_011438018.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.9    3e-10   
ref|WP_011855287.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_011559294.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.9    3e-10   
ref|WP_011740014.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_036503897.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_035910527.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_007456318.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_022476361.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.9    3e-10   
ref|WP_028472186.1|  glutamyl-tRNA amidotransferase                   68.9    3e-10   
ref|WP_007171310.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    3e-10   
ref|WP_039779921.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_028476431.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_015294101.1|  Putative glutamyl-tRNA(Gln) amidotransferase...  68.9    4e-10   
ref|WP_025274288.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_010305575.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    4e-10   
ref|WP_018178962.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    4e-10   
ref|WP_020458724.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.9    4e-10   
ref|WP_030161212.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_029100781.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_040720710.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_030512946.1|  glutamyl-tRNA amidotransferase                   68.9    4e-10   
ref|WP_017718972.1|  glutamyl-tRNA amidotransferase subunit B         68.6    4e-10   
gb|KIY93493.1|  aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)amidotransf...  67.8    4e-10   
ref|WP_014385484.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_014942669.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_027094525.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_008518554.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_008259040.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.6    4e-10   
ref|WP_029338987.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_043572312.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_042912748.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_014383014.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.6    4e-10   
ref|WP_019006189.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_009952796.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.6    4e-10   
ref|WP_033323914.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
gb|EGY76876.1|  glutamyl-tRNA(Gln) amidotransferase subunit B         68.6    4e-10   
ref|WP_036902427.1|  MULTISPECIES: glutamyl-tRNA amidotransferase     68.6    4e-10   
emb|CAJ73887.1|  strongly similar to aspartyl/glutamyl-tRNA(Asn/G...  68.6    4e-10   
ref|WP_018504497.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_033380379.1|  glutamyl-tRNA amidotransferase                   68.6    4e-10   
ref|WP_015582726.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    4e-10   
ref|WP_019733034.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
gb|EPH01931.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  68.6    5e-10   
ref|WP_023561984.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
ref|WP_023865123.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.6    5e-10   
ref|WP_003874999.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
ref|WP_036976595.1|  glutamyl-tRNA amidotransferase                   68.6    5e-10   
ref|WP_037257209.1|  glutamyl-tRNA amidotransferase                   68.6    5e-10   
ref|WP_021108502.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.6    5e-10   
ref|WP_023862558.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
gb|ERS37016.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  68.6    5e-10   
ref|WP_022182457.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    5e-10   
ref|WP_029412178.1|  glutamyl-tRNA amidotransferase                   68.2    5e-10   
ref|WP_022924346.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
gb|EUA36903.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,...  68.6    5e-10   
ref|WP_022737052.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    5e-10   
ref|WP_022447015.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    5e-10   
ref|WP_018791696.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
ref|WP_003927739.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.6    5e-10   
gb|ETB50841.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B     68.2    5e-10   
ref|WP_022369903.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.6    5e-10   
ref|WP_008358459.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    5e-10   
emb|CAM05344.1|  glutamyl-tRNA(Gln) amidotransferase subunit B        68.2    5e-10   
ref|WP_028777873.1|  glutamyl-tRNA amidotransferase                   68.2    5e-10   
ref|WP_009479671.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.2    5e-10   
ref|WP_012922469.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    5e-10   
ref|WP_015355117.1|  MULTISPECIES: glutamyl-tRNA(Gln) amidotransf...  68.2    5e-10   
ref|WP_028646926.1|  glutamyl-tRNA amidotransferase                   68.2    5e-10   
ref|WP_009944384.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    5e-10   
ref|WP_004019298.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    5e-10   
ref|WP_005240367.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_042576498.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_010277366.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_036541422.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_028931221.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_019969565.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_009778120.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_015255721.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_007775546.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_019854927.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    6e-10   
ref|WP_022483984.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    6e-10   
ref|WP_021030736.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    6e-10   
ref|WP_044484729.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_026448420.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
gb|EME63190.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B     68.2    6e-10   
emb|CDZ91891.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...  68.2    6e-10   
ref|WP_040782611.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_017682349.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  68.2    6e-10   
ref|WP_026313700.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_022184440.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    6e-10   
ref|WP_030429074.1|  glutamyl-tRNA amidotransferase                   68.2    6e-10   
ref|WP_014694326.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  68.2    7e-10   
ref|WP_006723153.1|  glutamyl-tRNA(Gln) amidotransferase              68.2    7e-10   
ref|WP_021899245.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  68.2    7e-10   
ref|WP_006942345.1|  MULTISPECIES: Aspartyl-tRNA(Asn) amidotransf...  68.2    7e-10   
ref|WP_040826403.1|  glutamyl-tRNA amidotransferase                   68.2    7e-10   
ref|WP_043407441.1|  glutamyl-tRNA amidotransferase                   68.2    7e-10   
gb|ETT29204.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...  68.2    7e-10   
ref|WP_039799668.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_024440175.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_020309846.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  67.8    7e-10   
ref|WP_043695628.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_034129993.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_014016524.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    7e-10   
ref|WP_027499200.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_036204577.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_027895030.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_036406795.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_013829657.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    7e-10   
ref|WP_012834956.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    7e-10   
ref|WP_014447240.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    7e-10   
ref|WP_043326041.1|  glutamyl-tRNA amidotransferase                   67.8    7e-10   
ref|WP_036411919.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_037142625.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_014028695.1|  glutamyl-tRNA amidotransferase subunit B         67.8    8e-10   
ref|WP_037111354.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
emb|CDQ11400.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...  67.8    8e-10   
ref|WP_030500901.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_009481195.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_019664318.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_033090099.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_020110342.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  67.8    8e-10   
ref|WP_035194500.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_019739063.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_044503902.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_022367320.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  67.8    8e-10   
ref|WP_023372168.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_018786240.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_030270131.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_013474304.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_013284471.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_033233153.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_038091799.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_023408904.1|  hypothetical protein                             67.8    8e-10   
ref|WP_040780862.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_037189745.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_014214132.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    8e-10   
ref|WP_036619748.1|  glutamyl-tRNA amidotransferase                   67.8    8e-10   
ref|WP_032397752.1|  glutamyl-tRNA amidotransferase                   67.8    9e-10   
ref|WP_040811181.1|  glutamyl-tRNA amidotransferase                   67.8    9e-10   
ref|WP_003530973.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_037245430.1|  glutamyl-tRNA amidotransferase                   67.8    9e-10   
ref|WP_009431837.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_009222514.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_006541003.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    9e-10   
ref|WP_010850283.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  67.8    9e-10   
ref|WP_013732010.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.8    9e-10   
ref|WP_022238092.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  67.4    9e-10   
ref|WP_036728264.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_027496639.1|  MULTISPECIES: glutamyl-tRNA amidotransferase     67.8    9e-10   
ref|WP_034438898.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_032366366.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_031703140.1|  glutamyl-tRNA amidotransferase                   64.3    9e-10   
ref|WP_008717459.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  67.4    9e-10   
ref|WP_042737032.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_003944692.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_019747920.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  67.4    9e-10   
ref|WP_029422739.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_005566378.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...  67.4    9e-10   
ref|WP_006245701.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_018351360.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
ref|WP_043069439.1|  glutamyl-tRNA amidotransferase                   67.4    9e-10   
ref|WP_013472170.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    9e-10   
emb|CBH49156.1|  glutamyl-tRNA(Gln) amidotransferase subunit B GatB   67.4    1e-09   
ref|WP_021624980.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...  67.4    1e-09   
ref|WP_041674791.1|  glutamyl-tRNA amidotransferase                   67.4    1e-09   
ref|WP_030535407.1|  glutamyl-tRNA amidotransferase                   67.4    1e-09   
ref|WP_043067115.1|  glutamyl-tRNA amidotransferase                   67.4    1e-09   
ref|WP_005259502.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    1e-09   
ref|WP_011895088.1|  aspartyl/glutamyl-tRNA amidotransferase subu...  67.4    1e-09   



>ref|XP_009589035.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X2 [Nicotiana tomentosiformis]
Length=478

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T  RGIQ  P   Y   YF+RKH  LYC +   +T T TQEK+Q KLK   +NQSK 
Sbjct  1    MALTFLRGIQLNPSMLYPSSYFARKHGVLYCCMRSAQTQTATQEKEQPKLKVSTQNQSKT  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D ILKDYE++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKILKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_009589032.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589033.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589034.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
Length=548

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T  RGIQ  P   Y   YF+RKH  LYC +   +T T TQEK+Q KLK   +NQSK 
Sbjct  1    MALTFLRGIQLNPSMLYPSSYFARKHGVLYCCMRSAQTQTATQEKEQPKLKVSTQNQSKT  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D ILKDYE++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKILKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_009797353.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=480

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T  RGIQ  P   Y   YF+RKH  L+C +   +T T TQEK+Q KLK   +NQSK 
Sbjct  1    MALTFLRGIQLNPSMLYPSSYFARKHGVLFCCMRSAQTQTATQEKEQPKLKISTQNQSKT  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D ILKDYE++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKILKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_009797350.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009797351.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009797352.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=548

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T  RGIQ  P   Y   YF+RKH  L+C +   +T T TQEK+Q KLK   +NQSK 
Sbjct  1    MALTFLRGIQLNPSMLYPSSYFARKHGVLFCCMRSAQTQTATQEKEQPKLKISTQNQSKT  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D ILKDYE++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKILKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_010326798.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Solanum lycopersicum]
Length=548

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T FRGIQ  P   Y   YF+RKH  LYC +   +T T TQEK+QTKLKG  ++Q K 
Sbjct  1    MALTFFRGIQLNPSMLYPSSYFARKHGVLYCCMRSAQTQTATQEKEQTKLKGSTQSQPKA  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D  LKD+E++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKFLKDFEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_006340880.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=554

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++T  RGIQ  P   Y   YF+RKH  LYC +   +T T TQEK+QTKLK   ++Q K 
Sbjct  1    MALTFLRGIQLNPSMLYPSSYFARKHGVLYCCMRNAQTQTATQEKEQTKLKVSTQSQPKA  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D  LKD+E++IGIETHVQLSTLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   VDKFLKDFEAVIGIETHVQLSTLTKAFCSCPYNYGSPPNTSVCPVCMGL  109



>ref|XP_002528338.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
[Ricinus communis]
 sp|B9SQR9.1|GATB_RICCO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Ricinus communis]
 gb|EEF34010.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
[Ricinus communis]
Length=549

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+ TLFR IQ +PL  Y   +F RK +  YCT+  T    T +++Q  ++K  P+ QSK 
Sbjct  1    MASTLFRNIQTHPLLLYPTSFFRRKSSVFYCTVNSTSPTATQEKQQCPRIKVSPQTQSKS  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD + KDYE+IIGIETHVQLSTLTKAFC CPY YGA PN+ ICP+CMG 
Sbjct  61   LDKLTKDYETIIGIETHVQLSTLTKAFCSCPYNYGAQPNSTICPVCMGL  109



>ref|XP_011091352.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091353.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091354.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091356.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
Length=548

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++TLFRG+Q    R Y   Y SRKH  LYC++   E  T TQEKQQT+LK   K +S  
Sbjct  1    MALTLFRGLQSNSFRLYSSVYVSRKHGVLYCSMRSAEGQTATQEKQQTQLKASLKKESTK  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             + +LK+YE++IGIETHVQLST TKAFC CPY YGA PNT ICPICMG 
Sbjct  61   FEELLKNYEAVIGIETHVQLSTHTKAFCSCPYNYGAQPNTSICPICMGL  109



>ref|XP_002311699.2| GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family protein [Populus trichocarpa]
 gb|EEE89066.2| GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family protein [Populus trichocarpa]
Length=538

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 6/115 (5%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqt------klkglP  485
            M+ TLFR IQ +P+  Y    F RK+  LYCT++ + ++TT  +          + K  P
Sbjct  1    MASTLFRNIQTHPILLYPSVLFRRKNGALYCTMKSSSSSTTQTQTATQEKQQNPQTKVSP  60

Query  486  KNQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            + Q+K +D  +KDYE+IIGIETHVQLSTLTKAFCGCPY YGA PNT ICP+CMG 
Sbjct  61   QTQTKGIDKRIKDYEAIIGIETHVQLSTLTKAFCGCPYNYGAQPNTSICPVCMGL  115



>ref|XP_011029735.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029736.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029737.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029738.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029739.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
Length=546

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+ TLFR IQ +P+  Y    F RK+  LYCT++ + ++TT  +    +    P+  +K 
Sbjct  1    MASTLFRNIQTHPILFYPSVLFRRKNGALYCTMKSSSSSTTQTQTATLEKHQNPR--TKV  58

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D  +KDYE+IIGIETHVQLSTLTKAFCGCPY YGA PNT ICP+CMG 
Sbjct  59   IDKRIKDYEAIIGIETHVQLSTLTKAFCGCPYNYGAQPNTSICPVCMGL  107



