BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF028B07

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010666847.1|  PREDICTED: methylthioribose-1-phosphate isom...    166   3e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009627128.1|  PREDICTED: methylthioribose-1-phosphate isom...    165   4e-45   Nicotiana tomentosiformis
ref|XP_010090181.1|  Methylthioribose-1-phosphate isomerase             164   9e-45   Morus notabilis
gb|KDO73879.1|  hypothetical protein CISIN_1g017293mg                   162   4e-44   Citrus sinensis [apfelsine]
ref|XP_006474713.1|  PREDICTED: methylthioribose-1-phosphate isom...    162   6e-44   Citrus sinensis [apfelsine]
gb|KDO73876.1|  hypothetical protein CISIN_1g017293mg                   162   7e-44   Citrus sinensis [apfelsine]
ref|XP_009781605.1|  PREDICTED: methylthioribose-1-phosphate isom...    161   8e-44   Nicotiana sylvestris
ref|XP_006452823.1|  hypothetical protein CICLE_v10008682mg             160   1e-43   
gb|ACU24114.1|  unknown                                                 156   1e-43   Glycine max [soybeans]
ref|XP_006452822.1|  hypothetical protein CICLE_v10008682mg             160   3e-43   Citrus clementina [clementine]
gb|KHG04432.1|  Methylthioribose-1-phosphate isomerase                  159   7e-43   Gossypium arboreum [tree cotton]
gb|KJB82982.1|  hypothetical protein B456_013G223100                    156   8e-43   Gossypium raimondii
ref|XP_006346696.1|  PREDICTED: methylthioribose-1-phosphate isom...    159   8e-43   Solanum tuberosum [potatoes]
ref|XP_010047466.1|  PREDICTED: methylthioribose-1-phosphate isom...    159   1e-42   Eucalyptus grandis [rose gum]
gb|KHN12290.1|  Methylthioribose-1-phosphate isomerase                  157   3e-42   Glycine soja [wild soybean]
gb|KJB82984.1|  hypothetical protein B456_013G223100                    157   4e-42   Gossypium raimondii
gb|KCW79381.1|  hypothetical protein EUGRSUZ_C00793                     159   4e-42   Eucalyptus grandis [rose gum]
gb|KJB82981.1|  hypothetical protein B456_013G223100                    157   5e-42   Gossypium raimondii
ref|XP_011019339.1|  PREDICTED: methylthioribose-1-phosphate isom...    157   6e-42   Populus euphratica
ref|XP_007012613.1|  NagB/RpiA/CoA transferase-like superfamily p...    157   7e-42   
ref|XP_004244859.1|  PREDICTED: methylthioribose-1-phosphate isom...    155   1e-41   Solanum lycopersicum
ref|XP_007012614.1|  NagB/RpiA/CoA transferase-like superfamily p...    157   1e-41   
gb|AAM65143.1|  putative translation initiation factor eIF-2B alp...    155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516257.1|  Methylthioribose-1-phosphate isomerase, puta...    155   3e-41   Ricinus communis
ref|XP_010261799.1|  PREDICTED: methylthioribose-1-phosphate isom...    154   5e-41   Nelumbo nucifera [Indian lotus]
gb|KDP33930.1|  hypothetical protein JCGZ_07501                         154   5e-41   Jatropha curcas
ref|NP_027726.1|  methylthioribose-1-phosphate isomerase                154   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308521.2|  eukaryotic translation initiation factor 2B ...    154   7e-41   
gb|EYU28322.1|  hypothetical protein MIMGU_mgv1a008441mg                153   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_002277806.1|  PREDICTED: methylthioribose-1-phosphate isom...    152   3e-40   Vitis vinifera
emb|CBI27788.3|  unnamed protein product                                152   8e-40   Vitis vinifera
ref|XP_007138649.1|  hypothetical protein PHAVU_009G226400g             150   1e-39   Phaseolus vulgaris [French bean]
emb|CDP03069.1|  unnamed protein product                                150   1e-39   Coffea canephora [robusta coffee]
ref|XP_008786516.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    150   2e-39   Phoenix dactylifera
ref|XP_010930603.1|  PREDICTED: methylthioribose-1-phosphate isom...    149   3e-39   
ref|XP_008242258.1|  PREDICTED: methylthioribose-1-phosphate isom...    149   3e-39   Prunus mume [ume]
ref|XP_008450940.1|  PREDICTED: methylthioribose-1-phosphate isom...    149   6e-39   Cucumis melo [Oriental melon]
gb|AES65569.2|  methylthioribose-1-phosphate isomerase                  148   7e-39   Medicago truncatula
ref|XP_003595318.1|  Methylthioribose-1-phosphate isomerase             148   8e-39   
ref|XP_007202151.1|  hypothetical protein PRUPE_ppa007089mg             148   1e-38   Prunus persica
ref|XP_002883712.1|  eukaryotic translation initiation factor 2B ...    147   2e-38   
ref|XP_009337200.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_011078119.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   2e-38   Sesamum indicum [beniseed]
ref|XP_010541997.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    147   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_008337840.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   2e-38   
gb|AFK48892.1|  unknown                                                 145   3e-38   Medicago truncatula
ref|XP_009359722.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_006396132.1|  hypothetical protein EUTSA_v10002579mg             144   1e-37   
ref|XP_008388900.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-37   
ref|XP_006396133.1|  hypothetical protein EUTSA_v10002579mg             144   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009406483.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN66312.1|  hypothetical protein Csa_1G597100                       142   1e-36   Cucumis sativus [cucumbers]
ref|XP_004144039.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   2e-36   
gb|KFK39882.1|  hypothetical protein AALP_AA3G300900                    141   2e-36   Arabis alpina [alpine rockcress]
ref|XP_004488081.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   4e-36   Cicer arietinum [garbanzo]
ref|XP_010467106.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010412762.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010488779.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004287647.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   2e-35   Fragaria vesca subsp. vesca
gb|ACL54299.1|  unknown                                                 134   2e-35   Zea mays [maize]
ref|XP_009102357.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   2e-35   Brassica rapa
ref|XP_006280656.1|  hypothetical protein CARUB_v10026616mg             138   4e-35   Capsella rubella
ref|XP_003577698.1|  PREDICTED: methylthioribose-1-phosphate isom...    135   6e-34   Brachypodium distachyon [annual false brome]
sp|A2ZCP0.1|MTNA_ORYSI  RecName: Full=Methylthioribose-1-phosphat...    135   7e-34   Oryza sativa Indica Group [Indian rice]
emb|CDY33397.1|  BnaA07g04420D                                          134   1e-33   Brassica napus [oilseed rape]
gb|EMS50123.1|  Methylthioribose-1-phosphate isomerase                  134   1e-33   Triticum urartu
ref|NP_001105275.1|  methylthioribose-1-phosphate isomerase             134   2e-33   
gb|ACG37871.1|  methylthioribose-1-phosphate isomerase                  134   2e-33   Zea mays [maize]
sp|B6TZD1.1|MTNA_MAIZE  RecName: Full=Methylthioribose-1-phosphat...    134   2e-33   Zea mays [maize]
ref|NP_001067511.1|  Os11g0216900                                       134   2e-33   
ref|XP_004979099.1|  PREDICTED: methylthioribose-1-phosphate isom...    134   2e-33   Setaria italica
gb|ABA92066.2|  Initiation factor 2 subunit family protein, expre...    134   3e-33   Oryza sativa Japonica Group [Japonica rice]
sp|Q9AYT7.1|MTNA_HORVU  RecName: Full=Methylthioribose-1-phosphat...    132   6e-33   Hordeum vulgare [barley]
dbj|BAJ86257.1|  predicted protein                                      132   6e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662829.1|  PREDICTED: methylthioribose-1-phosphate isom...    132   6e-33   Oryza brachyantha
gb|EPS64192.1|  methylthioribose-1-phosphate isomerase                  132   6e-33   Genlisea aurea
emb|CDY70356.1|  BnaCnng67980D                                          131   1e-32   Brassica napus [oilseed rape]
ref|XP_006842716.1|  hypothetical protein AMTR_s00147p00099160          129   6e-32   Amborella trichopoda
gb|ADE77025.1|  unknown                                                 127   4e-31   Picea sitchensis
ref|XP_001754539.1|  predicted protein                                  113   7e-26   
ref|XP_002992382.1|  hypothetical protein SELMODRAFT_135203             110   5e-25   
gb|KFK23167.1|  hypothetical protein AALP_AAs73675U000500               105   8e-25   Arabis alpina [alpine rockcress]
ref|XP_002967758.1|  hypothetical protein SELMODRAFT_87975              108   2e-24   
gb|KJB82983.1|  hypothetical protein B456_013G223100                    105   4e-23   Gossypium raimondii
gb|EMF09885.1|  methylthioribose-1-phosphate isomerase                99.8    4e-21   Sphaerulina musiva SO2202
gb|EPS29452.1|  hypothetical protein PDE_04401                        97.8    2e-20   Penicillium oxalicum 114-2
gb|EYE93514.1|  Methylthioribose-1-phosphate isomerase                97.4    2e-20   Aspergillus ruber CBS 135680
ref|XP_007780227.1|  methylthioribose-1-phosphate isomerase           94.7    2e-19   Coniosporium apollinis CBS 100218
gb|AGT02428.1|  S-methyl-5-thioribose-1-phosphate isomerase           94.0    3e-19   Strigomonas culicis
ref|XP_007681661.1|  hypothetical protein BAUCODRAFT_319460           94.0    4e-19   Baudoinia panamericana UAMH 10762
gb|EKG14703.1|  Initiation factor 2B-related protein                  94.0    4e-19   Macrophomina phaseolina MS6
gb|EPY28944.1|  methylthioribose-1-phosphate isomerase                94.0    5e-19   Strigomonas culicis
gb|KIW03172.1|  S-methyl-5-thioribose-1-phosphate isomerase           92.8    1e-18   Verruconis gallopava
ref|XP_011114920.1|  hypothetical protein H072_9321                   92.0    2e-18   
ref|XP_002151818.1|  translation initiation factor, putative          91.7    3e-18   Talaromyces marneffei ATCC 18224
ref|XP_003236958.1|  methylthioribose-1-phosphate isomerase           91.7    3e-18   Trichophyton rubrum CBS 118892
gb|KEQ84160.1|  Methylthioribose-1-phosphate isomerase                91.3    3e-18   Aureobasidium pullulans EXF-150
gb|AGT02618.1|  S-methyl-5-thioribose-1-phosphate isomerase           90.9    4e-18   Strigomonas oncopelti
ref|XP_661894.1|  hypothetical protein AN4290.2                       90.5    5e-18   Aspergillus nidulans FGSC A4
dbj|GAM36840.1|  hypothetical protein TCE0_022f06253                  90.9    5e-18   Talaromyces cellulolyticus
ref|XP_001216022.1|  hypothetical protein ATEG_07401                  90.5    6e-18   Aspergillus terreus NIH2624
emb|CCX34105.1|  Similar to Methylthioribose-1-phosphate isomeras...  90.5    6e-18   Pyronema omphalodes CBS 100304
emb|CBJ48521.1|  eukaryotic translation initiation factor 2B fami...  92.8    6e-18   Ectocarpus siliculosus
gb|KFH66789.1|  S-methyl-5-thioribose-1-phosphate isomerase           90.1    8e-18   Mortierella verticillata NRRL 6337
gb|AGT02734.1|  S-methyl-5-thioribose-1-phosphate isomerase           90.1    8e-18   Strigomonas galati
gb|EGD96919.1|  translation initiation factor                         90.1    9e-18   Trichophyton tonsurans CBS 112818
ref|XP_007929107.1|  hypothetical protein MYCFIDRAFT_204427           90.1    1e-17   Pseudocercospora fijiensis CIRAD86
gb|EGE01404.1|  S-methyl-5-thioribose-1-phosphate isomerase           89.7    1e-17   Trichophyton equinum CBS 127.97
gb|EME39638.1|  hypothetical protein DOTSEDRAFT_75327                 89.7    1e-17   Dothistroma septosporum NZE10
ref|XP_001794215.1|  hypothetical protein SNOG_03661                  89.7    1e-17   Parastagonospora nodorum SN15
ref|XP_003850691.1|  hypothetical protein MYCGRDRAFT_73955            89.7    1e-17   Zymoseptoria tritici IPO323
ref|XP_002843502.1|  methylthioribose-1-phosphate isomerase           89.0    2e-17   Microsporum canis CBS 113480
ref|XP_001820594.2|  methylthioribose-1-phosphate isomerase           88.6    3e-17   
ref|XP_002842304.1|  hypothetical protein                             88.2    3e-17   Tuber melanosporum Mel28
sp|Q2UIM3.1|MTNA_ASPOR  RecName: Full=Methylthioribose-1-phosphat...  88.2    4e-17   Aspergillus oryzae RIB40
gb|AGT02795.1|  S-methyl-5-thioribose-1-phosphate isomerase           88.2    4e-17   Angomonas desouzai
ref|XP_002480786.1|  translation initiation factor, putative          88.2    4e-17   Talaromyces stipitatus ATCC 10500
gb|EIT82996.1|  putative translation initiation factor                88.2    4e-17   Aspergillus oryzae 3.042
gb|EER36752.1|  translation initiation factor                         86.3    5e-17   Histoplasma capsulatum H143
ref|XP_001933231.1|  methylthioribose-1-phosphate isomerase           87.8    5e-17   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001540232.1|  hypothetical protein HCAG_04072                  87.8    6e-17   Histoplasma capsulatum NAm1
ref|XP_007583690.1|  putative methylthioribose-1-phosphate isomer...  90.1    7e-17   
ref|XP_001267437.1|  translation initiation factor, putative          87.4    8e-17   Aspergillus fischeri NRRL 181
gb|KEQ71351.1|  Methylthioribose-1-phosphate isomerase                87.4    9e-17   Aureobasidium namibiae CBS 147.97
ref|XP_003172192.1|  methylthioribose-1-phosphate isomerase           87.0    1e-16   Nannizzia gypsea CBS 118893
gb|EER36747.1|  conserved hypothetical protein                        86.3    1e-16   Histoplasma capsulatum H143
gb|KEQ63615.1|  Methylthioribose-1-phosphate isomerase                87.0    1e-16   Aureobasidium melanogenum CBS 110374
gb|KEY83965.1|  translation initiation factor                         86.7    1e-16   Aspergillus fumigatus var. RP-2014
gb|EGC42562.1|  translation initiation factor                         86.7    1e-16   Histoplasma capsulatum H88
ref|XP_752241.1|  translation initiation factor                       86.7    2e-16   Aspergillus fumigatus Af293
sp|C0P108.1|MTNA_AJECG  RecName: Full=Methylthioribose-1-phosphat...  86.7    2e-16   Histoplasma capsulatum G186AR
ref|XP_009056765.1|  hypothetical protein LOTGIDRAFT_190615           86.3    2e-16   Lottia gigantea
gb|KGO76677.1|  Initiation factor 2B alpha/beta/delta                 86.3    2e-16   Penicillium italicum
ref|XP_002560080.1|  Pc14g00860                                       86.3    2e-16   Penicillium rubens Wisconsin 54-1255
gb|KEQ98081.1|  hypothetical protein AUEXF2481DRAFT_63242             86.3    2e-16   Aureobasidium subglaciale EXF-2481
ref|XP_003068154.1|  methylthioribose-1-phosphate isomerase, puta...  85.9    3e-16   Coccidioides posadasii C735 delta SOWgp
emb|CDM34949.1|  Methylthioribose-1-phosphate isomerase               85.9    3e-16   Penicillium roqueforti FM164
ref|XP_002949511.1|  eukaryotic translation initiation factor 2B ...  86.3    3e-16   Volvox carteri f. nagariensis
ref|XP_006678377.1|  hypothetical protein BATDEDRAFT_19408            85.9    4e-16   Batrachochytrium dendrobatidis JAM81
ref|XP_003296469.1|  hypothetical protein PTT_06581                   85.5    4e-16   
emb|CDH49387.1|  methylthioribose-1-phosphate isomerase               85.5    4e-16   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAM84914.1|  hypothetical protein ANO11243_029160                 85.1    5e-16   fungal sp. No.11243
emb|CDS04006.1|  hypothetical protein LRAMOSA06961                    84.7    6e-16   Lichtheimia ramosa
ref|XP_002627028.1|  S-methyl-5-thioribose-1-phosphate isomerase      84.3    9e-16   Blastomyces gilchristii SLH14081
ref|XP_008031489.1|  hypothetical protein SETTUDRAFT_166325           84.3    9e-16   Exserohilum turcica Et28A
gb|KGO39130.1|  Initiation factor 2B alpha/beta/delta                 84.3    9e-16   Penicillium expansum
sp|C5GGE5.1|MTNA_AJEDR  RecName: Full=Methylthioribose-1-phosphat...  84.3    1e-15   Blastomyces dermatitidis ER-3
gb|AGG11452.1|  hypothetical protein                                  84.0    1e-15   Paratrypanosoma confusum
gb|AGT02499.1|  S-methyl-5-thioribose-1-phosphate isomerase           84.0    1e-15   Angomonas deanei
ref|XP_001695926.1|  eukaryotic initiation factor                     81.3    1e-15   Chlamydomonas reinhardtii
ref|XP_007708817.1|  hypothetical protein COCCADRAFT_2167             84.0    2e-15   Bipolaris zeicola 26-R-13
ref|XP_003726311.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  83.6    2e-15   Strongylocentrotus purpuratus [purple urchin]
ref|NP_001077883.1|  methylthioribose-1-phosphate isomerase           82.8    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EFX71518.1|  hypothetical protein DAPPUDRAFT_308831                82.8    2e-15   Daphnia pulex
ref|XP_007702121.1|  hypothetical protein COCSADRAFT_38815            83.6    2e-15   Bipolaris sorokiniana ND90Pr
ref|XP_001199953.2|  PREDICTED: methylthioribose-1-phosphate isom...  82.4    2e-15   
gb|EMD90991.1|  hypothetical protein COCHEDRAFT_1176662               83.2    2e-15   Bipolaris maydis C5
ref|XP_011120963.1|  hypothetical protein AOL_s00076g108              82.8    3e-15   Arthrobotrys oligospora ATCC 24927
gb|EUN32000.1|  hypothetical protein COCVIDRAFT_86317                 83.2    3e-15   Bipolaris victoriae FI3
ref|XP_007691907.1|  hypothetical protein COCMIDRAFT_105818           83.2    3e-15   Bipolaris oryzae ATCC 44560
gb|EKV08512.1|  Methylthioribose-1-phosphate isomerase                82.8    3e-15   Penicillium digitatum Pd1
gb|EPB91090.1|  S-methyl-5-thioribose-1-phosphate isomerase           82.8    4e-15   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001271470.1|  translation initiation factor, putative          82.8    4e-15   Aspergillus clavatus NRRL 1
ref|XP_008104502.1|  PREDICTED: methylthioribose-1-phosphate isom...  82.0    5e-15   Anolis carolinensis [Carolina anole]
ref|XP_003218379.1|  PREDICTED: methylthioribose-1-phosphate isom...  82.0    5e-15   Anolis carolinensis [Carolina anole]
ref|XP_003833699.1|  hypothetical protein LEMA_P064600.1              83.2    5e-15   Leptosphaeria maculans JN3
gb|EHA19257.1|  hypothetical protein ASPNIDRAFT_54270                 82.0    7e-15   Aspergillus niger ATCC 1015
ref|XP_002584032.1|  S-methyl-5-thioribose-1-phosphate isomerase      81.6    9e-15   Uncinocarpus reesii 1704
ref|NP_973428.1|  methylthioribose-1-phosphate isomerase              80.9    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_500138.1|  YALI0A16698p                                        80.5    2e-14   Yarrowia lipolytica CLIB122
ref|XP_004993054.1|  methylthioribose-1-phosphate isomerase           80.5    2e-14   Salpingoeca rosetta
dbj|GAN06082.1|  translation initiation factor                        80.1    3e-14   Mucor ambiguus
emb|CEP08072.1|  hypothetical protein                                 80.1    3e-14   Parasitella parasitica
gb|AGT02556.1|  S-methyl-5-thioribose-1-phosphate isomerase           79.7    3e-14   Herpetomonas muscarum
ref|XP_009008789.1|  hypothetical protein HELRODRAFT_62224            79.3    4e-14   Helobdella robusta
dbj|GAE00299.1|  translation initiation factor, putative              79.7    4e-14   Byssochlamys spectabilis No. 5
ref|NP_001104708.1|  methylthioribose-1-phosphate isomerase           79.0    6e-14   Danio rerio [leopard danio]
gb|EQL00687.1|  methylthioribose-1-phosphate isomerase                78.6    1e-13   Ophiocordyceps sinensis CO18
ref|XP_001742754.1|  hypothetical protein                             78.2    1e-13   Monosiga brevicollis MX1
ref|XP_007229603.1|  PREDICTED: methylthioribose-1-phosphate isom...  77.8    1e-13   Astyanax mexicanus [blind cave fish]
gb|EIE81164.1|  S-methyl-5-thioribose-1-phosphate isomerase           77.8    2e-13   Rhizopus delemar RA 99-880