>ref|XP_010650169.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Vitis vinifera]
 ref|XP_010650170.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Vitis vinifera]
Length=548

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+  LFRG+Q  P   Y    F RK   LYCT++ T+T+T   E +Q +LK  P+ ++K 
Sbjct  1    MASILFRGVQARPFLLYPSALFGRKSGVLYCTIKGTQTHTAAPENKQPQLKVSPQTKAKV  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD I +DYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  61   LDKISQDYEAIIGIETHVQLSTLTKAFCSCPYNYGSQPNTCICPICMGL  109



>gb|KJB38439.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
Length=502

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQ-SK  500
            M+ TLFR IQ +P   Y    FSR++  LYCT++ ++T T TQEKQQ     +P++   K
Sbjct  1    MASTLFRTIQIHPFLLYPTALFSRRNGVLYCTMKSSQTQTATQEKQQPPKVKVPQHALKK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             +D I +DYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  61   TVDKITRDYEAIIGIETHVQLSTLTKAFCSCPYNYGSQPNTSICPICMGL  110



>gb|KJB38438.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38440.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38441.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38442.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38443.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
Length=565

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQ-SK  500
            M+ TLFR IQ +P   Y    FSR++  LYCT++ ++T T TQEKQQ     +P++   K
Sbjct  1    MASTLFRTIQIHPFLLYPTALFSRRNGVLYCTMKSSQTQTATQEKQQPPKVKVPQHALKK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             +D I +DYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  61   TVDKITRDYEAIIGIETHVQLSTLTKAFCSCPYNYGSQPNTSICPICMGL  110



>ref|XP_011041462.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X2 [Populus euphratica]
 ref|XP_011041463.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X2 [Populus euphratica]
Length=300

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  282  SLFLILKLE*RIYNMSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekq  461
            SL LI+K        + TL R IQ  PL  Y   +F RK+  LY T++ +    T    Q
Sbjct  10   SLELIIK-----KTTASTLLRSIQTVPLLLYPSAFFRRKNGALYWTMKSSSVTQTQTAIQ  64

Query  462  qtklkglPK----NQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYI  629
            + K     K     Q+K +D ++KDYE+IIGIETHVQLSTLTKAFCGCPY YGA PNT I
Sbjct  65   EKKQNPQIKASTLTQTKTIDKLIKDYEAIIGIETHVQLSTLTKAFCGCPYNYGAQPNTSI  124

Query  630  CPICMGF  650
            CP+CMG 
Sbjct  125  CPVCMGL  131



>ref|XP_011041460.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=338

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = +3

Query  282  SLFLILKLE*RIYNMSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekq  461
            SL LI+K        + TL R IQ  PL  Y   +F RK+  LY T++ +    T    Q
Sbjct  10   SLELIIK-----KTTASTLLRSIQTVPLLLYPSAFFRRKNGALYWTMKSSSVTQTQTAIQ  64

Query  462  qtklkglPK----NQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYI  629
            + K     K     Q+K +D ++KDYE+IIGIETHVQLSTLTKAFCGCPY YGA PNT I
Sbjct  65   EKKQNPQIKASTLTQTKTIDKLIKDYEAIIGIETHVQLSTLTKAFCGCPYNYGAQPNTSI  124

Query  630  CPICMGF  650
            CP+CMG 
Sbjct  125  CPVCMGL  131



>ref|XP_010264847.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264848.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264849.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264850.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
Length=548

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+  LFRGIQ  P   Y     SRK+  L+CT + +++ T TQE QQT++K  P+  +K 
Sbjct  1    MASVLFRGIQTRPFLLYPSALLSRKNGVLFCTTKCSQSQTATQENQQTQMKVSPRTHTKK  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            ++ IL DYE+IIGIETHVQL TLTKAFC C Y YG+ PNT +CPICMG 
Sbjct  61   VEKILHDYEAIIGIETHVQLDTLTKAFCSCAYLYGSQPNTNVCPICMGL  109



>gb|KCW63541.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=476

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++ L RGI+ YP       +  RK    YC +  TE  T TQ  Q T +K  P  + K 
Sbjct  1    MALLLCRGIRMYPPLLNYAAFLRRKSHVFYCAMSTTEAQTATQGSQSTPIKISPHRKEKG  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD++LKDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  61   LDDVLKDYEAIIGIETHVQLSTLTKAFCSCPYHYGSQPNTNICPVCMGL  109



>gb|KCW60134.1| hypothetical protein EUGRSUZ_H02859 [Eucalyptus grandis]
Length=528

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++ L RGI+ YP       +  RK    YC +  TE  T TQ  Q T +K  P  + K 
Sbjct  1    MALLLCRGIRMYPPLLNYAAFLRRKSHVFYCAMSTTEAQTATQGSQSTPIKISPHRKEKG  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD++LKDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  61   LDDVLKDYEAIIGIETHVQLSTLTKAFCSCPYHYGSQPNTNICPVCMGL  109



>gb|KCW63539.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=538

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++ L RGI+ YP       +  RK    YC +  TE  T TQ  Q T +K  P  + K 
Sbjct  1    MALLLCRGIRMYPPLLNYAAFLRRKSHVFYCAMSTTEAQTATQGSQSTPIKISPHRKEKG  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD++LKDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  61   LDDVLKDYEAIIGIETHVQLSTLTKAFCSCPYHYGSQPNTNICPVCMGL  109



>gb|KCW63540.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=536

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++ L RGI+ YP       +  RK    YC +  TE  T TQ  Q T +K  P  + K 
Sbjct  1    MALLLCRGIRMYPPLLNYAAFLRRKSHVFYCAMSTTEAQTATQGSQSTPIKISPHRKEKG  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD++LKDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  61   LDDVLKDYEAIIGIETHVQLSTLTKAFCSCPYHYGSQPNTNICPVCMGL  109



>ref|XP_010065851.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Eucalyptus grandis]
Length=548

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++ L RGI+ YP       +  RK    YC +  TE  T TQ  Q T +K  P  + K 
Sbjct  1    MALLLCRGIRMYPPLLNYAAFLRRKSHVFYCAMSTTEAQTATQGSQSTPIKISPHRKEKG  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD++LKDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  61   LDDVLKDYEAIIGIETHVQLSTLTKAFCSCPYHYGSQPNTNICPVCMGL  109



>gb|KHN21619.1| Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Glycine soja]
Length=548

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+ T+FR +Q +P   Y   +  R++   +   + T++ T TQ+ + T        QSK 
Sbjct  1    MASTIFRSLQVHPFLLYPTTFLRRRNEVFHLASKATQSQTDTQQTKVTTSS----TQSKK  56

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD I KDYE+IIGIETHVQLSTLTKAFCGCPY+YG+PPN+ ICPICMG 
Sbjct  57   LDKIPKDYEAIIGIETHVQLSTLTKAFCGCPYSYGSPPNSSICPICMGL  105



>ref|XP_003525222.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Glycine max]
Length=544

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+ T+FR +Q +P   Y   +  R++   +   + T++ T TQ+ + T        QSK 
Sbjct  1    MASTIFRSLQVHPFLLYPTTFLRRRNEVFHLASKATQSQTDTQQTKVTTSS----TQSKK  56

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD I KDYE+IIGIETHVQLSTLTKAFCGCPY+YG+PPN+ ICPICMG 
Sbjct  57   LDKIPKDYEAIIGIETHVQLSTLTKAFCGCPYSYGSPPNSSICPICMGL  105



>gb|EYU43758.1| hypothetical protein MIMGU_mgv1a003561mg [Erythranthe guttata]
Length=578

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +3

Query  318  YNMSVTLFRGIQFYPLRQYKFPY-FSRKHATLYCtlertetntttqekqq-tklkglPKN  491
            Y+M++TLFRG++    R Y      +RKH  L+C++  +    T  +++Q  +LK +PK 
Sbjct  26   YDMALTLFRGLRSNCFRSYPPSLCITRKHGVLHCSMSSSAQGQTATQEKQHAQLKDVPKR  85

Query  492  Q-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            + SK L+ +LK YE++IGIETHVQL+TLTKAFC CPY YGA PNT +CPICMG 
Sbjct  86   EPSKKLEEVLKHYEAVIGIETHVQLATLTKAFCSCPYNYGAQPNTSVCPICMGL  139



>gb|KHN16523.1| Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Glycine soja]
Length=434

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ ++FR +Q +P   Y   +  R++   + T + T++ T TQ++Q         + QSK
Sbjct  1    MASSIFRSLQVHPFMLYPTTFLRRRNGVFHLTTKATQSQTDTQQRQPQTKVSSSNSTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD I KDYE+IIGIETHVQLSTLTKAFCGCPY+YG+ PN+ ICPICMG 
Sbjct  61   KLDKIPKDYEAIIGIETHVQLSTLTKAFCGCPYSYGSSPNSSICPICMGL  110



>ref|XP_007035291.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 ref|XP_007035292.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 gb|EOY06217.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 gb|EOY06218.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
Length=549

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ TLFR IQ +P   Y      R++  LYCT++ T+T T TQEKQQ     + ++ QSK
Sbjct  1    MASTLFRTIQIHPFLLYPTAICRRRNGVLYCTMKSTQTQTATQEKQQPPKVKVSQHTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              D I +DYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  61   TPDKITRDYEAIIGIETHVQLSTLTKAFCSCPYNYGSQPNTSICPICMGL  110



>ref|XP_003530925.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Glycine max]
Length=549

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ ++FR +Q +P   Y   +  R++   + T + T++ T TQ++Q         + QSK
Sbjct  1    MASSIFRSLQVHPFMLYPTTFLRRRNGVFHLTTKATQSQTDTQQRQPQTKVSSSNSTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD I KDYE+IIGIETHVQLSTLTKAFCGCPY+YG+ PN+ ICPICMG 
Sbjct  61   KLDKIPKDYEAIIGIETHVQLSTLTKAFCGCPYSYGSSPNSSICPICMGL  110



>ref|XP_007160438.1| hypothetical protein PHAVU_002G322100g [Phaseolus vulgaris]
 gb|ESW32432.1| hypothetical protein PHAVU_002G322100g [Phaseolus vulgaris]
Length=548

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+  +FR +Q +P   Y      R++   + T + T++ T TQ +Q          QSK 
Sbjct  1    MASAIFRSLQVHPFLLYPTTLLRRRNGVYHLTTKATQSQTDTQPRQPQTKVSTSSTQSKK  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD I K+YE+IIGIETHVQLSTLTKAFCGCPY YG+PPN+ ICPICMG 
Sbjct  61   LDKIPKNYEAIIGIETHVQLSTLTKAFCGCPYHYGSPPNSSICPICMGL  109



>ref|XP_008224027.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Prunus mume]
 ref|XP_008224028.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Prunus mume]
Length=550

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ T+FR +  +P   +      RK   LYCT+   +T   TQEK + ++K  P + QSK
Sbjct  1    MASTIFRSLHSHPFLFHPTALIRRKDVILYCTMRSAQTQMATQEKVKPQVKVSPHSTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             L+   KDYE++IGIETHVQL+TLTKAFC CPY YG+PPNT +CPICMG 
Sbjct  61   ALEKAAKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSPPNTSVCPICMGL  110



>ref|XP_008224029.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Prunus mume]
Length=549

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ T+FR +  +P   +      RK   LYCT+   +T   TQEK + ++K  P + QSK
Sbjct  1    MASTIFRSLHSHPFLFHPTALIRRKDVILYCTMRSAQTQMATQEKVKPQVKVSPHSTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             L+   KDYE++IGIETHVQL+TLTKAFC CPY YG+PPNT +CPICMG 
Sbjct  61   ALEKAAKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSPPNTSVCPICMGL  110



>ref|XP_007223309.1| hypothetical protein PRUPE_ppa003810mg [Prunus persica]
 gb|EMJ24508.1| hypothetical protein PRUPE_ppa003810mg [Prunus persica]
Length=547

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            M+ T+FR +  +P   +      RK+  LYCT+   +T T TQEK + ++K  P + QSK
Sbjct  1    MASTIFRSLHSHPFLFHPTALIRRKYVILYCTMRSAQTQTATQEKVKPQVKVSPHSTQSK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             L+   KDYE++IGIETHVQL+TLTKAFC CPY YG+PPNT +CPICMG 
Sbjct  61   ALEKASKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSPPNTSVCPICMGL  110



>ref|XP_010667083.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667084.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=679

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqe-kqqtklkglPKNQSK  500
            M+  LFRG+Q  PL  Y     ++    L CT     T +   + K +++ K + +N  K
Sbjct  131  MASLLFRGLQIRPLCIYPSSLLTKNVGVLCCTSNALHTQSVKTQDKPKSQSKVVTRNLDK  190

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD  LKDYE+IIGIETHVQLST+TKAFCGC Y+YG+ PNT ICP+CMG 
Sbjct  191  TLDTRLKDYEAIIGIETHVQLSTITKAFCGCAYSYGSEPNTDICPVCMGL  240



>ref|XP_011462425.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Fragaria vesca subsp. vesca]
Length=550

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN--QS  497
            M+ T+FR  Q +P   +      RK+   YCT+   +T     +++    +    N  Q+
Sbjct  1    MASTIFRSFQTHPFVFHPTTLLRRKNVLFYCTMRSAQTTQAATQEKVNPPQAKVSNLTQN  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+N LKDYE++IGIETHVQLSTLTKAFC CPY Y + PNT ICPICMG 
Sbjct  61   KTLENALKDYEAVIGIETHVQLSTLTKAFCSCPYNYASQPNTSICPICMGL  111



>ref|XP_010667086.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667087.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667088.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667089.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667091.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667092.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekq-qtklkglPKNQSK  500
            M+  LFRG+Q  PL  Y     ++    L CT     T +   + + +++ K + +N  K
Sbjct  1    MASLLFRGLQIRPLCIYPSSLLTKNVGVLCCTSNALHTQSVKTQDKPKSQSKVVTRNLDK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD  LKDYE+IIGIETHVQLST+TKAFCGC Y+YG+ PNT ICP+CMG 
Sbjct  61   TLDTRLKDYEAIIGIETHVQLSTITKAFCGCAYSYGSEPNTDICPVCMGL  110



>ref|XP_010667085.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=603

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekq-qtklkglPKNQSK  500
            M+  LFRG+Q  PL  Y     ++    L CT     T +   + + +++ K + +N  K
Sbjct  131  MASLLFRGLQIRPLCIYPSSLLTKNVGVLCCTSNALHTQSVKTQDKPKSQSKVVTRNLDK  190

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD  LKDYE+IIGIETHVQLST+TKAFCGC Y+YG+ PNT ICP+CMG 
Sbjct  191  TLDTRLKDYEAIIGIETHVQLSTITKAFCGCAYSYGSEPNTDICPVCMGL  240



>ref|XP_002314512.2| hypothetical protein POPTR_0010s07520g, partial [Populus trichocarpa]
 gb|EEF00683.2| hypothetical protein POPTR_0010s07520g, partial [Populus trichocarpa]
Length=488

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +3

Query  384  YFSRKHATLYCtlertetntttqekqqtkl----kglPKNQSKPLDNILKDYESIIGIET  551
            +F RK+  LYCT++ +    T    Q+ +     K   + Q+K +D ++KDYE+IIGIET
Sbjct  2    FFRRKNGALYCTMKSSSVTQTQTATQEKQQNPQIKVSTQTQTKTIDKLIKDYEAIIGIET  61

Query  552  HVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            HVQLSTLTKAFCGCPY YGA P T ICP+CMG 
Sbjct  62   HVQLSTLTKAFCGCPYNYGAQPYTSICPVCMGL  94



>ref|XP_010110683.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Morus notabilis]
 gb|EXC27687.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Morus notabilis]
Length=530

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 73/114 (64%), Gaps = 5/114 (4%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqe-----kqqtklkglPK  488
            M+ T+FR +Q  P   Y    F RK+  LYCT++ T+  T TQE         +LK  P 
Sbjct  1    MASTIFRSLQTRPFCFYPKALFRRKNGILYCTMQNTQAQTATQEKPITKTTTPELKKAPA  60

Query  489  NQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            N     + ILKDYE+IIGIETHVQLST TKAFC C Y+YGAPPN+ ICP+CMG 
Sbjct  61   NYKTIDEKILKDYEAIIGIETHVQLSTQTKAFCSCAYSYGAPPNSGICPVCMGL  114



>ref|XP_008340732.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=314

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = +3

Query  315  IYNMSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqt-klkglPKN  491
            +  M+ T+FR +   P   +      RK   LYCT+   +T T   + +   ++K  P  
Sbjct  59   VTKMASTIFRSLHTNPCLLHTTALLRRKDVILYCTMRSAQTRTAATQDKVKPQVKVAPNI  118

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGFAWGI  662
            Q+K L+   KDYE++IGIETHVQL+TLTKAFC CPY YG+ PNT +CP+CMG    +
Sbjct  119  QNKTLEKASKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSLPNTSVCPVCMGLPGAL  175



>ref|XP_009357958.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009357959.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=549

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqt-klkglPKNQSK  500
            M+ T+FR +   P   +      RK   LYCT+   +T T     +   ++K  P  Q+K
Sbjct  1    MASTIFRSLHTNPCLLHPTALLRRKDVILYCTMRSAQTQTAATPDKVKPQVKVAPNIQNK  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             L+   +DYE++IGIETHVQL+TLTKAFC CPY YG+PPNT +CP+CMG 
Sbjct  61   TLEKASRDYEAVIGIETHVQLNTLTKAFCSCPYNYGSPPNTSVCPVCMGL  110



>ref|XP_008340674.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Malus domestica]
Length=652

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +3

Query  315  IYNMSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqt-klkglPKN  491
            +  M+ T+FR +   P   +      RK   LYCT+   +T T   + +   ++K  P  
Sbjct  101  VTKMASTIFRSLHTNPCLLHTTALLRRKDVILYCTMRSAQTRTAATQDKVKPQVKVAPNI  160

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            Q+K L+   KDYE++IGIETHVQL+TLTKAFC CPY YG+ PNT +CP+CMG 
Sbjct  161  QNKTLEKASKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSLPNTSVCPVCMGL  213



>ref|XP_010527184.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=550

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +3

Query  486  KNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +NQ S  LD IL+DYE++IGIETHVQLSTLTKAFCGCPY+YG+ PN+ +CP+CMG 
Sbjct  57   RNQKSDKLDQILRDYEAVIGIETHVQLSTLTKAFCGCPYSYGSRPNSGVCPVCMGL  112



>ref|XP_008460666.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis melo]
 ref|XP_008460667.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis melo]
Length=547

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+    R IQ  PL  +    FSR+   +Y +++ +++ T TQEKQ+      P    + 
Sbjct  1    MAFIGMRSIQTLPLLFHPAVLFSRRKKIMYFSVKASQSQTATQEKQRPIAIS-PHFDKQI  59

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D I KDYE+IIGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  60   IDKISKDYEAIIGIETHVQLSTLTKAFCSCPYNYGSSPNTNICPICMGL  108



>ref|XP_010467088.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Camelina sativa]
Length=549

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            MS TL R IQ             R+   +      ++T TT + KQ +  +  PKN +S 
Sbjct  1    MSTTLLRTIQLNQFSLLGTALIRRRSNNVSVRCCGSQTATTHEAKQTSPSRVAPKNHKSN  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   KLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSVPNTSICPVCMGL  110



>ref|XP_006418762.1| hypothetical protein EUTSA_v10002467mg [Eutrema salsugineum]
 gb|ESQ37198.1| hypothetical protein EUTSA_v10002467mg [Eutrema salsugineum]
Length=551

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN  S  LD IL+DYE++IGIETHVQLSTLTKAFC CP +YG+ PNT ICP+CMG 
Sbjct  56   PKNHGSNKLDEILRDYEAVIGIETHVQLSTLTKAFCNCPNSYGSHPNTSICPVCMGL  112



>ref|XP_006297361.1| hypothetical protein CARUB_v10013381mg [Capsella rubella]
 gb|EOA30259.1| hypothetical protein CARUB_v10013381mg [Capsella rubella]
Length=550

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKH--ATLYCtlertetntttqekqqtklkglPKNQS  497
            MS TLFR IQ           F R+    ++ C   +T T T   ++          ++S
Sbjct  1    MSTTLFRTIQLNQFTLLGTTLFRRRSNVVSVRCCGSQTTTTTHEAKQSSQSRVAPKNHKS  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              LD ILKDYE++IGIETHVQLST TKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   NKLDEILKDYEAVIGIETHVQLSTSTKAFCSCSNNYGSYPNTSICPVCMGL  111



>ref|NP_973990.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AEE32307.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=475

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtle-rtetntttqekqqtklkglPKN-QS  497
            MS TL R IQ             R+ +  +      ++T TT + KQ +  +  PKN +S
Sbjct  1    MSTTLLRTIQLNQFSLLGTSLLRRRRSNNFSVRSCGSQTTTTHEAKQSSPTRVAPKNHKS  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   NQLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  111



>ref|NP_973991.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AEE32308.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=488

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtle-rtetntttqekqqtklkglPKN-QS  497
            MS TL R IQ             R+ +  +      ++T TT + KQ +  +  PKN +S
Sbjct  1    MSTTLLRTIQLNQFSLLGTSLLRRRRSNNFSVRSCGSQTTTTHEAKQSSPTRVAPKNHKS  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   NQLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  111



>ref|XP_004490131.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=536

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            QSK LD I KDYE +IGIETHVQLSTLTKAFC CPY YG+ PNT ICP+CMG 
Sbjct  45   QSKKLDKIPKDYEPVIGIETHVQLSTLTKAFCNCPYNYGSFPNTSICPVCMGL  97



>ref|XP_004169939.1| PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRNA(Gln) amidotransferase 
subunit B, chloroplastic/mitochondrial-like [Cucumis 
sativus]
Length=556

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+    R I+  PL  +    FSR+   LY +++ +++ T TQEKQ+      P    + 
Sbjct  1    MAFVGLRCIRTLPLLFHPAALFSRRKKVLYFSVKASQSQTATQEKQRPMAIS-PHFDKQI  59

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D I KDYE++IGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  60   IDKISKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSSPNTNICPICMGL  108



>gb|KGN61558.1| hypothetical protein Csa_2G170810 [Cucumis sativus]
Length=560

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+    R I+  PL  +    FSR+   LY +++ +++ T TQEKQ+      P    + 
Sbjct  1    MAFVGLRCIRTLPLLFHPAALFSRRKKVLYFSVKASQSQTATQEKQRPMAIS-PHFDKQI  59

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D I KDYE++IGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  60   IDKISKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSSPNTNICPICMGL  108



>ref|XP_004147167.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis sativus]
Length=555

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+    R I+  PL  +    FSR+   LY +++ +++ T TQEKQ+      P    + 
Sbjct  1    MAFVGLRCIRTLPLLFHPAALFSRRKKVLYFSVKASQSQTATQEKQRPMAIS-PHFDKQI  59

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +D I KDYE++IGIETHVQLSTLTKAFC CPY YG+ PNT ICPICMG 
Sbjct  60   IDKISKDYEAVIGIETHVQLSTLTKAFCSCPYNYGSSPNTNICPICMGL  108



>ref|NP_564530.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 sp|Q9FV81.1|GATB_ARATH RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG29096.1|AF239836_1 Glu-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AAL06883.1| At1g48520/T1N15_12 [Arabidopsis thaliana]
 gb|AAL67097.1| At1g48520/T1N15_12 [Arabidopsis thaliana]
 dbj|BAE99203.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32309.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=550

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtle-rtetntttqekqqtklkglPKN-QS  497
            MS TL R IQ             R+ +  +      ++T TT + KQ +  +  PKN +S
Sbjct  1    MSTTLLRTIQLNQFSLLGTSLLRRRRSNNFSVRSCGSQTTTTHEAKQSSPTRVAPKNHKS  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   NQLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  111



>ref|XP_010412724.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=549

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            MS TL R IQ             R+   +      ++T TT + KQ    +  PKN +S 
Sbjct  1    MSTTLLRTIQLNQFSLLGTALIRRRSNNVSVRCCGSQTATTHEAKQTPPSRVAPKNHKSN  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   KLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  110



>ref|XP_010490175.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=514

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN-QSK  500
            MS TL + IQ             R+   +      ++T TT + KQ +  +  PKN +S 
Sbjct  1    MSTTLLKTIQLNQFSLLGTALIRRRSNNVSVRCCGSQTATTHEAKQTSPSRVAPKNHKSN  60

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  61   KLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  110



>gb|KDO52268.1| hypothetical protein CISIN_1g043020mg [Citrus sinensis]
Length=564

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++ LD I K+YE+IIGIETHVQLSTLTKAFC CPY YGA PNT +CPICMG 
Sbjct  62   KTRTLDRISKEYEAIIGIETHVQLSTLTKAFCTCPYNYGAQPNTSVCPICMGL  114



>ref|XP_006420387.1| hypothetical protein CICLE_v10004652mg [Citrus clementina]
 gb|ESR33627.1| hypothetical protein CICLE_v10004652mg [Citrus clementina]
Length=563

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++ LD I K+YE+IIGIETHVQLSTLTKAFC CPY YGA PNT +CPICMG 
Sbjct  62   KTRTLDRISKEYEAIIGIETHVQLSTLTKAFCTCPYNYGAQPNTSVCPICMGL  114