emb|CEI86534.1|  Putative S-methyl-5-thioribose-1-phosphate isome...  77.8    2e-13   Rhizopus microsporus
ref|XP_006023465.1|  PREDICTED: methylthioribose-1-phosphate isom...  77.8    2e-13   Alligator sinensis
ref|XP_007275439.1|  methylthioribose-1-phosphate isomerase           77.8    2e-13   
ref|XP_006790934.1|  PREDICTED: methylthioribose-1-phosphate isom...  76.6    2e-13   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007422307.1|  PREDICTED: methylthioribose-1-phosphate isom...  77.0    3e-13   
ref|XP_003760740.1|  PREDICTED: methylthioribose-1-phosphate isom...  77.0    3e-13   Sarcophilus harrisii
ref|XP_003455807.1|  PREDICTED: methylthioribose-1-phosphate isom...  77.0    3e-13   Oreochromis niloticus
gb|EMT32201.1|  Methylthioribose-1-phosphate isomerase                77.8    3e-13   
gb|KIL92878.1|  methylthioribose-1-phosphate isomerase                77.0    4e-13   Fusarium avenaceum
ref|XP_003057882.1|  translation initiation factor fusion with me...  78.2    4e-13   Micromonas pusilla CCMP1545
emb|CEF98703.1|  Putative translation initiation factor,aIF-2BI/5...  78.2    4e-13   Ostreococcus tauri
gb|KGQ02006.1|  methylthioribose-1-phosphate isomerase                76.6    5e-13   Paracoccidioides lutzii Pb01
gb|ENH63320.1|  Methylthioribose-1-phosphate isomerase                76.6    6e-13   Fusarium oxysporum f. sp. cubense race 1
ref|XP_005850664.1|  hypothetical protein CHLNCDRAFT_140697           77.8    6e-13   Chlorella variabilis
emb|CEG65982.1|  Putative S-methyl-5-thioribose-1-phosphate isome...  76.3    6e-13   Rhizopus microsporus
ref|XP_003972078.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.9    6e-13   Takifugu rubripes [tiger puffer]
emb|CCT63771.1|  probable cig2 protein (putative GDP-GTP exchange...  76.3    7e-13   Fusarium fujikuroi IMI 58289
gb|AGT02673.1|  S-methyl-5-thioribose-1-phosphate isomerase           75.9    8e-13   Crithidia acanthocephali
emb|CAG06038.1|  unnamed protein product                              75.5    8e-13   Tetraodon nigroviridis
ref|XP_006262838.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.9    8e-13   Alligator mississippiensis
gb|EQB52140.1|  S-methyl-5-thioribose-1-phosphate isomerase           75.9    8e-13   Colletotrichum gloeosporioides Cg-14
ref|XP_003080319.1|  methylthioribose kinase (ISS)                    77.4    9e-13   
ref|WP_026289843.1|  methylthioribose-1-phosphate isomerase           75.5    1e-12   Thioalkalivibrio sulfidiphilus
ref|XP_001594777.1|  hypothetical protein SS1G_04585                  76.3    1e-12   Sclerotinia sclerotiorum 1980 UF-70
gb|ENH78574.1|  methylthioribose-1-phosphate isomerase                75.9    1e-12   
gb|EWZ41170.1|  methylthioribose-1-phosphate isomerase                75.9    1e-12   Fusarium oxysporum Fo47
gb|EXA01732.1|  methylthioribose-1-phosphate isomerase                75.5    1e-12   Fusarium oxysporum f. sp. lycopersici MN25
gb|EXA48565.1|  methylthioribose-1-phosphate isomerase                75.5    1e-12   Fusarium oxysporum f. sp. pisi HDV247
gb|EGU81202.1|  hypothetical protein FOXB_08352                       75.5    1e-12   Fusarium oxysporum Fo5176
gb|EMT60763.1|  Methylthioribose-1-phosphate isomerase                75.5    1e-12   Fusarium oxysporum f. sp. cubense race 4
gb|EWG45098.1|  methylthioribose-1-phosphate isomerase                75.5    1e-12   Fusarium verticillioides 7600
ref|XP_010870944.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.1    1e-12   
ref|XP_010740335.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.1    1e-12   Larimichthys crocea [croceine croaker]
ref|XP_003012717.1|  hypothetical protein ARB_00968                   75.9    1e-12   Trichophyton benhamiae CBS 112371
ref|XP_005805132.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.1    1e-12   Xiphophorus maculatus
emb|CEJ01322.1|  Putative S-methyl-5-thioribose-1-phosphate isome...  75.5    1e-12   Rhizopus microsporus
ref|XP_007570269.1|  PREDICTED: methylthioribose-1-phosphate isom...  75.1    2e-12   Poecilia formosa
ref|XP_001687079.1|  putative translation initiation factor 2 sub...  75.5    2e-12   Leishmania major strain Friedlin
ref|XP_003025058.1|  hypothetical protein TRV_00716                   75.5    2e-12   Trichophyton verrucosum HKI 0517
ref|XP_004872496.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.9    2e-12   
gb|AGG11646.1|  hypothetical protein                                  74.7    2e-12   Leptomonas pyrrhocoris
gb|EAW84369.1|  hypothetical protein MGC3207, isoform CRA_a           72.8    2e-12   Homo sapiens [man]
emb|CCF35223.1|  S-methyl-5-thioribose-1-phosphate isomerase          73.2    3e-12   Colletotrichum higginsianum
gb|KFY18962.1|  hypothetical protein V491_04642                       72.4    3e-12   Pseudogymnoascus sp. VKM F-3775
sp|Q4Q0R9.2|MTNA_LEIMA  RecName: Full=Methylthioribose-1-phosphat...  74.3    3e-12   Leishmania major
ref|XP_010777850.1|  PREDICTED: methylthioribose-1-phosphate isom...  72.4    4e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004872495.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.9    4e-12   Heterocephalus glaber [naked mole rat]
ref|XP_003798062.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.9    4e-12   Otolemur garnettii
ref|XP_008087169.1|  NagB/RpiA/CoA transferase-like protein           74.3    4e-12   Glarea lozoyensis ATCC 20868
ref|XP_005310723.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.6    4e-12   Chrysemys picta bellii
gb|EYB31804.1|  hypothetical protein FG05_05053                       73.9    5e-12   Fusarium graminearum
ref|XP_009256337.1|  hypothetical protein FPSE_04944                  73.2    5e-12   Fusarium pseudograminearum CS3096
ref|XP_008596336.1|  S-methyl-5-thioribose-1-phosphate isomerase      73.9    5e-12   Beauveria bassiana ARSEF 2860
ref|XP_007790511.1|  putative methylthioribose-1-phosphate isomer...  73.9    5e-12   
ref|XP_011323537.1|  hypothetical protein FGSG_05053                  73.9    5e-12   Fusarium graminearum PH-1
gb|KGQ07769.1|  Methylthioribose-1-phosphate isomerase                73.9    5e-12   Beauveria bassiana D1-5
gb|KJB07315.1|  hypothetical protein B456_001G015800                  72.8    5e-12   Gossypium raimondii
ref|XP_829164.1|  translation initiation factor 2 subunit             73.6    5e-12   Trypanosoma brucei brucei TREU927
ref|XP_008853657.1|  PREDICTED: methylthioribose-1-phosphate isom...  72.8    6e-12   
sp|D0A8W2.1|MTNA_TRYB9  RecName: Full=Methylthioribose-1-phosphat...  73.6    6e-12   Trypanosoma brucei gambiense DAL972
ref|XP_004872494.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.6    6e-12   
ref|NP_115661.1|  methylthioribose-1-phosphate isomerase isoform 2    72.8    6e-12   Homo sapiens [man]
sp|C0S1C8.1|MTNA_PARBP  RecName: Full=Methylthioribose-1-phosphat...  73.6    6e-12   Paracoccidioides brasiliensis Pb03
ref|XP_007591582.1|  S-methyl-5-thioribose-1-phosphate isomerase      73.6    7e-12   
gb|ERS95656.1|  methylthioribose-1-phosphate isomerase                73.6    7e-12   Sporothrix schenckii ATCC 58251
emb|CCC53713.1|  putative translation initiation factor 2 subunit     73.2    7e-12   Trypanosoma vivax Y486
ref|XP_001418690.1|  predicted protein                                73.2    8e-12   Ostreococcus lucimarinus CCE9901
ref|XP_002099512.1|  GE23315                                          73.2    8e-12   Drosophila yakuba
ref|XP_004060186.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.2    8e-12   
ref|XP_001469414.1|  putative translation initiation factor 2 sub...  73.2    8e-12   Leishmania infantum JPCM5
ref|XP_008853656.1|  PREDICTED: methylthioribose-1-phosphate isom...  73.2    8e-12   Nannospalax galili
gb|KJB07314.1|  hypothetical protein B456_001G015800                  72.4    8e-12   Gossypium raimondii
ref|XP_010759673.1|  methylthioribose-1-phosphate isomerase           73.2    8e-12   Paracoccidioides brasiliensis Pb18
ref|NP_001026897.1|  methylthioribose-1-phosphate isomerase isofo...  72.8    8e-12   Homo sapiens [man]
ref|XP_004170363.1|  PREDICTED: methylthioribose-1-phosphate isom...  67.8    9e-12   
pdb|4LDR|A  Chain A, Structure Of The S283y Mutant Of Mrdi            72.8    9e-12   Homo sapiens [man]
ref|XP_001226203.1|  hypothetical protein CHGG_10936                  73.2    9e-12   Chaetomium globosum CBS 148.51
gb|KIZ04682.1|  isopentenyl-diphosphate Delta-isomerase               73.6    1e-11   Monoraphidium neglectum
ref|XP_003665347.1|  hypothetical protein MYCTH_2135256               72.8    1e-11   Thermothelomyces thermophila ATCC 42464
gb|KDN67943.1|  putative S-methyl-5-thioribose-1-phosphate isomerase  72.8    1e-11   Colletotrichum sublineola
ref|XP_809913.1|  translation initiation factor 2 subunit             72.8    1e-11   Trypanosoma cruzi strain CL Brener
ref|XP_003123394.2|  PREDICTED: methylthioribose-1-phosphate isom...  72.8    1e-11   
emb|CBZ26352.1|  translation initiation factor 2 subunit,putative     73.2    1e-11   Leishmania mexicana MHOM/GT/2001/U1103
gb|KFB37657.1|  AGAP001589-PA-like protein                            72.4    1e-11   Anopheles sinensis
ref|XP_001560925.1|  hypothetical protein BC1G_00010                  72.8    1e-11   Botrytis cinerea B05.10
ref|XP_001357949.1|  GA10928                                          72.4    1e-11   Drosophila pseudoobscura pseudoobscura
ref|XP_002023756.1|  GL27236                                          72.4    1e-11   Drosophila persimilis
ref|XP_807040.1|  translation initiation factor 2 subunit             72.4    1e-11   Trypanosoma cruzi strain CL Brener
gb|KFY24283.1|  hypothetical protein V493_05338                       72.8    1e-11   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_001641945.1|  predicted protein                                72.0    1e-11   Nematostella vectensis
gb|EFQ35563.1|  S-methyl-5-thioribose-1-phosphate isomerase           72.4    1e-11   Colletotrichum graminicola M1.001