>emb|CDX93007.1| BnaA03g37290D [Brassica napus]
Length=552

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN  S  LD ILKDYE++IGIETHVQLST TKAFC CP +YG+ PNT ICP+CMG 
Sbjct  50   PKNHGSNKLDEILKDYEAVIGIETHVQLSTSTKAFCSCPNSYGSHPNTSICPVCMGL  106



>ref|XP_009135887.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Brassica rapa]
Length=545

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN  S  LD ILKDYE++IGIETHVQLST TKAFC CP +YG+ PNT ICP+CMG 
Sbjct  50   PKNHGSNKLDEILKDYEAVIGIETHVQLSTSTKAFCSCPNSYGSHPNTSICPVCMGL  106



>emb|CDX94828.1| BnaC03g43600D [Brassica napus]
Length=552

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN  S  LD ILKDYE++IGIETHVQLST TKAFC CP +YG+ PNT ICP+CMG 
Sbjct  56   PKNHGSNKLDEILKDYEAVIGIETHVQLSTSTKAFCSCPNSYGSHPNTSICPVCMGL  112



>gb|KFK39734.1| hypothetical protein AALP_AA3G281100 [Arabis alpina]
Length=551

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKNQ-SKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN  S  LD IL+DYE++IGIETHVQLST TKAFC CP  YG+ PNT ICP+CMG 
Sbjct  56   PKNHGSNKLDEILRDYEAVIGIETHVQLSTFTKAFCSCPNNYGSHPNTSICPVCMGL  112



>gb|AAF79700.1|AC020889_8 T1N15.14 [Arabidopsis thaliana]
Length=618

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKN-QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PKN +S  LD IL+DYE++IGIETHVQLSTLTKAFC C   YG+ PNT ICP+CMG 
Sbjct  120  PKNHKSNQLDEILRDYEAVIGIETHVQLSTLTKAFCSCSNNYGSYPNTSICPVCMGL  176



>ref|XP_003614593.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Medicago 
truncatula]
 gb|AES97551.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Medicago 
truncatula]
Length=542

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            QSK L+N+ KDYE IIGIETHVQLST TKAFC CPY YG+ PNT ICP+CMG 
Sbjct  53   QSKKLNNLPKDYEPIIGIETHVQLSTNTKAFCNCPYNYGSFPNTSICPVCMGL  105



>ref|XP_006480233.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=553

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++ LD I K+YE+IIGIETHVQLSTL+KAFC CPY YG+ PNT +CPICMG 
Sbjct  62   KTRTLDRISKEYEAIIGIETHVQLSTLSKAFCPCPYIYGSQPNTSVCPICMGL  114



>ref|XP_010532821.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=552

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +3

Query  483  PKN-QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P+N +S  L  IL+DYE IIGIETHVQLSTLTKAFC C Y+YG+ PN+ ICP+CMG 
Sbjct  56   PRNHKSDKLHQILRDYEPIIGIETHVQLSTLTKAFCSCSYSYGSRPNSCICPVCMGL  112



>ref|XP_006854350.1| hypothetical protein AMTR_s00039p00150510 [Amborella trichopoda]
 gb|ERN15817.1| hypothetical protein AMTR_s00039p00150510 [Amborella trichopoda]
Length=548

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +3

Query  486  KNQS-KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            K QS  PL+N   DYE +IGIETHVQLST TKAFCGCP +YG+ PNT ICPICMG 
Sbjct  54   KTQSHAPLENPTLDYEPVIGIETHVQLSTKTKAFCGCPSSYGSQPNTSICPICMGL  109



>ref|XP_010936074.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Elaeis guineensis]
 ref|XP_010936075.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Elaeis guineensis]
Length=552

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN----  491
            M++  FR I+   L  +    F++K   L+CTL+ +     TQ   Q + K   K+    
Sbjct  1    MALIYFRCIRMNHLFLHPSSPFTKKSGVLFCTLQASHAQVATQVNFQNQGKQKEKSIQTA  60

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              K L++    YE+IIGIETHVQLSTLTKAFC CPY YG  PNT ICPICMG 
Sbjct  61   TKKTLEHHKHGYEAIIGIETHVQLSTLTKAFCSCPYLYGTRPNTTICPICMGL  113



>ref|XP_010936076.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Elaeis guineensis]
Length=546

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN----  491
            M++  FR I+   L  +    F++K   L+CTL+ +     TQ   Q + K   K+    
Sbjct  1    MALIYFRCIRMNHLFLHPSSPFTKKSGVLFCTLQASHAQVATQVNFQNQGKQKEKSIQTA  60

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
              K L++    YE+IIGIETHVQLSTLTKAFC CPY YG  PNT ICPICMG 
Sbjct  61   TKKTLEHHKHGYEAIIGIETHVQLSTLTKAFCSCPYLYGTRPNTTICPICMGL  113



>gb|EPS62098.1| hypothetical protein M569_12692, partial [Genlisea aurea]
Length=482

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  513  ILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +L +YE++IGIETHVQLST TKAFC CPY YGA PNT ICP+CMG 
Sbjct  1    VLGNYEAVIGIETHVQLSTSTKAFCSCPYNYGAQPNTSICPVCMGM  46



>ref|NP_001068056.2| Os11g0544800 [Oryza sativa Japonica Group]
 sp|Q2R2Z0.1|GATB_ORYSJ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA94201.1| Aspartyl/glutamyl-tRNA amidotransferase subunit B, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ18664.1| hypothetical protein OsJ_34183 [Oryza sativa Japonica Group]
 dbj|BAG89266.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28419.2| Os11g0544800 [Oryza sativa Japonica Group]
Length=544

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 67/112 (60%), Gaps = 12/112 (11%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN----  491
            M++TL RG+        + P  +R++A L+ T  ++   +    + ++     PK+    
Sbjct  1    MALTLLRGM--------RTPVVARRNAGLFFTTLQSPLLSRFTMRAESARAAAPKSIQLA  52

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
              +  +   + +E++IGIETHVQLST+TKAFC CPY+YG+ PN+ +CP CMG
Sbjct  53   TKEAAEQKAQGFEAVIGIETHVQLSTVTKAFCSCPYSYGSQPNSTVCPTCMG  104



>ref|XP_008796400.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
 ref|XP_008796401.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
 ref|XP_008796402.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
Length=553

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 19/121 (16%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++  FR I+   L  +    F++K + L+CTL+ +    TTQ +         +NQSK 
Sbjct  1    MALIYFRCIRMNRLFLHPSSPFTKKSSVLFCTLQASHARVTTQVENL-------QNQSKQ  53

Query  504  LDNILK------------DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
             + +++             YE+IIGIETHVQL TLTKAFC CPY YG+ PNT ICPICMG
Sbjct  54   KEKLIQTATKKTLEHHKHGYEAIIGIETHVQLYTLTKAFCSCPYLYGSRPNTTICPICMG  113

Query  648  F  650
             
Sbjct  114  L  114



>ref|XP_009420258.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=298

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            YE+IIGIETHVQLSTLTKAFC CPY YG+ PNT +CP+CMG
Sbjct  56   YETIIGIETHVQLSTLTKAFCSCPYPYGSQPNTTVCPVCMG  96



>ref|XP_007137464.1| hypothetical protein PHAVU_009G129000g [Phaseolus vulgaris]
 gb|ESW09458.1| hypothetical protein PHAVU_009G129000g [Phaseolus vulgaris]
Length=150

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 7/113 (6%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M+  +FR +Q +P   Y     +R++   +   + T++ T TQ +Q          QSK 
Sbjct  1    MASAIFRTLQVHPFLLYPTTLLTRRNGVYHLKTKATQSQTDTQHRQPQTKISTSSTQSKK  60

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGFAWGI  662
            LD I K+YE+IIGIETHVQLSTLTK        YG+PPN+ I PICMG    +
Sbjct  61   LDKIPKNYEAIIGIETHVQLSTLTK-------NYGSPPNSSIFPICMGLPGSL  106



>gb|ADE76344.1| unknown [Picea sitchensis]
Length=511

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +DYE++IGIETHVQLSTLTKAFC CP  YG+ PN+ +CPICMG 
Sbjct  24   QDYEAVIGIETHVQLSTLTKAFCSCPSKYGSHPNSNVCPICMGL  67



>sp|A2ZF53.1|GATB_ORYSI RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Oryza sativa Indica Group]
 gb|EAY81237.1| hypothetical protein OsI_36412 [Oryza sativa Indica Group]
Length=544

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKN----  491
            M++TL RG+        + P  +R++A L+ T  +T   +    + ++      K+    
Sbjct  1    MALTLLRGM--------RTPVVARRNAGLFFTTLQTPLLSRFTTRAESARAAAHKSIQLA  52

Query  492  QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
              +  +   + +E++IGIETHVQLST+TKAFC CPY+YG+ PN+ +CP CMG
Sbjct  53   TKEAAEQKTQSFEAVIGIETHVQLSTVTKAFCSCPYSYGSQPNSTVCPTCMG  104



>ref|NP_001167978.1| hypothetical protein [Zea mays]
 gb|ACN26715.1| unknown [Zea mays]
 gb|AFW64899.1| hypothetical protein ZEAMMB73_511569 [Zea mays]
Length=213

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            + +E+IIGIETHVQLST+TKAFC CPY+YG+ PN+ ICP CMG
Sbjct  65   QGFEAIIGIETHVQLSTVTKAFCSCPYSYGSQPNSTICPTCMG  107



>gb|EMS48922.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Triticum 
urartu]
Length=546

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 64/116 (55%), Gaps = 17/116 (15%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++TL RGI+   L        S  +A L+CT  R      T   +  +    PK+  K 
Sbjct  1    MALTLLRGIRTQTL--------SGANAGLFCTTRRPPLAHFTARVESVQTSE-PKSVRKS  51

Query  504  LDNILKD--------YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +    K+        +E++IGIETHVQLST+TKAFC CPY YG+ PN+ +CP CMG
Sbjct  52   IQQATKEAVEQKTHGFEAVIGIETHVQLSTITKAFCSCPYDYGSQPNSTVCPTCMG  107



>gb|ESV64564.1| gatB/GatE catalytic domain protein [Mycobacterium abscessus MAB_091912_2446]
Length=191

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|XP_002450901.1| hypothetical protein SORBIDRAFT_05g020870 [Sorghum bicolor]
 sp|C5Y3V8.1|GATB_SORBI RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Sorghum bicolor]
 gb|EES09889.1| hypothetical protein SORBIDRAFT_05g020870 [Sorghum bicolor]
Length=548

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +E++IGIETHVQLST+TKAFC CPY+YGA PN+ +CP CMG
Sbjct  69   FEAVIGIETHVQLSTVTKAFCSCPYSYGAQPNSTVCPTCMG  109



>gb|AFW64900.1| hypothetical protein ZEAMMB73_511569 [Zea mays]
Length=546

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +E+IIGIETHVQLST+TKAFC CPY+YG+ PN+ ICP CMG
Sbjct  67   FEAIIGIETHVQLSTVTKAFCSCPYSYGSQPNSTICPTCMG  107



>gb|AEI54824.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Mycobacterium 
chelonae]
Length=494

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|AEI54822.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Mycobacterium 
franklinii]
Length=494

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_030094130.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus]
Length=499

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|AEI54825.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Mycobacterium 
immunogenum]
Length=494

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|AEI54823.1| aspartyl/glutamyl-tRNA amidotransferase B subunit, partial [Mycobacterium 
abscessus subsp. bolletii]
Length=494

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_005077118.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus]
 gb|EHM17748.1| aspartyl/glutamyl-tRNA amidotransferase, B subunit (GatB) [Mycobacterium 
abscessus subsp. bolletii BD]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|AEI54821.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Mycobacterium 
abscessus]
Length=494

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|AEI54826.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Mycobacterium 
abscessus subsp. bolletii]
Length=494

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_016891258.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|EMS55713.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Triticum 
urartu]
Length=547

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 63/116 (54%), Gaps = 17/116 (15%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++TL RGI        + P   R + +L+CT +       T   +  +    PK   K 
Sbjct  1    MALTLLRGI--------RTPTLFRANFSLFCTTQHRPLAHFTTRAESVQTTE-PKAVPKS  51

Query  504  LDNILKD--------YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +    K+        +ES+IGIETHVQLST+TKAFC CP+ YG+ PN+ +CP CMG
Sbjct  52   IQQATKEAAEQKTQGFESVIGIETHVQLSTITKAFCSCPHNYGSQPNSTVCPTCMG  107



>ref|WP_043078637.1| glutamyl-tRNA amidotransferase [Mycobacterium immunogenum]
 gb|KIU39377.1| glutamyl-tRNA amidotransferase [Mycobacterium immunogenum]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_017207721.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_005069760.1| MULTISPECIES: aspartyl/glutamyl-tRNA amidotransferase subunit 
B [Mycobacterium]
 gb|EHM16275.1| aspartyl/glutamyl-tRNA amidotransferase, B subunit (GatB) [Mycobacterium 
abscessus subsp. bolletii CCUG 48898 = JCM 15300]
 gb|EIC61727.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus M94]
 gb|EIC67621.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus M93]
 gb|EIU05437.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0422]
 gb|EIU06958.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0421]
 gb|EIU09579.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0304]
 gb|EIU20488.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0708]
 gb|EIU25907.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0817]
 gb|EIU30204.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-1212]
 gb|EIU43040.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-1215]
 gb|EIU90281.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 5S-0921]
 gb|EIV64428.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii CCUG 48898 = JCM 15300]
 gb|ETZ73991.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_110811_1470]
 gb|ETZ90397.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_030201_1075]
 gb|ETZ94224.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_030201_1061]
 gb|EUA47794.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 21]
 gb|EUA70551.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 1513]
 gb|AIR42438.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus subsp. 
bolletii]
 dbj|BAP98109.1| aspartyl-tRNA(Asn) amidotransferase subunit B [Mycobacterium 
abscessus subsp. bolletii CCUG 48898 = JCM 15300]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_005093966.1| MULTISPECIES: aspartyl/glutamyl-tRNA amidotransferase subunit 
B [Mycobacterium chelonae group]
 ref|YP_001704064.1| Aspartyl/glutamyl-tRNA amidotransferase, B subunit (GatB) [Mycobacterium 
abscessus]
 emb|CAM63410.1| Aspartyl/glutamyl-tRNA amidotransferase, B subunit (GatB) [Mycobacterium 
abscessus ATCC 19977]
 gb|EIT89327.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0303]
 gb|EIT91319.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0726-RB]
 gb|EIT94868.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0726-RA]
 gb|EIU36069.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-0125-S]
 gb|EIU38717.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-0125-R]
 gb|EIU52975.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-0728-S]
 gb|EIU55100.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-1108]
 gb|EIU88542.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-0212]
 gb|EIU94632.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 6G-0728-R]
 gb|EIV08898.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0206]
 gb|EIV22417.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0119-R]
 gb|EIV26392.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0122-R]
 gb|EIV33083.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0122-S]
 gb|EIV37474.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0731]
 gb|EIV48526.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0116-R]
 gb|EIV49277.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0930-R]
 gb|EIV49661.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0930-S]
 gb|EIV59301.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 4S-0116-S]
 gb|EIV75824.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 3A-0810-R]
 gb|EPZ18335.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus V06705]
 gb|ETZ61849.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_110811_2726]
 gb|EUA61979.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus 1948]
 gb|EUA74636.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
chelonae 1518]
 gb|EUA79499.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 103]
 gb|AIR34493.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus subsp. 
bolletii 103]
 gb|AIR39372.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus subsp. 
bolletii]
 gb|AIV12096.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus subsp. 
bolletii]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>ref|WP_005056810.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus]
 gb|EHC00390.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus 47J26]
 gb|EIU62960.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 1S-151-0930]
 gb|EIU69969.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 1S-152-0914]
 gb|EIU73540.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 1S-153-0915]
 gb|EIU77603.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-0626]
 gb|EIU81154.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 1S-154-0310]
 gb|EIV03314.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-0912-R]
 gb|EIV04861.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-0307]
 gb|EIV17728.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-0912-S]
 gb|EIV72372.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-1231]
 gb|EIV76459.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus subsp. bolletii 2B-0107]
 gb|AFN63971.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus subsp. bolletii str. GO 06]
 gb|AGM29874.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus subsp. bolletii 50594]
 gb|EPQ22500.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
abscessus subsp. bolletii CRM-0020]
 gb|ESV56156.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_082312_2258]
 gb|ETZ78069.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_082312_2272]
 gb|ETZ82930.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
abscessus MAB_091912_2455]
 gb|AIV15463.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus]
 gb|AIV19993.1| glutamyl-tRNA amidotransferase [Mycobacterium abscessus]
Length=499

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGCP T+GA PNT ICP+C+G 
Sbjct  8    DDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICPVCLGL  55



>gb|ACY99093.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermomonospora 
curvata DSM 43183]
Length=500

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P +  L  YE ++G+ETH++L T TK FCGCP T+GAPPNT +CP+C+G 
Sbjct  8    PYEEALAKYEPVLGVETHIELGTATKMFCGCPTTFGAPPNTQVCPVCLGL  57



>ref|WP_041439968.1| glutamyl-tRNA amidotransferase [Thermomonospora curvata]
Length=494

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P +  L  YE ++G+ETH++L T TK FCGCP T+GAPPNT +CP+C+G 
Sbjct  2    PYEEALAKYEPVLGVETHIELGTATKMFCGCPTTFGAPPNTQVCPVCLGL  51



>ref|XP_002972781.1| hypothetical protein SELMODRAFT_441971 [Selaginella moellendorffii]
 gb|EFJ26002.1| hypothetical protein SELMODRAFT_441971 [Selaginella moellendorffii]
Length=528

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            L+D+E++IG+ETHVQL T TKAFCGC   YGA PN+ +CP+CMG 
Sbjct  52   LQDFEAVIGVETHVQLGTATKAFCGCLSQYGAQPNSNVCPVCMGL  96



>gb|EMT05438.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Aegilops 
tauschii]
Length=543

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 5/110 (5%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYF--SRKHATLYCtlertetntttqekqqtklkglPKNQS  497
            M++TL RGI+   L       F  +R+H   + T       T+  +  +  ++   K  +
Sbjct  1    MALTLLRGIRTQTLFGANAGLFCTTRRHPLAHFTTRVESVQTSEPKSVRKSIQQATKEAA  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
               ++  + +E++IGIETHVQLST+TKAFC CPY YG+ PN+ +CP CMG
Sbjct  61   ---EHKTQGFEAVIGIETHVQLSTITKAFCSCPYDYGSQPNSTVCPTCMG  107



>dbj|BAJ94910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 21/118 (18%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYF--SRKHATLYCtlertetntttqekqqtklkglPKNQS  497
            M++TL RGI+   L       F  +R+H   + T       T+            PK+  
Sbjct  8    MALTLLRGIRTQTLFGANAGLFCTTRRHPLAHFTTRVESVQTSE-----------PKSVR  56

Query  498  KPLDNILKD--------YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            K +    K+        +E++IGIETHVQLST+TKAFC CPY YG+ PN+ +CP CMG
Sbjct  57   KSIQQATKEAAEHKTQGFEAVIGIETHVQLSTITKAFCSCPYDYGSQPNSTVCPTCMG  114



>ref|XP_003575991.2| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Brachypodium distachyon]
Length=547

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 60/116 (52%), Gaps = 17/116 (15%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++TL RGI        + P   R +  L+CT         T      +    PK   K 
Sbjct  1    MALTLLRGI--------RTPTLFRTNVGLFCTARHPPLAHFTTRAGGMQTTE-PKAAPKS  51

Query  504  LDNILKD--------YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +    K+        +E++IGIETHVQLST+TKAFC CPY YG+ PN+ +CP CMG
Sbjct  52   IQQATKEAAEHKTRGFEAVIGIETHVQLSTITKAFCSCPYNYGSQPNSTVCPTCMG  107



>ref|XP_004979428.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=546

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +E++IGIETHVQLST+TKAFC CPY YG+ PN+ ICP CMG
Sbjct  67   FEAVIGIETHVQLSTVTKAFCSCPYNYGSQPNSTICPTCMG  107



>ref|XP_002984359.1| hypothetical protein SELMODRAFT_120349 [Selaginella moellendorffii]
 gb|EFJ14409.1| hypothetical protein SELMODRAFT_120349 [Selaginella moellendorffii]
Length=526

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            L+D+E++IG+ETHVQL T TKAFCGC   YGA PN+ +CP+CMG 
Sbjct  46   LQDFEAVIGVETHVQLGTATKAFCGCLSQYGAQPNSNVCPVCMGL  90



>dbj|BAJ96366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 17/116 (15%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkglPKNQSKP  503
            M++TL RGI+   L +  F        +L+CT +R      T   +  +    PK   K 
Sbjct  55   MALTLLRGIRTSTLFRANF--------SLFCTTQRRPLAHFTTRAESVQTTE-PKAVPKS  105

Query  504  LDNILKD--------YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +    K+        +ES+IGIETHVQLST+TKAFC CP  YG+ PNT +CP CMG
Sbjct  106  IQQATKEAAEQKTQGFESVIGIETHVQLSTITKAFCSCPNNYGSQPNTTVCPTCMG  161



>ref|WP_033340300.1| glutamyl-tRNA amidotransferase [Catenuloplanes japonicus]
Length=501

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D+++  YE +IG+ETHV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  8    PYDDVVARYEPVIGLETHVELGTKTKMFCGCPTEFGAEPNTQVCPVCLGL  57



>ref|WP_012894456.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Streptosporangium 
roseum]
 gb|ACZ90726.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Streptosporangium 
roseum DSM 43021]
Length=501

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP T+GAPPNT++CP+C+  
Sbjct  8    PYDEALERFEPVLGLETHVELGTASKMFCGCPTTFGAPPNTHVCPVCLAL  57



>ref|WP_030913698.1| glutamyl-tRNA amidotransferase [Streptosporangium amethystogenes]
Length=495

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP T+GAPPNT++CP+C+  
Sbjct  2    PYDEALERFEPVLGLETHVELGTASKMFCGCPTTFGAPPNTHVCPVCLAL  51



>ref|WP_013133058.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thermobispora 
bispora]
 gb|ADG89525.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Thermobispora 
bispora DSM 43833]
Length=501

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+E HV+L T +K FCGCP T+GAPPNT +CP+C+G 
Sbjct  9    PYDEALERFEPVLGLEVHVELGTASKMFCGCPTTFGAPPNTQVCPVCLGL  58



>ref|WP_026442077.1| glutamyl-tRNA amidotransferase [Acidobacterium sp. PMMR2]
Length=491

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            ++L  YE++IG+E HVQL T TKAFCGC   +GAPPNT ICP+C+G 
Sbjct  10   DVLAKYEAVIGLEVHVQLLTATKAFCGCANQFGAPPNTNICPVCLGL  56



>ref|WP_036331275.1| glutamyl-tRNA amidotransferase [Microbispora sp. ATCC PTA-5024]
 gb|ETK31834.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Microbispora 
sp. ATCC PTA-5024]
Length=502

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP T+GAPPNT++CP+C+  
Sbjct  9    PYDEALERFEPVLGLETHVELGTESKMFCGCPTTFGAPPNTHVCPVCLAL  58



>ref|WP_030456559.1| glutamyl-tRNA amidotransferase [Herbidospora cretacea]
Length=502

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP T+GAPPNT++CP C+ F
Sbjct  9    PYDEALERFEPVLGLETHVELGTNSKMFCGCPTTFGAPPNTHVCPTCLAF  58



>gb|EMT25645.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Aegilops 
tauschii]
Length=550

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 5/110 (5%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYF--SRKHATLYCtlertetntttqekqqtklkglPKNQS  497
            M++TL RGI+   L +  F     +++H   + T       TT  +     ++   K  +
Sbjct  1    MALTLLRGIRTPTLLRANFSLLCTTQRHPLAHFTTRAESVQTTEPKAVPKSIQQATKEAA  60

Query  498  KPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
               +  ++ +ES+IGIETHVQLST+TKAFC CP  YG+ PN+ +CP CMG
Sbjct  61   ---EQKIQGFESVIGIETHVQLSTITKAFCSCPNNYGSQPNSTVCPTCMG  107



>gb|ABJ88619.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Candidatus 
Solibacter usitatus Ellin6076]
Length=492

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             +L  YE +IG+E HVQL+T TK FCGCP ++GAPPNT +CP+C+G 
Sbjct  12   EMLARYEVVIGLEVHVQLATATKIFCGCPTSFGAPPNTNVCPVCLGL  58



>ref|WP_020574762.1| hypothetical protein [Actinopolymorpha alba]
Length=504

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L+ ++ ++G+E HV+L+TLTK FCGCP  +GAPPN+ +CPIC+G 
Sbjct  15   DEVLERFDPVLGLEVHVELNTLTKMFCGCPTEFGAPPNSQVCPICLGM  62



>ref|WP_041860409.1| glutamyl-tRNA amidotransferase [Candidatus Solibacter usitatus]
Length=480

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  513  ILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +L  YE +IG+E HVQL+T TK FCGCP ++GAPPNT +CP+C+G 
Sbjct  1    MLARYEVVIGLEVHVQLATATKIFCGCPTSFGAPPNTNVCPVCLGL  46



>ref|WP_030506104.1| glutamyl-tRNA amidotransferase [Microbispora rosea]
Length=502

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP T+GAPPNT +CP+C+  
Sbjct  9    PYDEALERFEPVLGLETHVELGTASKMFCGCPTTFGAPPNTQVCPVCLAL  58