ref|WP_019006345.1|  methylthioribose-1-phosphate isomerase           72.0    2e-11   Cohnella laeviribosi
gb|EPE04150.1|  methylthioribose-1-phosphate isomerase                72.0    2e-11   Ophiostoma piceae UAMH 11346
ref|XP_007915793.1|  putative methylthioribose-1-phosphate isomer...  72.0    2e-11   Phaeoacremonium minimum UCRPA7
gb|ESL11669.1|  translation initiation factor 2 subunit               72.0    2e-11   Trypanosoma rangeli SC58
gb|AIC57312.1|  MRI1                                                  71.6    2e-11   synthetic construct
ref|WP_012638101.1|  methylthioribose-1-phosphate isomerase           71.2    3e-11   Thioalkalivibrio sulfidiphilus
ref|XP_001604505.1|  PREDICTED: methylthioribose-1-phosphate isom...  71.2    3e-11   Nasonia vitripennis
ref|XP_004616861.1|  PREDICTED: methylthioribose-1-phosphate isom...  71.2    3e-11   
ref|XP_004389786.1|  PREDICTED: methylthioribose-1-phosphate isom...  71.2    3e-11   
gb|EPY53630.1|  methylthioribose-1-phosphate isomerase                71.2    3e-11   
ref|XP_009651895.1|  methylthioribose-1-phosphate isomerase           71.2    3e-11   
ref|XP_011496297.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.9    4e-11   
ref|XP_001664017.1|  AAEL013828-PA                                    70.9    4e-11   
gb|ELR06241.1|  S-methyl-5-thioribose-1-phosphate isomerase           71.6    4e-11   
ref|XP_003008283.1|  methylthioribose-1-phosphate isomerase           71.2    4e-11   
gb|EKC40771.1|  Methylthioribose-1-phosphate isomerase                72.0    4e-11   
gb|KFY51323.1|  hypothetical protein V496_08871                       71.2    4e-11   
gb|EKG00716.1|  translation initiation factor 2 subunit, putative     70.1    4e-11   
ref|XP_002105622.1|  GD16414                                          70.9    4e-11   
gb|KFX96181.1|  hypothetical protein V490_03482                       71.2    4e-11   
gb|KFX97244.1|  hypothetical protein O988_04954                       71.2    5e-11   
sp|B2AML6.2|MTNA_PODAN  RecName: Full=Methylthioribose-1-phosphat...  70.9    5e-11   
ref|XP_004066207.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.5    5e-11   
gb|KIH90966.1|  methylthioribose-1-phosphate isomerase                70.9    5e-11   
ref|XP_010359906.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.9    5e-11   
gb|ESS62513.1|  translation initiation factor 2 subunit               70.9    5e-11   
emb|CCC95679.1|  unnamed protein product                              70.5    6e-11   
ref|XP_002733184.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.5    6e-11   
ref|XP_007828445.1|  Methylthioribose-1-phosphate isomerase           70.5    7e-11   
ref|XP_002001025.1|  GI10562                                          70.5    7e-11   
ref|XP_011454865.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.5    7e-11   
gb|KDB15846.1|  methylthioribose-1-phosphate isomerase                70.5    8e-11   
gb|EKF29009.1|  translation initiation factor 2 subunit, putative     70.1    8e-11   
ref|XP_009494667.1|  hypothetical protein H696_02480                  70.5    8e-11   
ref|NP_001016877.1|  methylthioribose-1-phosphate isomerase           70.1    8e-11   
ref|XP_011262788.1|  PREDICTED: methylthioribose-1-phosphate isom...  70.1    8e-11   
ref|XP_001905298.1|  hypothetical protein                             70.5    8e-11   
ref|XP_001993776.1|  GH21593                                          70.1    9e-11   
gb|EFN63924.1|  Translation initiation factor eIF-2B subunit alph...  70.1    9e-11   
ref|XP_006690569.1|  putative translation initiation factor           70.1    9e-11   
sp|Q0VFN1.1|MTNA_XENTR  RecName: Full=Methylthioribose-1-phosphat...  69.7    9e-11   
ref|WP_027091764.1|  methylthioribose-1-phosphate isomerase           70.1    9e-11   
ref|XP_003654207.1|  hypothetical protein THITE_2117012               70.1    9e-11   
ref|XP_003045774.1|  predicted protein                                70.1    1e-10   
ref|XP_009433121.1|  PREDICTED: methylthioribose-1-phosphate isom...  69.3    1e-10   
ref|XP_009853534.1|  hypothetical protein NEUTE1DRAFT_67681           69.7    1e-10   
ref|XP_007290300.1|  S-methyl-5-thioribose-1-phosphate isomerase      70.1    1e-10   
emb|CBY10920.1|  unnamed protein product                              67.8    1e-10   
ref|XP_006003719.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.9    1e-10   
ref|NP_651868.1|  CG11334, isoform B                                  69.3    1e-10   
emb|CCE31988.1|  probable cig2 protein (putative GDP-GTP exchange...  69.7    1e-10   
ref|XP_002037477.1|  GM12085                                          69.3    1e-10   
ref|XP_001569135.1|  putative translation initiation factor 2 sub...  69.7    1e-10   
gb|KHJ32211.1|  putative methylthioribose-1-phosphate isomerase       69.7    1e-10   
ref|XP_005185612.1|  PREDICTED: methylthioribose-1-phosphate isom...  69.3    1e-10   
pdb|2A0U|A  Chain A, Crystal Structure Of The Eukaryotic Initiati...  69.3    1e-10   
ref|XP_009433120.1|  PREDICTED: methylthioribose-1-phosphate isom...  69.3    2e-10   
gb|KFY36346.1|  hypothetical protein V494_05095                       69.7    2e-10   
gb|KFY77341.1|  hypothetical protein V499_03240                       69.7    2e-10   
ref|NP_001037650.1|  methylthioribose-1-phosphate isomerase           69.3    2e-10   
gb|KFZ14857.1|  hypothetical protein V501_03036                       69.7    2e-10   
gb|KIX06934.1|  S-methyl-5-thioribose-1-phosphate isomerase           69.3    2e-10   
ref|XP_002054225.1|  GJ22917                                          68.9    2e-10   
ref|XP_005099286.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.9    2e-10   
ref|XP_002072272.1|  GK22419                                          68.9    2e-10   
ref|XP_969152.1|  PREDICTED: methylthioribose-1-phosphate isomerase   68.9    2e-10   
ref|XP_006003718.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.9    2e-10   
ref|XP_007952565.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.9    2e-10   
sp|P0CI29.1|MTNA_SORMK  RecName: Full=Methylthioribose-1-phosphat...  68.9    2e-10   
ref|NP_001090076.1|  methylthioribose-1-phosphate isomerase           68.6    3e-10   
ref|XP_008315470.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.6    3e-10   
ref|XP_959639.1|  methylthioribose-1-phosphate isomerase              68.6    3e-10   
ref|XP_003468199.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.6    3e-10   
gb|AII97822.1|  BLTX450                                               67.0    3e-10   
gb|KFY12396.1|  hypothetical protein V492_03899                       68.6    3e-10   
ref|XP_003867136.1|  Mri1 protein                                     68.6    3e-10   
gb|KJE93735.1|  translation initiation factor eif-2b                  68.2    4e-10   
ref|XP_011184740.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.2    4e-10   
ref|XP_006666062.1|  methylthioribose-1-phosphate isomerase           68.2    4e-10   
ref|XP_011210381.1|  PREDICTED: methylthioribose-1-phosphate isom...  68.2    4e-10   
gb|AII97717.1|  BLTX330                                               67.0    4e-10   
ref|XP_001981082.1|  GG11866                                          68.2    4e-10   
emb|CBY31516.1|  unnamed protein product                              67.8    4e-10   
ref|XP_010703436.1|  translation initiation factor 2 subunit, put...  68.2    4e-10   
ref|XP_004348313.2|  translation initiation factor eif-2b             68.2    4e-10   
ref|XP_004166700.1|  PREDICTED: methylthioribose-1-phosphate isom...  67.8    5e-10   
emb|CEJ93750.1|  Putative Methylthioribose-1-phosphate isomerase      67.8    5e-10   
ref|XP_005962906.1|  PREDICTED: methylthioribose-1-phosphate isom...  67.4    6e-10   
ref|XP_002424016.1|  conserved hypothetical protein                   67.4    6e-10   
ref|XP_004530069.1|  PREDICTED: methylthioribose-1-phosphate isom...  67.4    7e-10   
ref|XP_006730645.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.9    7e-10   
ref|WP_029565436.1|  methylthioribose-1-phosphate isomerase           67.4    7e-10   
gb|KEZ46350.1|  Methylthioribose-1-phosphate isomerase                67.4    8e-10   
emb|CBY10945.1|  unnamed protein product                              67.4    8e-10   
gb|KGU12270.1|  methylthioribose-1-phosphate isomerase                67.4    8e-10   
gb|KGU30284.1|  methylthioribose-1-phosphate isomerase                67.4    8e-10   
ref|XP_001953494.1|  GF17194                                          67.0    9e-10   
emb|CBY10944.1|  unnamed protein product                              67.0    1e-09   
gb|EHH59270.1|  Methylthioribose-1-phosphate isomerase                66.6    1e-09   
emb|CCE43738.1|  hypothetical protein CPAR2_213820                    67.0    1e-09   
ref|XP_006206282.1|  PREDICTED: methylthioribose-1-phosphate isom...  66.6    1e-09   
ref|XP_002761866.2|  PREDICTED: methylthioribose-1-phosphate isom...  66.6    1e-09   
ref|WP_029281779.1|  methylthioribose-1-phosphate isomerase           66.6    1e-09   
ref|XP_003351360.1|  hypothetical protein SMAC_03666                  67.4    1e-09   
gb|KGU15995.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
gb|KGQ96798.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
gb|KGR15986.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
gb|KHC81191.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
ref|XP_719585.1|  potential Initiation factor 2 subunit family pr...  66.6    1e-09   
gb|KGU16188.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
gb|KHC55206.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
gb|KGQ89948.1|  methylthioribose-1-phosphate isomerase                66.6    1e-09   
sp|C4YJ78.1|MTNA_CANAW  RecName: Full=Methylthioribose-1-phosphat...  66.6    1e-09   