>ref|WP_037937256.1| glutamyl-tRNA amidotransferase [Streptosporangium roseum]
Length=508

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  L+ +E ++G+ETHV+L T +K FCGCP  +GAPPNT++CP+C+  
Sbjct  15   PYDEALERFEPVLGLETHVELGTASKMFCGCPAAFGAPPNTHVCPVCLAL  64



>ref|WP_027343799.1| glutamyl-tRNA amidotransferase [Hamadaea tsunoensis]
Length=497

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++ +++E +IG+ETHV+L T TK FCGCP  +G  PNT++CP+C+G 
Sbjct  10   DDVTEEFEPVIGLETHVELGTRTKMFCGCPTEFGGEPNTHVCPVCLGL  57



>ref|WP_011525511.1| glutamyl-tRNA amidotransferase subunit B [Candidatus Koribacter 
versatilis]
 gb|ABF43715.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Candidatus 
Koribacter versatilis Ellin345]
Length=491

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            L  +L+ YE +IG+E HVQL T TKAFCGC   +GAPPNT +CP+C+G 
Sbjct  8    LATVLEKYEPVIGLEVHVQLLTATKAFCGCSTQFGAPPNTNVCPVCLGM  56



>ref|WP_019145289.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aeromicrobium 
massiliense]
Length=497

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            PLD  L  Y+ ++G+E HV+L+T TK FCGC  T+GAPPNT +CP+C+  
Sbjct  7    PLDEALDRYDPVMGLEVHVELNTATKMFCGCSTTFGAPPNTQVCPVCLAL  56



>ref|WP_005182543.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Gordonia amarae]
 dbj|GAB04006.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
amarae NBRC 15530]
Length=503

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++ D++ ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+GF
Sbjct  12   DQVIADFDPVMGLEVHVELGTETKMFCGCPTAFGAEPNTQVCPVCLGF  59



>ref|WP_015897906.1| glutamyl-tRNA amidotransferase subunit B [Acidobacterium capsulatum]
 gb|ACO31463.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Acidobacterium 
capsulatum ATCC 51196]
Length=491

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             IL  YE +IG+E HVQL T TKAFCGC   +GAPPNT ICP+C+G 
Sbjct  10   EILAKYEPVIGLEVHVQLLTATKAFCGCVNKFGAPPNTNICPVCLGL  56



>ref|WP_020523275.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Catelliglobosispora 
koreensis]
Length=496

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+ +  YE +IG+ETHV+L T TK FCGCP  +GA PNT ICP+C+G 
Sbjct  9    DDAIGRYEPVIGLETHVELGTQTKMFCGCPTVFGADPNTQICPVCLGL  56



>ref|XP_006662992.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=548

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 16/116 (14%)
 Frame = +3

Query  324  MSVTLFRGIQFYPLRQYKFPYFSRKHATLYCtlertetntttqekqqtklkg----lPKN  491
            M++TL RGI        + P  +R++A L+ T  +T  +      +  +        PK+
Sbjct  1    MALTLLRGI--------RTPMVARRNAGLFFTTLQTPLSRFATRAESAQATEPKPPAPKS  52

Query  492  ----QSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
                  +  +   + +E++IGIETHVQLST+TKAFC C Y+YG+ PN+ +CP CMG
Sbjct  53   IQLATKEAAEQKTQGFEAVIGIETHVQLSTVTKAFCSCLYSYGSQPNSTVCPTCMG  108



>ref|WP_006554542.1| MULTISPECIES: aspartyl/glutamyl-tRNA amidotransferase subunit 
B [Rhodococcus]
 gb|EHK80653.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
pyridinivorans AK37]
 gb|KHJ72597.1| glutamyl-tRNA amidotransferase [Rhodococcus sp. Chr-9]
Length=502

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DDVLAKFEPVMGMEVHVELHTATKMFCGCPTTFGAEPNTQVCPVCLGL  60



>gb|EUA14014.1| gatB/GatE catalytic domain protein [Mycobacterium xenopi 4042]
Length=198

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            D ++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G
Sbjct  16   DEVVARYEPVLGLEVHVELSTATKMFCGCPTAFGAEPNTQVCPVCLG  62



>ref|XP_001782927.1| predicted protein [Physcomitrella patens]
 sp|A9TWD9.1|GATB_PHYPA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Physcomitrella patens]
 gb|EDQ52278.1| predicted protein [Physcomitrella patens]
Length=562

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            YE++IGIETHVQL T TKAFC CP  YG+ PN  +CP+CMG 
Sbjct  81   YEAVIGIETHVQLGTSTKAFCSCPSEYGSEPNANVCPVCMGL  122



>ref|WP_022922808.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Ornithinimicrobium 
pekingense]
Length=517

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D +L  YE ++G+E HV+LST TK FCGC  ++GA PNT  CP+C+G 
Sbjct  18   PFDEVLTRYEPVMGLEVHVELSTATKMFCGCAQSFGAEPNTRTCPVCLGL  67



>ref|WP_003922147.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
xenopi]
 gb|EID11237.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
xenopi RIVM700367]
Length=506

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  16   DEVVARYEPVLGLEVHVELSTATKMFCGCPTAFGAEPNTQVCPVCLGL  63



>gb|EUA33956.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
xenopi 3993]
Length=344

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  16   DEVVARYEPVLGLEVHVELSTATKMFCGCPTAFGAEPNTQVCPVCLGL  63



>ref|WP_020622202.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudonocardia 
sp. P2]
Length=500

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  Y+ ++GIE HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  11   DDVVARYDPVLGIEVHVELSTNTKMFCGCPTEFGAEPNTQVCPVCLGL  58



>ref|WP_022910338.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aestuariimicrobium 
kwangyangense]
Length=502

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  ++ ++G+E HV+L+T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  12   DEVLDRFDPVMGLEVHVELNTATKMFCGCPTTFGAEPNTQVCPVCLGL  59



>ref|WP_044510611.1| glutamyl-tRNA amidotransferase [Mycobacterium simiae]
Length=503

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE ++G+E HV+LST+TK FCGC   +GA PNT +CP+C+G 
Sbjct  13   DEVLARYEPVLGLEVHVELSTVTKMFCGCSTAFGAEPNTQVCPVCLGL  60



>ref|WP_040158353.1| glutamyl-tRNA amidotransferase [Mobilicoccus sp. SIT2]
Length=520

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            LD  L  Y+ ++G+E HV+LST +K FCGC   +GAPPNT++CP+C+G 
Sbjct  16   LDEALAAYDPVMGLEVHVELSTASKMFCGCSTEFGAPPNTHVCPVCLGL  64



>ref|WP_033241269.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Actinomycetales]
Length=502

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DVVTRYEPVLGMEVHVELSTATKMFCGCPTTFGADPNTQVCPVCLGL  59



>ref|XP_007510369.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bathycoccus 
prasinos]
 emb|CCO18714.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Bathycoccus 
prasinos]
Length=594

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            P+D   K +E  IGIETHVQL T TKAFCGC Y+YGA  NT ICPICMG
Sbjct  92   PIDANTK-FEPTIGIETHVQLQTKTKAFCGCQYSYGANANTQICPICMG  139



>ref|WP_035277884.1| glutamyl-tRNA amidotransferase [Actinokineospora sp. EG49]
 gb|EWC64421.1| Aspartyl-tRNA(Asn) amidotransferase subunit B [Actinokineospora 
sp. EG49]
Length=501

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L+ ++ ++G+E HV+LST TK FCGCP T+G  PNT +CP+C+G 
Sbjct  11   DEVLERFDPVLGLEVHVELSTKTKMFCGCPTTFGGEPNTQVCPVCLGM  58



>ref|WP_022363912.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Eggerthella 
sp. CAG:298]
 emb|CDD60569.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Eggerthella 
sp. CAG:298]
Length=513

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +LKD+E++IG+E H +L+TL TK FCGC   +GA PNT+ CP+C+G 
Sbjct  2    KKLEEVLKDWEAVIGLEVHAELTTLETKMFCGCKLEFGAAPNTHTCPVCLGL  53



>ref|WP_012799286.1| glutamyl-tRNA(Gln) amidotransferase [Slackia heliotrinireducens]
 gb|ACV23186.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Slackia heliotrinireducens DSM 20476]
Length=521

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            + L+  L+D+E++IG+E H +L+TL TK FCGC   +GAPPNT+ CP+C+G 
Sbjct  2    RQLEEALRDWEAVIGLEIHAELTTLNTKMFCGCKLEFGAPPNTHTCPVCLGL  53



>ref|WP_009076158.1| glutamyl-tRNA(Gln) amidotransferase [Slackia sp. CM382]
 gb|EJU35215.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Slackia 
sp. CM382]
Length=522

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +LKD+E++IG+E H +L+TL TK FCGC   +GA PNT+ CP+C+G 
Sbjct  2    KALEEVLKDWEAVIGLEIHAELTTLDTKMFCGCKLEHGAAPNTHTCPVCLGL  53



>ref|WP_022335033.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:452]
 emb|CDD27825.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:452]
Length=480

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +DYE++IG+E H +LST TK FC CP T+GA PNT++CPICM  
Sbjct  4    EDYEAVIGLEVHAELSTKTKIFCSCPTTFGAEPNTHVCPICMAM  47



>gb|EEZ60376.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Slackia 
exigua ATCC 700122]
Length=525

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +LKD+E++IG+E H +L+TL TK FCGC   +GA PNT+ CP+C+G 
Sbjct  5    KALEEVLKDWEAVIGLEIHAELTTLDTKMFCGCKLEHGAAPNTHTCPVCLGL  56



>ref|WP_043962246.1| glutamyl-tRNA amidotransferase [Micromonospora carbonacea]
 gb|KIR65457.1| glutamyl-tRNA amidotransferase [Micromonospora carbonacea]
Length=498

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  10   DDVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGEPNTRVCPVCLGL  57



>ref|WP_040836935.1| glutamyl-tRNA amidotransferase [Nocardia brevicatena]
Length=501

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DVVTRYEPVLGMEVHVELSTETKMFCGCPTTFGAEPNTQVCPVCLGL  59



>ref|WP_040619462.1| glutamyl-tRNA amidotransferase [Slackia exigua]
Length=522

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +LKD+E++IG+E H +L+TL TK FCGC   +GA PNT+ CP+C+G 
Sbjct  2    KALEEVLKDWEAVIGLEIHAELTTLDTKMFCGCKLEHGAAPNTHTCPVCLGL  53



>ref|WP_012950071.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Geodermatophilus 
obscurus]
 gb|ADB76646.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Geodermatophilus 
obscurus DSM 43160]
Length=504

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D IL  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  14   DEILTRYEPVIGLETHVELGTASKMFCGCATTFGAEPNTQTCPVCLGL  61



>ref|WP_007320107.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Gordonia effusa]
 dbj|GAB20772.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
effusa NBRC 100432]
Length=503

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  Y+ ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DDVIASYDPVLGMEVHVELGTATKMFCGCPTTFGAEPNTQVCPVCIGL  60



>ref|WP_030448195.1| glutamyl-tRNA amidotransferase [Actinocatenispora sera]
Length=499

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  504  LDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            L ++L  YE ++G+E HV+L T TK FC CP T+GA PNT ICP+C+G 
Sbjct  8    LSDVLSRYEVVMGLEVHVELGTRTKMFCSCPTTFGAEPNTQICPVCLGM  56



>ref|WP_040791483.1| glutamyl-tRNA amidotransferase [Nocardia paucivorans]
Length=501

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DVVTRYEPVLGMEVHVELSTETKMFCGCPTTFGAEPNTQVCPVCLGL  59



>ref|WP_007075105.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Micromonospora 
sp. ATCC 39149]
 gb|EEP73836.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Micromonospora 
sp. ATCC 39149]
Length=497

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  10   DDVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGEPNTRVCPVCLGL  57



>ref|WP_038154229.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA164-N20]
Length=78

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  522  DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +YE IIG+ETHVQL T +K +CGCP  YGA PNT +CP+C+G 
Sbjct  2    EYEPIIGLETHVQLKTKSKMWCGCPNQYGADPNTQVCPVCLGM  44



>ref|WP_013673962.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudonocardia 
dioxanivorans]
 gb|AEA24031.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudonocardia 
dioxanivorans CB1190]
Length=500

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  Y+ ++G+E HV+LST TK FCGCP T+GA PNT +CP C+G 
Sbjct  10   DDVVDRYDPVLGLEVHVELSTNTKMFCGCPTTFGAEPNTQVCPTCLGL  57



>ref|WP_014742435.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Modestobacter 
marinus]
 emb|CCH89871.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Modestobacter 
marinus]
Length=503

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE +IG+ETHV+L T +K FCGC  T+GA PNT+ CP+C+G 
Sbjct  13   DELLTRYEPVIGLETHVELGTASKMFCGCATTFGAEPNTHTCPVCLGM  60



>ref|WP_036340042.1| glutamyl-tRNA amidotransferase [Modestobacter sp. KNN45-2b]
 gb|KGH44615.1| glutamyl-tRNA amidotransferase [Modestobacter sp. KNN45-2b]
Length=502

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  12   DDVLTRYEPVIGLETHVELGTASKMFCGCATTFGAEPNTQTCPVCLGM  59



>ref|WP_007717546.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit, partial [Brevibacillus 
sp. BC25]
 gb|EJL31485.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit, partial [Brevibacillus 
sp. BC25]
Length=105

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +  YE++IG+E H +LST +K FCGCP  +GAPPNT+ CPIC+G
Sbjct  1    MSKYETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHTCPICLG  44



>ref|WP_023646468.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [actinobacterium 
LLX17]
Length=503

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  ++ Y+ ++G+E HV+L+T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  8    PFDTAIERYDPVLGLEVHVELNTATKMFCGCPTEFGADPNTQVCPVCLGL  57



>ref|WP_031577466.1| glutamyl-tRNA amidotransferase [Proteiniclasticum ruminis]
Length=479

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +K YE++IG+E HV+LST TKAFCGC   YG  PN+++CP+C+G 
Sbjct  1    MKHYEAVIGLEVHVELSTKTKAFCGCTTEYGGKPNSHVCPVCLGL  45



>ref|XP_001420207.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 sp|A4S450.1|GATB_OSTLU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Ostreococcus lucimarinus CCE9901]
 gb|ABO98500.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=499

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +E++IGIETHVQL++ TKAFC C Y YGA PNT +CP CMG
Sbjct  9    FEAVIGIETHVQLNSRTKAFCRCAYEYGAEPNTRVCPTCMG  49



>ref|WP_009742277.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Frankia sp. 
QA3]
 gb|EIV95886.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Frankia sp. QA3]
Length=505

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            + L  YE +IG+ETHV+L T++K FCGCP  +GA PNT +CP+C+G 
Sbjct  15   DALARYEPVIGLETHVELGTVSKMFCGCPTAFGAEPNTQVCPVCLGL  61



>ref|XP_011398000.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Auxenochlorella 
protothecoides]
 gb|KFM25112.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Auxenochlorella 
protothecoides]
Length=526

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  522  DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            DYE+++GIE HVQL+T TKAFC CP  YG  PN++ICP+C+G
Sbjct  26   DYEAVVGIECHVQLNTRTKAFCACPNQYGGEPNSHICPVCLG  67



>ref|WP_011606921.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Frankia alni]
 emb|CAJ64485.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT 
subunit B) [Frankia alni ACN14a]
Length=505

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            + L  YE +IG+ETHV+L T++K FCGCP  +GA PNT +CP+C+G 
Sbjct  15   DALARYEPVIGLETHVELGTVSKMFCGCPTAFGAEPNTQVCPVCLGL  61



>ref|WP_030164576.1| glutamyl-tRNA amidotransferase [Spirillospora albida]
Length=494

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D  L  YE ++GIETH++L T +K FCGCP  +GA PNT +CP+C+G 
Sbjct  4    DEALAKYEPVLGIETHIELGTASKMFCGCPTGFGAEPNTQVCPVCLGL  51



>gb|KJE22073.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Frankia 
sp. CpI1-S]
Length=505

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            + L  YE +IG+ETHV+L T++K FCGCP  +GA PNT +CP+C+G 
Sbjct  15   DALARYEPVIGLETHVELGTVSKMFCGCPTAFGAEPNTQVCPVCLGL  61



>ref|WP_026403873.1| glutamyl-tRNA amidotransferase [Actinomadura rifamycini]
Length=492

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P +  L  YE ++GIETH++L T +K FCGCP  +GA PNT +CP+C+G 
Sbjct  2    PYEEALAKYEPVLGIETHIELGTASKMFCGCPTAFGAEPNTQVCPVCLGL  51



>ref|WP_029366059.1| glutamyl-tRNA amidotransferase [Mycobacterium sp. UM_WWY]
Length=501

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  11   DDVLAAYEPVMGMEVHVELSTATKMFCGCANRFGAEPNTQVCPVCLGL  58



>emb|CEG00947.1| Aspartyl/Glutamyl-tRNA(Gln) amidotransferase,subunit B/E, catalytic 
[Ostreococcus tauri]
Length=514

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +E++IGIETHVQL++ TKAFC C Y YGA PNT +CP CMG
Sbjct  26   FEAVIGIETHVQLNSRTKAFCRCAYAYGAEPNTRVCPTCMG  66



>ref|WP_022565549.1| MULTISPECIES: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B [Actinomycetales]
 dbj|GAD81818.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Nocardia 
asteroides NBRC 15531]
Length=501

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DVISRYEPVLGMEVHVELSTATKMFCGCPTEFGAEPNTQVCPVCLGL  59



>ref|WP_010228366.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Pseudonocardia 
sp. P1]
Length=501

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  ++ ++GIE HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  12   DDVVARFDPVLGIEVHVELSTNTKMFCGCPTEFGAEPNTQVCPVCLGL  59



>ref|WP_018729841.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_018218868.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_011905123.1| MULTISPECIES: aspartyl/glutamyl-tRNA amidotransferase subunit 
B [Salinispora]
 sp|A4X491.1|GATB_SALTO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Salinispora tropica 
CNB-440]
 gb|ABP53691.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Salinispora 
tropica CNB-440]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_027658896.1| glutamyl-tRNA amidotransferase [Salinispora pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_040338263.1| glutamyl-tRNA amidotransferase [Candidatus Blastococcus massiliensis]
Length=503

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  13   DEVLTRYEPVIGLETHVELGTASKMFCGCSTTFGAEPNTQTCPVCLGL  60



>ref|WP_019871103.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_018743029.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_024101389.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
pyridinivorans]
 gb|AHD20388.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
pyridinivorans SB3094]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLAKFEPVMGMEVHVELHTATKMFCGCPTAFGAEPNTQVCPVCLGL  60



>ref|WP_019288389.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
sp. R04]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLAKFEPVMGMEVHVELHTATKMFCGCPTAFGAEPNTQVCPVCLGL  60



>ref|WP_016932865.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
sp. R1101]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLAKFEPVMGMEVHVELHTATKMFCGCPTAFGAEPNTQVCPVCLGL  60



>ref|WP_016691191.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
rhodochrous]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLAKFEPVMGMEVHVELHTATKMFCGCPTAFGAEPNTQVCPVCLGL  60



>ref|WP_012464030.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylacidiphilum 
infernorum]
 ref|YP_001940346.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Methylacidiphilum 
infernorum V4]
 sp|B3DWT5.1|GATB_METI4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Methylacidiphilum 
infernorum V4]
 gb|ACD83748.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Methylacidiphilum 
infernorum V4]
Length=485

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  522  DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGFAWGIAS  668
            DYE+IIG+E HVQL T TK FCGC   YGA PN+ +CP+C+G    + S
Sbjct  2    DYEAIIGLEVHVQLKTQTKLFCGCAVEYGATPNSRVCPVCLGLPGALPS  50



>ref|WP_026856068.1| glutamyl-tRNA amidotransferase [Geodermatophilaceae bacterium 
URHB0062]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  10   DEVLTRYEPVIGLETHVELGTASKMFCGCSTTFGAEPNTQTCPVCLGL  57



>ref|WP_018723578.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_014815105.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
chubuense]
 gb|AFM16624.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Mycobacterium chubuense NBB4]
Length=500

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  12   DEVLASYEPVLGLEVHVELSTATKMFCGCANQFGAEPNTQVCPVCLGL  59



>ref|WP_018156521.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Demetria terragena]
Length=501

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D  LKD++ ++G E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  11   DAALKDFDPVMGFEVHVELGTATKMFCGCPTEFGADPNTQVCPVCLGL  58



>ref|WP_018820772.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_018253776.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_023963824.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Williamsia 
sp. D3]
 gb|ETD30019.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Williamsia 
sp. D3]
Length=496

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++ +++ ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  8    DDVISEFDPVMGMEVHVELGTNTKMFCGCPTTFGAEPNTQVCPVCIGL  55



>ref|WP_039688206.1| glutamyl-tRNA amidotransferase [Coriobacteriaceae bacterium 68-1-3]
 gb|AJC11570.1| glutamyl-tRNA amidotransferase [Coriobacteriaceae bacterium 68-1-3]
Length=522

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTLT-KAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +L+D+E++IG+E H +L+TLT K FCGC   +GA PNT+ CP+C+G 
Sbjct  2    KKLEEVLEDWEAVIGLEVHAELTTLTTKMFCGCKLEFGADPNTHTCPVCLGL  53



>ref|WP_025617559.1| glutamyl-tRNA amidotransferase [Salinispora pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_030172058.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Actinomycetales]
Length=496

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++ +++ ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  8    DDVISEFDPVMGMEVHVELGTNTKMFCGCPTTFGAEPNTQVCPVCIGL  55



>ref|WP_040749810.1| glutamyl-tRNA amidotransferase [Nocardia transvalensis]
Length=503

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DVVDRYEPVLGMEVHVELGTATKMFCGCPTTFGAEPNTQVCPVCLGL  59



>ref|WP_028569219.1| glutamyl-tRNA amidotransferase [Salinispora tropica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_017973960.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Actinopolyspora 
halophila]
Length=502

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L++++ ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  11   DEVLRNFDPVLGLEVHVELSTATKMFCGCANEFGAEPNTRVCPVCLGM  58



>ref|WP_009139480.1| glutamyl-tRNA(Gln) amidotransferase [Slackia piriformis]
 gb|EJZ83761.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Slackia 
piriformis YIT 12062]
Length=522

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            K L+ +LKD+E++IG+E H +L+TL TK FCGC   +GA PNT  CP+C+G 
Sbjct  2    KTLEEVLKDWEAVIGLEVHAELTTLNTKMFCGCKLEFGAEPNTRTCPVCLGL  53



>ref|WP_027654083.1| glutamyl-tRNA amidotransferase [Salinispora pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_026848022.1| glutamyl-tRNA amidotransferase [Geodermatophilaceae bacterium 
URHA0031]
Length=503

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  13   DEVLTRYEPVIGLETHVELGTASKMFCGCATTFGAEPNTQTCPVCLGM  60



>ref|WP_018725886.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_024806598.1| glutamyl-tRNA amidotransferase [Nocardia sp. BMG51109]
Length=503

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   DVVDRYEPVLGMEVHVELGTATKMFCGCPTTFGAEPNTQVCPVCLGL  59



>ref|WP_041328718.1| glutamyl-tRNA amidotransferase [Rubrobacter xylanophilus]
Length=485

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            K Y+++IG+E HV LST TK FCGC  TYG PPNT++CP+C+G
Sbjct  7    KAYQAVIGLEFHVHLSTRTKMFCGCRVTYGEPPNTHVCPVCLG  49



>ref|WP_027645334.1| glutamyl-tRNA amidotransferase [Salinispora pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_018220802.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
pacifica]
Length=499

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVARYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_043655346.1| glutamyl-tRNA amidotransferase [Nocardia thailandica]
Length=501

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DVVSRYEPVLGMEVHVELSTATKMFCGCPTEFGAEPNTQVCPVCLGL  59



>ref|WP_010838482.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodococcus rhodnii]
 gb|EOM76223.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Rhodococcus rhodnii 
LMG 5362]
Length=503

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  Y+ ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLAAYDPVLGMEVHVELGTQTKMFCGCPTAFGAEPNTQVCPVCLGM  60



>ref|WP_027007235.1| glutamyl-tRNA amidotransferase [Conexibacter woesei]
Length=477

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  522  DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +YE++IG+E HVQL+T+TK FCGC  ++G PPNT+ CP+C+G 
Sbjct  5    EYETVIGLEIHVQLATVTKMFCGCTLSFGDPPNTHTCPVCLGL  47



>ref|WP_010632510.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sporolactobacillus 
vineae]
Length=478

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            + ++E+IIG+E HV+L T TKAFCGC   +GAPPNT+ CPIC+G
Sbjct  1    MSNFETIIGLEVHVELKTKTKAFCGCANEFGAPPNTHTCPICLG  44



>ref|WP_006339119.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Gordonia rhizosphera]
 dbj|GAB93665.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
rhizosphera NBRC 16068]
Length=501

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++ D++ ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  12   DQVIADFDPVLGLEVHVELGTETKMFCGCPTAFGAEPNTQVCPVCIGL  59



>ref|WP_018640536.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Frankia sp. 
BMG5.12]
Length=505

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            ++ L  YE++IG+ETHV+L T++K FCGC   +GA PNT +CP+C+G 
Sbjct  14   EDALARYEAVIGLETHVELGTVSKMFCGCATAFGAAPNTQVCPVCLGL  61