gb|EHH29705.1|  Methylthioribose-1-phosphate isomerase                66.2    2e-09   
ref|XP_001111047.1|  PREDICTED: methylthioribose-1-phosphate isom...  66.2    2e-09   
ref|XP_005588259.1|  PREDICTED: methylthioribose-1-phosphate isom...  66.2    2e-09   
gb|EHJ70136.1|  eIF2B-alpha-like protein                              65.9    2e-09   
gb|ETI70279.1|  translation initiation factor, aIF-2BI family pro...  65.9    2e-09   
ref|WP_034723208.1|  methylthioribose-1-phosphate isomerase           65.9    2e-09   
ref|XP_004715550.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.9    2e-09   
gb|KGR01354.1|  methylthioribose-1-phosphate isomerase                66.2    2e-09   
ref|XP_011342004.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.9    2e-09   
gb|KFA62564.1|  hypothetical protein S40285_05811                     65.9    2e-09   
gb|KEY69218.1|  hypothetical protein S7711_01674                      65.9    2e-09   
ref|XP_008709946.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.9    2e-09   
ref|XP_007753953.1|  S-methyl-5-thioribose-1-phosphate isomerase      65.9    3e-09   
ref|XP_004399024.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.9    3e-09   
ref|XP_006874338.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.5    3e-09   
gb|KFA77974.1|  hypothetical protein S40288_07704                     65.9    3e-09   
gb|KDR24083.1|  Methylthioribose-1-phosphate isomerase                65.5    3e-09   
gb|EPX71175.1|  methylthioribose-1-phosphate isomerase                65.5    3e-09   
ref|XP_008724306.1|  S-methyl-5-thioribose-1-phosphate isomerase      65.5    3e-09   
ref|WP_026567320.1|  methylthioribose-1-phosphate isomerase           65.5    3e-09   
ref|XP_005336293.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.5    3e-09   
ref|XP_003275654.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    3e-09   
gb|KHC66520.1|  methylthioribose-1-phosphate isomerase                65.5    3e-09   
ref|XP_005533667.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.5    3e-09   
ref|WP_023558366.1|  methylthioribose-1-phosphate isomerase           65.1    3e-09   
ref|XP_005336292.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.5    4e-09   
ref|XP_003275653.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    4e-09   
ref|XP_007744831.1|  S-methyl-5-thioribose-1-phosphate isomerase      65.1    4e-09   
ref|XP_006900885.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  65.1    4e-09   
ref|XP_007993674.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    4e-09   
ref|XP_002921063.2|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  65.1    4e-09   
ref|XP_003915067.2|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    4e-09   
ref|XP_007993676.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    4e-09   
ref|XP_003915068.2|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    4e-09   
ref|XP_006621216.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    5e-09   
ref|XP_006621215.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    5e-09   
ref|XP_003486247.1|  PREDICTED: methylthioribose-1-phosphate isom...  65.1    5e-09   
gb|ACO15518.1|  Translation initiation factor eIF-2B subunit alph...  64.7    5e-09   
ref|XP_003700639.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    5e-09   
gb|KIN04067.1|  hypothetical protein OIDMADRAFT_143525                65.1    5e-09   
ref|XP_006621213.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    5e-09   
ref|XP_006079940.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    5e-09   
ref|XP_011380861.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    6e-09   
ref|XP_006621214.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    6e-09   
ref|WP_035018788.1|  methylthioribose-1-phosphate isomerase           64.7    6e-09   
ref|XP_003397603.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.7    6e-09   
ref|XP_004748335.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  64.7    6e-09   
sp|A5DNT0.2|MTNA_PICGU  RecName: Full=Methylthioribose-1-phosphat...  64.7    6e-09   
ref|WP_035044941.1|  methylthioribose-1-phosphate isomerase           64.3    6e-09   
ref|XP_001482976.1|  hypothetical protein PGUG_04931                  64.7    6e-09   
gb|KIW94717.1|  S-methyl-5-thioribose-1-phosphate isomerase           64.7    7e-09   
ref|XP_006560811.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.9    7e-09   
ref|XP_003697763.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.3    7e-09   
ref|XP_006560810.1|  PREDICTED: methylthioribose-1-phosphate isom...  64.3    7e-09   
ref|WP_022485644.1|  methylthioribose-1-phosphate isomerase           64.3    8e-09   
ref|XP_002291786.1|  predicted protein                                64.3    8e-09   
ref|XP_392553.1|  PREDICTED: methylthioribose-1-phosphate isomera...  64.3    8e-09   
gb|EMG50997.1|  hypothetical protein G210_5303                        64.3    9e-09   
ref|XP_006560809.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.9    9e-09   
ref|XP_006918814.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.9    9e-09   
ref|XP_006684403.1|  putative translation initiation factor           64.3    9e-09   
ref|XP_007816032.1|  methylthioribose-1-phosphate isomerase           63.9    9e-09   
gb|KIE00968.1|  methylthioribose-1-phosphate isomerase                63.9    1e-08   
ref|XP_001382812.2|  hypothetical protein PICST_40776                 63.9    1e-08   
ref|XP_002724279.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.9    1e-08   
gb|KID80714.1|  methylthioribose-1-phosphate isomerase                63.9    1e-08   
ref|XP_006175447.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.9    1e-08   
gb|KFG78348.1|  methylthioribose-1-phosphate isomerase                63.9    1e-08   
gb|KID90826.1|  methylthioribose-1-phosphate isomerase                63.9    1e-08   
ref|XP_007817378.1|  methylthioribose-1-phosphate isomerase           63.9    1e-08   
gb|KEF62771.1|  S-methyl-5-thioribose-1-phosphate isomerase           63.9    1e-08   
gb|KFH48781.1|  Methylthioribose-1-phosphate isomerase-like protein   63.9    1e-08   
gb|KIW71970.1|  S-methyl-5-thioribose-1-phosphate isomerase           63.5    1e-08   
emb|CDY04295.1|  BnaC06g25200D                                        62.4    1e-08   
ref|XP_002500043.1|  translation initiation factor fusion with me...  63.9    1e-08   
ref|XP_001528640.1|  conserved hypothetical protein                   63.5    2e-08   
ref|WP_004436101.1|  methylthioribose-1-phosphate isomerase           63.2    2e-08   
ref|XP_003741363.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.2    2e-08   
ref|WP_010283269.1|  methylthioribose-1-phosphate isomerase           63.2    2e-08   
gb|ELR62033.1|  Methylthioribose-1-phosphate isomerase                63.2    2e-08   
emb|CDJ81666.1|  Initiation factor 2B related domain containing p...  63.2    2e-08   
ref|XP_007129465.1|  PREDICTED: methylthioribose-1-phosphate isom...  63.2    2e-08   
ref|NP_001039852.1|  methylthioribose-1-phosphate isomerase           63.2    2e-08   
gb|ELK21537.1|  S-methyl-5-thioribose-1-phosphate isomerase           62.8    2e-08   
ref|XP_005888077.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    2e-08   
ref|XP_010992133.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    2e-08   
ref|XP_004277483.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    2e-08   
ref|XP_004327551.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    2e-08   
ref|WP_004433811.1|  methylthioribose-1-phosphate isomerase           62.8    2e-08   
gb|EDL10940.1|  RIKEN cDNA 2410018C20, isoform CRA_a                  60.5    2e-08   
ref|XP_456394.2|  DEHA2A01276p                                        62.8    2e-08   
ref|XP_001943893.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    2e-08   
ref|XP_002418085.1|  methylthioribose-1-phosphate isomerase, puta...  62.8    3e-08   
ref|XP_007182139.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    3e-08   
ref|XP_008469932.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  63.2    3e-08   
ref|XP_004688304.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.8    3e-08   
ref|XP_003708706.1|  S-methyl-5-thioribose-1-phosphate isomerase      62.4    3e-08   
ref|WP_026576415.1|  methylthioribose-1-phosphate isomerase           62.4    3e-08   
ref|WP_027319562.1|  methylthioribose-1-phosphate isomerase           62.4    3e-08   
ref|XP_007469132.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...  62.4    3e-08   
emb|CDO93946.1|  unnamed protein product                              62.4    3e-08   
gb|KIX97693.1|  hypothetical protein Z520_06471                       62.4    3e-08   
gb|KHN97965.1|  methylthioribose-1-phosphate isomerase                62.4    3e-08   
ref|WP_035344152.1|  methylthioribose-1-phosphate isomerase           62.4    4e-08   
ref|XP_002546989.1|  hypothetical protein CTRG_01295                  62.4    4e-08   
ref|XP_011052943.1|  PREDICTED: methylthioribose-1-phosphate isom...  62.4    4e-08   
ref|WP_009790917.1|  MULTISPECIES: methylthioribose-1-phosphate i...  62.4    4e-08   
ref|XP_007375063.1|  hypothetical protein SPAPADRAFT_60886            62.4    4e-08   
gb|KIW83076.1|  S-methyl-5-thioribose-1-phosphate isomerase           62.4    4e-08   
gb|KIV77933.1|  S-methyl-5-thioribose-1-phosphate isomerase           62.4    4e-08   
gb|EHK50478.1|  hypothetical protein TRIATDRAFT_297230                62.0    4e-08   
ref|WP_011357239.1|  methylthioribose-1-phosphate isomerase           62.0    4e-08   
gb|ABB28615.1|  translation initiation factor 2B subunit I family...  62.0    4e-08   
ref|WP_020615982.1|  methylthioribose-1-phosphate isomerase           62.0    5e-08   
ref|WP_022995937.1|  methylthioribose-1-phosphate isomerase           62.0    5e-08   



>ref|XP_010666847.1| PREDICTED: methylthioribose-1-phosphate isomerase [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAICY RGSLQLLDQRKLPL+T+YL+I+NA DGW AIKEMVVRGAPAIAIAAALSLAVE
Sbjct  20   LQAICYNRGSLQLLDQRKLPLETVYLEIRNASDGWLAIKEMVVRGAPAIAIAAALSLAVE  79

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            +SNL+ F GT +DA SFL+QKLEYLVSSRPTAVNLSDAATKL E+I K AST SEA T+
Sbjct  80   SSNLKAFQGTPEDAASFLAQKLEYLVSSRPTAVNLSDAATKLKEIIAKAASTCSEADTV  138



>ref|XP_009627128.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Nicotiana tomentosiformis]
 sp|Q948X8.1|MTNA_TOBAC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nicotiana 
tabacum]
 dbj|BAB63262.1| CIG2 [Nicotiana tabacum]
Length=374

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MANG +  DKTL +ICY RGSLQLLDQRKLPL+TIYLDI++ KDGWDAIKEMVVRGAPAI
Sbjct  1    MANG-NEGDKTLLSICYNRGSLQLLDQRKLPLETIYLDIQDTKDGWDAIKEMVVRGAPAI  59

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNL +F+GT+ DA  FLS KL+YLVSSRPTAVNLSDAA KL EVI K 
Sbjct  60   AIAAALSLAVEVSNLSSFDGTSDDASDFLSNKLDYLVSSRPTAVNLSDAAVKLKEVIKKA  119

Query  617  ASTASEAKTI  646
            A+TA +A ++
Sbjct  120  ATTAKDANSV  129



>ref|XP_010090181.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
 gb|EXB38978.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
Length=371

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            A S+D TLQAICYKRGSL+LLDQRKLPL+T YLDI+++ DGW AIK+MVVRGAPAIAIAA
Sbjct  2    ASSQDNTLQAICYKRGSLRLLDQRKLPLETAYLDIRDSTDGWHAIKDMVVRGAPAIAIAA  61

Query  449  alslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
            ALSLAVE SNL+ F+G+  DAVS+L  KL+YLVSSRPTAVNLSDAATKL EVI+K + TA
Sbjct  62   ALSLAVEVSNLDPFDGSISDAVSYLIMKLDYLVSSRPTAVNLSDAATKLKEVISKASDTA  121

Query  629  SEAKTI  646
            SEAK I
Sbjct  122  SEAKNI  127



>gb|KDO73879.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=358

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8    TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68   SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  635  AKTI  646
            A ++
Sbjct  128  ANSV  131



>ref|XP_006474713.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Citrus 
sinensis]
 gb|KDO73877.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
 gb|KDO73878.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=373

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8    TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68   SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  635  AKTI  646
            A ++
Sbjct  128  ANSV  131



>gb|KDO73876.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=374

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8    TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68   SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  635  AKTI  646
            A ++
Sbjct  128  ANSV  131



>ref|XP_009781605.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nicotiana 
sylvestris]
Length=374

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            DKTL +ICYKRGSLQLLDQRKLPL+TI+LDI++ KDGWDAIKEMVVRGAPAIAIAAALSL
Sbjct  8    DKTLLSICYKRGSLQLLDQRKLPLETIFLDIQDTKDGWDAIKEMVVRGAPAIAIAAALSL  67

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SNL +F+GT+ DA  FLS+KL+YLVSSRPTAVNLSDAA KL EVI K A+TA +A 
Sbjct  68   AVEVSNLSSFDGTSDDASDFLSKKLDYLVSSRPTAVNLSDAAVKLKEVIKKAATTAKDAN  127

Query  641  TI  646
            ++
Sbjct  128  SV  129



>ref|XP_006452823.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66063.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=358

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            +  +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIAIAAALS
Sbjct  9    DSNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAIAAALS  68

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            LAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASEA
Sbjct  69   LAVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEA  128

Query  638  KTI  646
             ++
Sbjct  129  NSV  131



>gb|ACU24114.1| unknown [Glycine max]
Length=213

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAICYKRGSLQLLDQRKLPL+T+YL+I+++ DGW+AI+EMVVRGAPAIAIAAALSLAV
Sbjct  12   TLQAICYKRGSLQLLDQRKLPLETVYLEIRDSTDGWNAIREMVVRGAPAIAIAAALSLAV  71