>ref|WP_007534192.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
triatomae]
 gb|EME19083.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhodococcus 
triatomae BKS 15-14]
Length=503

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D++L  +E ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DDVLATFEPVMGMEVHVELHTATKMFCGCPTVFGAEPNTQVCPVCLGL  60



>gb|ABG03802.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Rubrobacter 
xylanophilus DSM 9941]
Length=501

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            K Y+++IG+E HV LST TK FCGC  TYG PPNT++CP+C+G
Sbjct  23   KAYQAVIGLEFHVHLSTRTKMFCGCRVTYGEPPNTHVCPVCLG  65



>ref|WP_029432844.1| glutamyl-tRNA amidotransferase [Blastococcus sp. URHD0036]
Length=504

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE +IG+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  14   DEVLTRYEPVIGLETHVELGTASKMFCGCTTTFGAEPNTQTCPVCLGL  61



>ref|WP_020105527.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nocardia sp. 
348MFTsu5.1]
Length=496

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++ +++ ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  8    DDVIAEFDPVMGMEVHVELGTNTKMFCGCPTTFGAEPNTQVCPVCIGL  55



>ref|WP_040797543.1| glutamyl-tRNA amidotransferase [Nocardia higoensis]
Length=501

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DVVARYEPVLGMEVHVELSTATKMFCGCPTEFGAEPNTQVCPVCLGL  59



>ref|WP_011210772.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nocardia farcinica]
 sp|Q5YRV4.1|GATB_NOCFA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Nocardia farcinica 
IFM 10152]
 dbj|BAD59087.1| putative glutamyl-tRNA amidotransferase subunit B [Nocardia farcinica 
IFM 10152]
Length=503

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  15   DVVARYEPVLGMEVHVELSTATKMFCGCPTDFGAEPNTQVCPVCLGL  61



>dbj|GAB10695.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
araii NBRC 100433]
Length=513

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  483  PKNQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P  +    D+++  Y+ ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  17   PATELMEFDDVIAAYDPVLGMEVHVELGTATKMFCGCPTAFGAEPNTQVCPVCIGL  72



>ref|WP_028652445.1| glutamyl-tRNA amidotransferase [Nocardioides halotolerans]
Length=500

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D +L+ Y+  +G+E HV+L+T TK FCGCP  +G  PNT++CP C+G 
Sbjct  10   PFDEVLERYDPALGLEVHVELNTATKMFCGCPAAFGGEPNTHVCPTCLGL  59



>ref|WP_007616472.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
soli]
 dbj|GAC66341.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gordonia 
soli NBRC 108243]
Length=500

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +++ ++ ++G+E HV+L T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  12   DQVIEKFDPVMGLEVHVELGTATKMFCGCPTTFGADPNTQVCPVCIGL  59



>ref|WP_040523138.1| glutamyl-tRNA amidotransferase [Gordonia araii]
Length=500

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  483  PKNQSKPLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P  +    D+++  Y+ ++G+E HV+L T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  4    PATELMEFDDVIAAYDPVLGMEVHVELGTATKMFCGCPTAFGAEPNTQVCPVCIGL  59



>ref|WP_007077397.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Aeromicrobium 
marinum]
 gb|EFQ83096.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Aeromicrobium 
marinum DSM 15272]
Length=503

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P D  +  Y+ ++G+E HV+L+T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  8    PFDEAITRYDPVMGLEVHVELNTATKMFCGCPTEFGAEPNTQVCPVCLGL  57



>ref|WP_019121668.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Brevibacillus 
massiliensis]
Length=478

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +  +E++IG+E H +LST +K FCGCP T+GAPPNT+ CPIC+G
Sbjct  1    MSQFETVIGLEVHAELSTNSKIFCGCPTTFGAPPNTHTCPICLG  44



>ref|WP_040708934.1| glutamyl-tRNA amidotransferase [Nocardia takedensis]
Length=501

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DVIARYEPVLGMEVHVELSTATKMFCGCPTEFGAQPNTQVCPVCLGL  59



>ref|WP_013980364.1| glutamyl-tRNA(Gln) amidotransferase [Eggerthella sp. YY7918]
 dbj|BAK45120.1| asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Eggerthella 
sp. YY7918]
Length=525

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  498  KPLDNILKDYESIIGIETHVQLSTL-TKAFCGCPYTYGAPPNTYICPICMGF  650
            + L+ +L+D+E++IG+E H +L+TL TK FCGC   +GA PNT+ CP+C+G 
Sbjct  2    RKLEEVLQDWEAVIGLEVHAELTTLETKMFCGCKLEFGAAPNTHTCPVCLGL  53



>ref|WP_036538506.1| glutamyl-tRNA amidotransferase [Nocardia cyriacigeorgica]
Length=502

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  13   DVVTRYEPVLGMEVHVELSTATKMFCGCPTEFGAEPNTQVCPVCLGL  59



>ref|WP_005626440.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
hassiacum]
 gb|EKF24286.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
hassiacum DSM 44199]
Length=503

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  12   DDVVARYEPVLGLEVHVELSTATKMFCGCANQFGAEPNTQVCPVCLGL  59



>ref|WP_006592248.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Kineosphaera 
limosa]
 dbj|GAB95716.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Kineosphaera 
limosa NBRC 100340]
Length=509

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  513  ILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +L D++ +IG+E HV+LST TK FCGCP  +G  PN+ +CP+C+G 
Sbjct  10   VLADFDPVIGLEVHVELSTATKMFCGCPTVFGGEPNSQVCPVCLGL  55



>ref|WP_014352185.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nocardia cyriacigeorgica]
 ref|YP_005265367.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Nocardia cyriacigeorgica 
GUH-2]
 emb|CCF64733.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT 
subunit B) [Nocardia cyriacigeorgica GUH-2]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +++  YE ++G+E HV+LST TK FCGCP  +GA PNT +CP+C+G 
Sbjct  5    DVVTRYEPVLGMEVHVELSTATKMFCGCPTEFGAEPNTQVCPVCLGL  51



>ref|WP_029026659.1| glutamyl-tRNA amidotransferase [Salinispora arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_026337226.1| glutamyl-tRNA amidotransferase [Acidobacteriaceae bacterium KBS 
96]
Length=479

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            ++ YE +IG+E HVQL T TK FCGCP  +GA PNT +CP+C+G 
Sbjct  1    MRKYEPVIGLEVHVQLGTKTKIFCGCPVEFGAAPNTNVCPVCLGL  45



>ref|WP_028075227.1| glutamyl-tRNA amidotransferase [Solirubrobacterales bacterium 
URHD0059]
Length=484

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            YE++IG+E HVQL+T+TK FCGC  ++G PPNT+ CP+C+G 
Sbjct  10   YETVIGLEIHVQLATVTKMFCGCTLSFGDPPNTHTCPVCLGL  51



>ref|WP_018806728.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_039070039.1| glutamyl-tRNA amidotransferase [Brevibacillus borstelensis]
Length=478

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +  +E++IG+E H +LST +K FCGCP  +GAPPNT++CPIC+G
Sbjct  1    MSQFETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHVCPICLG  44



>ref|WP_029020167.1| glutamyl-tRNA amidotransferase [Salinispora arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_003389391.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Brevibacillus 
borstelensis]
 gb|EMT51806.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Brevibacillus 
borstelensis AK1]
Length=478

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +  +E++IG+E H +LST +K FCGCP  +GAPPNT++CPIC+G
Sbjct  1    MSQFETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHVCPICLG  44



>ref|WP_028183904.1| glutamyl-tRNA amidotransferase [Salinispora arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_019902083.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_020216556.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_012181331.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
 sp|A8M5E7.1|GATB_SALAI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Salinispora arenicola 
CNS-205]
 gb|ABV97021.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Salinispora arenicola 
CNS-205]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_029536616.1| glutamyl-tRNA amidotransferase [Salinispora arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_020609012.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_018798574.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_016811336.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Salinispora 
arenicola]
Length=499

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D ++  YE +IG+ETHV+L T TK FCGCP  +G  PNT +CP+C+G 
Sbjct  9    DEVVPRYEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGL  56



>ref|WP_014377564.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Blastococcus 
saxobsidens]
 emb|CCG04689.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Blastococcus 
saxobsidens DD2]
Length=498

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D +L  YE ++G+ETHV+L T +K FCGC  T+GA PNT  CP+C+G 
Sbjct  10   DEVLTRYEPVVGLETHVELGTESKMFCGCSTTFGAEPNTQTCPVCLGL  57



>ref|WP_005832547.1| MULTISPECIES: aspartyl/glutamyl-tRNA amidotransferase subunit 
B [Bacillales]
 gb|EJL46492.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Brevibacillus sp. CF112]
 gb|ELK41040.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Brevibacillus 
agri BAB-2500]
Length=478

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  516  LKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMG  647
            +  YE++IG+E H +LST +K FCGCP  +GAPPNT+ CPIC+G
Sbjct  1    MSKYETVIGLEVHAELSTKSKIFCGCPTEFGAPPNTHTCPICLG  44



>ref|WP_009059364.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Methylacidiphilum 
fumariolicum]
 emb|CCG91994.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Methylacidiphilum 
fumariolicum SolV]
Length=485

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  522  DYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGFAWGIAS  668
            +YE+IIG+E HVQL T TK FCGCP  YG  PN+ +CPIC+G    + S
Sbjct  2    EYEAIIGLEVHVQLKTQTKLFCGCPVEYGVLPNSRVCPICLGLPGALPS  50



>ref|WP_003893735.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
smegmatis]
 ref|YP_886709.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
smegmatis str. MC2 155]
 ref|YP_006567072.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
smegmatis str. MC2 155]
 sp|A0QUX1.1|GATB_MYCS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Mycobacterium smegmatis 
str. MC2 155]
 gb|ABK74332.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Mycobacterium 
smegmatis str. MC2 155]
 gb|AFP38777.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Mycobacterium 
smegmatis str. MC2 155]
 gb|ELQ90180.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Mycobacterium 
smegmatis MKD8]
 gb|AIU07552.1| glutamyl-tRNA amidotransferase [Mycobacterium smegmatis str. 
MC2 155]
 gb|AIU14177.1| glutamyl-tRNA amidotransferase [Mycobacterium smegmatis]
 gb|AIU20800.1| glutamyl-tRNA amidotransferase [Mycobacterium smegmatis]
Length=503

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  13   DDVVARYEPVMGMEVHVELSTATKMFCGCANRFGAEPNTLVCPVCLGL  60



>ref|WP_028984882.1| glutamyl-tRNA amidotransferase [Sporichthya polymorpha]
Length=496

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  501  PLDNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            P +  L+ YE +IG+E HV+L T +K FCGCP  +GA PNT +CP C+G 
Sbjct  3    PFEQALQTYEPVIGLEVHVELGTASKMFCGCPTAFGAEPNTQVCPTCLGL  52



>ref|WP_018526987.1| hypothetical protein [Spirochaeta alkalica]
Length=814

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  525  YESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            Y+S IG+E HVQL T TK FC CP T+G  PNT +CP+CMG+
Sbjct  2    YQSFIGLEIHVQLQTKTKVFCDCPVTFGDEPNTRVCPVCMGY  43



>ref|WP_036388300.1| glutamyl-tRNA amidotransferase [Mycobacterium farcinogenes]
 emb|CDP83749.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
farcinogenes]
Length=503

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  12   DDVIAAYEPVMGMEVHVELSTATKMFCGCANRFGAEPNTLVCPVCLGL  59



>ref|WP_003889203.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
phlei]
 gb|EID12447.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
phlei RIVM601174]
Length=503

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  12   DDVVARYEPVLGLEVHVELSTATKMFCGCANRFGAEPNTQVCPVCLGL  59



>ref|WP_021978492.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:793]
 emb|CCY99321.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:793]
Length=479

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  519  KDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            +DYE IIG+E H +LST TK FC CP  +GA PNT++CP+CM  
Sbjct  4    QDYEEIIGLEVHAELSTKTKIFCSCPTEFGADPNTHVCPVCMAM  47



>ref|WP_019343139.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium 
mageritense]
Length=503

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  507  DNILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
            D+++  YE ++G+E HV+LST TK FCGC   +GA PNT +CP+C+G 
Sbjct  12   DDVIAAYEPVMGMEVHVELSTATKMFCGCANRFGAEPNTLVCPVCLGL  59



>ref|WP_030521902.1| glutamyl-tRNA amidotransferase [Nocardia rhamnosiphila]
Length=502

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  510  NILKDYESIIGIETHVQLSTLTKAFCGCPYTYGAPPNTYICPICMGF  650
             ++  YE ++G+E HV+L+T TK FCGCP T+GA PNT +CP+C+G 
Sbjct  13   EVVTRYEPVLGMEVHVELNTATKMFCGCPTTFGADPNTQVCPVCLGL  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960