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NL+ FNG+A DAVS L +KLEYLV+SRPTAVNLSDAATKL EVI+  A+T SE +++
Sbjct  72   EVFNLD-FNGSATDAVSLLQKKLEYLVTSRPTAVNLSDAATKLKEVISNAAATTSEGRSV  130



>ref|XP_006452822.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66062.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=373

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            +  +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIAIAAALS
Sbjct  9    DSNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAIAAALS  68

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            LAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASEA
Sbjct  69   LAVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEA  128

Query  638  KTI  646
             ++
Sbjct  129  NSV  131



>gb|KHG04432.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=385

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI+EMVVRGAPAIAIAAALSL
Sbjct  15   DNTLQAICYKRGSLQLLDQRKLPLETVYLDIHGSADGWNAIREMVVRGAPAIAIAAALSL  74

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75   AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  641  TI  646
            ++
Sbjct  135  SV  136



>gb|KJB82982.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=278

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15   DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75   AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  641  TI  646
            ++
Sbjct  135  SV  136



>ref|XP_006346696.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Solanum 
tuberosum]
Length=374

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            DKTL+AICY+RGSLQLLDQRKLPL+T+YLDI +  D WDAIKEMVVRGAPAIAIAAALSL
Sbjct  8    DKTLEAICYRRGSLQLLDQRKLPLETLYLDIHDTNDAWDAIKEMVVRGAPAIAIAAALSL  67

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SNL +F+GT+ DA  FLS+KL++LVSSRPTAVNLSDAA KL EVI+K A+TA E  
Sbjct  68   AVEISNLASFDGTSHDASVFLSKKLDFLVSSRPTAVNLSDAAVKLKEVISKAAATAKETN  127

Query  641  TI  646
            ++
Sbjct  128  SV  129



>ref|XP_010047466.1| PREDICTED: methylthioribose-1-phosphate isomerase [Eucalyptus 
grandis]
Length=380

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = +2

Query  260  ANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaia  439
            +NG  + D +LQ+ICY+RGSL+LLDQRKLPL+T+YLDIK+A DGW AIK+MVVRGAPAIA
Sbjct  8    SNGGGA-DASLQSICYERGSLRLLDQRKLPLETVYLDIKDATDGWHAIKDMVVRGAPAIA  66

Query  440  iaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            IAAALSLAVE  +L+ F+GTA +A SFL  KL+YLVSSRPTAVNLSDAATKL EVI+  A
Sbjct  67   IAAALSLAVEVYHLDAFSGTAVEAASFLIGKLDYLVSSRPTAVNLSDAATKLKEVISDAA  126

Query  620  STASEAKTI  646
            +TASEAK+I
Sbjct  127  ATASEAKSI  135



>gb|KHN12290.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=372

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 1/120 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAICYKRGSLQLLDQRKLPL+T+YL+I+++ DGW+AI+EMVVRGAPAIAIAAALSLAV
Sbjct  12   TLQAICYKRGSLQLLDQRKLPLETVYLEIRDSTDGWNAIREMVVRGAPAIAIAAALSLAV  71

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NL+ FNG+A DAVS L +KLEYLV+SRPTAVNLSDAATKL EVI+  A+T SE +++
Sbjct  72   EVFNLD-FNGSATDAVSLLQKKLEYLVTSRPTAVNLSDAATKLKEVISNAAATTSEGRSV  130



>gb|KJB82984.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=367

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15   DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75   AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  641  TI  646
            ++
Sbjct  135  SV  136



>gb|KCW79381.1| hypothetical protein EUGRSUZ_C00793 [Eucalyptus grandis]
Length=461

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = +2

Query  260  ANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaia  439
            +NG    D +LQ+ICY+RGSL+LLDQRKLPL+T+YLDIK+A DGW AIK+MVVRGAPAIA
Sbjct  89   SNGG-GADASLQSICYERGSLRLLDQRKLPLETVYLDIKDATDGWHAIKDMVVRGAPAIA  147

Query  440  iaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            IAAALSLAVE  +L+ F+GTA +A SFL  KL+YLVSSRPTAVNLSDAATKL EVI+  A
Sbjct  148  IAAALSLAVEVYHLDAFSGTAVEAASFLIGKLDYLVSSRPTAVNLSDAATKLKEVISDAA  207

Query  620  STASEAKTI  646
            +TASEAK+I
Sbjct  208  ATASEAKSI  216



>gb|KJB82981.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=385

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15   DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75   AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  641  TI  646
            ++
Sbjct  135  SV  136



>ref|XP_011019339.1| PREDICTED: methylthioribose-1-phosphate isomerase [Populus euphratica]
Length=380

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQ+ICY RGSLQLLDQRKLPL+T YLDIK+  DGW AI+EMVVRGAPAIAI+AALSL
Sbjct  12   DNTLQSICYHRGSLQLLDQRKLPLETTYLDIKDTSDGWLAIREMVVRGAPAIAISAALSL  71

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SNLE F+GT  +A SFL+ KL+YLVSSRPTAVNLSDAATKL EV++K A+ AS+ +
Sbjct  72   AVEVSNLENFSGTPVEAASFLAGKLDYLVSSRPTAVNLSDAATKLKEVVSKAAAVASDCQ  131

Query  641  TI  646
            ++
Sbjct  132  SV  133



>ref|XP_007012613.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY30232.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
Length=424

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQ+ICYK GSLQLLDQRKLPL+T+YLDI++A DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  57   DNTLQSICYKCGSLQLLDQRKLPLETVYLDIQDATDGWNAIRDMVVRGAPAIAIAAALSL  116

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
            AVE +NL+ FNGT +DA SFL  KLEYLVSSRPTAVNLSDAATKL ++I+K A+TA+
Sbjct  117  AVEVANLKDFNGTCEDAASFLEMKLEYLVSSRPTAVNLSDAATKLRKIISKAATTAT  173



>ref|XP_004244859.1| PREDICTED: methylthioribose-1-phosphate isomerase [Solanum lycopersicum]
Length=374

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            DKTL+AICY+RGSLQLLDQRKLPL+T++LDI +  D WDAIKEMVVRGAPAIAIAAALSL
Sbjct  8    DKTLEAICYRRGSLQLLDQRKLPLETLHLDIHDTNDAWDAIKEMVVRGAPAIAIAAALSL  67

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SNL +F+GT+ DA  FLS+KL++LVSSRPTAVNLSD+A KL EVI+K A+ A EA 
Sbjct  68   AVEVSNLASFDGTSHDASVFLSKKLDFLVSSRPTAVNLSDSAVKLKEVISKAAAIAKEAN  127

Query  641  TI  646
            ++
Sbjct  128  SV  129



>ref|XP_007012614.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY30233.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
Length=458

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQ+ICYK GSLQLLDQRKLPL+T+YLDI++A DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  57   DNTLQSICYKCGSLQLLDQRKLPLETVYLDIQDATDGWNAIRDMVVRGAPAIAIAAALSL  116

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
            AVE +NL+ FNGT +DA SFL  KLEYLVSSRPTAVNLSDAATKL ++I+K A+TA+
Sbjct  117  AVEVANLKDFNGTCEDAASFLEMKLEYLVSSRPTAVNLSDAATKLRKIISKAATTAT  173



>gb|AAM65143.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
Length=374

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIA ALSL
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIATALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA KL  VI K  +TA+EAK
Sbjct  66   AVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAK  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_002516257.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
 sp|B9RR88.1|MTNA_RICCO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ricinus 
communis]
 gb|EEF46259.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
Length=382

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 110/135 (81%), Gaps = 5/135 (4%)
 Frame = +2

Query  257  MANGAHSE-----DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVR  421
            MAN ++S      D TLQ+ICY RGSL+LLDQRKLPL+T +LDI+N+ DGW AI+EMVVR
Sbjct  1    MANNSNSGSELEVDDTLQSICYNRGSLKLLDQRKLPLETEFLDIRNSSDGWSAIREMVVR  60

Query  422  GapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE  601
            GAPAIAIAAALSLAVE  N + F GT+ DA SFL +KLEYLVSSRPTAVNLSDAA KL E
Sbjct  61   GAPAIAIAAALSLAVEVFNFDDFTGTSNDAASFLFKKLEYLVSSRPTAVNLSDAANKLKE  120

Query  602  VITKEASTASEAKTI  646
            VI K A+TAS++ ++
Sbjct  121  VIYKAAATASDSNSV  135



>ref|XP_010261799.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nelumbo nucifera]
Length=377

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            S + +LQ+ICYKRGSL+LLDQR+LPL+TIYLD+++  DGW+AI++MVVRGAPAIAIAAAL
Sbjct  12   SNESSLQSICYKRGSLRLLDQRRLPLETIYLDVRDVTDGWNAIRDMVVRGAPAIAIAAAL  71

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  NLE+F GT+ DA SFL +KLEYLVSSRPTAVNL DAATKL +VI   AST  E
Sbjct  72   SLAVEVFNLESFVGTSGDAASFLIKKLEYLVSSRPTAVNLYDAATKLKDVILNAASTTGE  131

Query  635  AKTI  646
            A++I
Sbjct  132  ARSI  135



>gb|KDP33930.1| hypothetical protein JCGZ_07501 [Jatropha curcas]
Length=382

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQ+ICYKRGSL LLDQRKLPL+T YL I +A DGW AI+EMVVRGAPAIAIAAALSLAV
Sbjct  16   TLQSICYKRGSLHLLDQRKLPLETEYLVIGDASDGWSAIREMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NL+ FNGT+ DA SFL QKL+YLVSSRPTAVNLSDAATKL EVI+K A+  SE+K +
Sbjct  76   EVFNLQDFNGTSDDAGSFLFQKLDYLVSSRPTAVNLSDAATKLKEVISKTAAATSESKAV  135



>ref|NP_027726.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9ZUG4.2|MTNA_ARATH RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arabidopsis 
thaliana]
 gb|AAC95160.2| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05975.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=374

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA KL  VI K  +TA+EAK
Sbjct  66   AVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAK  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_002308521.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
 sp|B9HCR2.2|MTNA_POPTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Populus 
trichocarpa]
 gb|EEE92044.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
Length=375

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TLQ+ICY RGSL+LLDQRKLPL+T YLDIK+A DGW AI+EMVVRGAPAIAI+AALSL
Sbjct  12   DNTLQSICYHRGSLKLLDQRKLPLETTYLDIKDASDGWLAIREMVVRGAPAIAISAALSL  71

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SNLE FNGT  +A SFL+ KL+YLVSSRPTAVNLSDAATKL EV++K A+ AS  +
Sbjct  72   AVEVSNLENFNGTPVEAASFLAGKLDYLVSSRPTAVNLSDAATKLKEVVSKAAAAASNCQ  131

Query  641  TI  646
            ++
Sbjct  132  SV  133



>gb|EYU28322.1| hypothetical protein MIMGU_mgv1a008441mg [Erythranthe guttata]
Length=374

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+ICY RGSL+LLDQRKLPL+TIYLDI ++KDGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  10   SLQSICYTRGSLKLLDQRKLPLETIYLDIADSKDGWVAIKDMVVRGAPAIAIAAALSLAV  69

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E SNL  F+G  +DA SFLS KL+YLVSSRPTAVNLSDAATKL EV+ K A+ +SEA+ +
Sbjct  70   EVSNLGAFSGMPKDAASFLSDKLDYLVSSRPTAVNLSDAATKLKEVVHKAAAASSEAQNV  129



>ref|XP_002277806.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 ref|XP_010656105.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 sp|D7TCD0.2|MTNA_VITVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Vitis 
vinifera]
Length=376

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA+       +LQ+ICYKRGSLQLLDQRKLPL+T+YL+IK A DGW AI++MVVRGAPAI
Sbjct  1    MADSNSKHQDSLQSICYKRGSLQLLDQRKLPLETVYLEIKGADDGWHAIRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNLE F GT+ DA SFL+ KL+YLV+SRPTAVNLSDA TKL  VI+  
Sbjct  61   AIAAALSLAVEVSNLEDFIGTSDDAASFLNSKLDYLVTSRPTAVNLSDAVTKLKGVISNA  120

Query  617  ASTASEAKTI  646
            A+TA EA ++
Sbjct  121  AATAFEAMSV  130



>emb|CBI27788.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA+       +LQ+ICYKRGSLQLLDQRKLPL+T+YL+IK A DGW AI++MVVRGAPAI
Sbjct  43   MADSNSKHQDSLQSICYKRGSLQLLDQRKLPLETVYLEIKGADDGWHAIRDMVVRGAPAI  102

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNLE F GT+ DA SFL+ KL+YLV+SRPTAVNLSDA TKL  VI+  
Sbjct  103  AIAAALSLAVEVSNLEDFIGTSDDAASFLNSKLDYLVTSRPTAVNLSDAVTKLKGVISNA  162

Query  617  ASTASEAKTI  646
            A+TA EA ++
Sbjct  163  AATAFEAMSV  172



>ref|XP_007138649.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
 gb|ESW10643.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
Length=373

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQ+I Y RGSL LLDQRKLPL+T YL+I+++ DGW+AI++MVVRGAPAIAIAAALSLAV
Sbjct  12   TLQSIRYTRGSLHLLDQRKLPLETTYLEIRDSTDGWNAIRDMVVRGAPAIAIAAALSLAV  71

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NL+ FNG+A +AVSFL  KLEYLVSSRPTAVNLSDAATKL EV++  A+TASE +++
Sbjct  72   EVFNLDGFNGSAGEAVSFLQNKLEYLVSSRPTAVNLSDAATKLKEVVSNAAATASEGRSV  131



>emb|CDP03069.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI YKRGSLQLLDQRKLPL+TIYLDI++  DGW AI++MVVRGAPAIAIAAALSLAV
Sbjct  10   SLQAILYKRGSLQLLDQRKLPLETIYLDIQDTNDGWVAIRDMVVRGAPAIAIAAALSLAV  69

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            E SNL+ F+GT+ DA SFL +KLEYLVSSRPTAVNLSDAA+KL EV++K ASTA +
Sbjct  70   EVSNLKDFSGTSDDAASFLGKKLEYLVSSRPTAVNLSDAASKLKEVVSKAASTAKD  125



>ref|XP_008786516.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Phoenix dactylifera]
Length=376

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA  ++ +  +LQ+ICY+RGSL+LLDQR+LP++T+YLD+++A DGW+A+++MVVRGAPAI
Sbjct  1    MAVESNGKSDSLQSICYERGSLRLLDQRRLPIETVYLDVRDATDGWNAVRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE  NL+ F GT+ DA SFL +KLEYLVSSRPTAVNLSDA+TKL  ++ K 
Sbjct  61   AIAAALSLAVEVFNLD-FTGTSGDAASFLVKKLEYLVSSRPTAVNLSDASTKLQNIVLKT  119

Query  617  ASTASEAKTI  646
            A TA+EAKT+
Sbjct  120  AKTATEAKTV  129



>ref|XP_010930603.1| PREDICTED: methylthioribose-1-phosphate isomerase [Elaeis guineensis]
Length=376

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA  ++ +  +LQ+ICY+RGSL+LLDQR+LP +T+YLD+++A DGW+AI++MVVRGAPAI
Sbjct  1    MAVESNGKSDSLQSICYERGSLRLLDQRRLPRETVYLDVRDATDGWNAIRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE  NL+ F GT+ DA SFL +KLEYLVSSRPTAVNLSDA+TKL  +++K 
Sbjct  61   AIAAALSLAVEVFNLD-FAGTSGDAASFLVKKLEYLVSSRPTAVNLSDASTKLQNIVSKT  119

Query  617  ASTASEAKTI  646
            A TA+EAKT+
Sbjct  120  AKTATEAKTV  129



>ref|XP_008242258.1| PREDICTED: methylthioribose-1-phosphate isomerase [Prunus mume]
Length=382

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+ICYKRGSLQLLDQRKLPLQT YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+  S+AK +
Sbjct  76   EVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLRQIASTVAAATSDAKNV  135



>ref|XP_008450940.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis melo]
Length=381

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D +LQ+ICYKRGSL+LLDQRKLPL+T+YLDIK+A DGW AI++MVVRGAPAIAI+AAL+L
Sbjct  14   DNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVRGAPAIAISAALAL  73

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            A E  N   FNGT  DA S ++ KL+YLVSSRPTAVNL DAA KL E+++  A+ +SEA+
Sbjct  74   AAEVYNSAPFNGTPNDAASLIADKLDYLVSSRPTAVNLGDAAIKLKEIVSGAAAISSEAR  133

Query  641  TI  646
            ++
Sbjct  134  SV  135



>gb|AES65569.2| methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=372

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA+   +    LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1    MASSDSNATNMLQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61   AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  617  ASTASEAKTI  646
            A+T SEAK +
Sbjct  121  AATTSEAKGV  130



>ref|XP_003595318.1| Methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=382

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA+   +    LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1    MASSDSNATNMLQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61   AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  617  ASTASEAKTI  646
            A+T SEAK +
Sbjct  121  AATTSEAKGV  130



>ref|XP_007202151.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
 gb|EMJ03350.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
Length=382

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+ICYKRGSLQLLDQRKLPLQT YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDA+ KL ++ +  A+  S+AK +
Sbjct  76   EVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDASAKLRQIASTVAAATSDAKNV  135



>ref|XP_002883712.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59971.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=369

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE      F+G+A DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  + A+E K
Sbjct  66   AVEVFTFNGFDGSAADAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALAIATEPK  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_009337200.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=378

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  12   SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  71

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ ++ A+T S+A+ +
Sbjct  72   EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASEVATTTSDARKV  131



>ref|XP_011078119.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sesamum indicum]
Length=374

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MANG    DK+LQ+I Y RGSL LLDQRKLPL+T+YLDIK++KDGW AIKEMVVRGAPAI
Sbjct  1    MANGVEL-DKSLQSIRYNRGSLWLLDQRKLPLETVYLDIKDSKDGWVAIKEMVVRGAPAI  59

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            AIAAALSLAVE SNL  F+GT  DA SF+S K +YLVSSRPTAVNLSDAATKL EV+ K
Sbjct  60   AIAAALSLAVEVSNLGVFSGTPNDAASFISNKFDYLVSSRPTAVNLSDAATKLKEVVQK  118



>ref|XP_010541997.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Tarenaya hassleriana]
Length=367

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            DK LQ+ICYKRGSL+LLDQRKLPL+T YLDI  A+DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  7    DKVLQSICYKRGSLKLLDQRKLPLETTYLDILGAEDGWNAIRDMVVRGAPAIAIAAALSL  66

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N+++F+GT++DA +FL ++L+ LVSSRPTAVNL+DAA KL EVI+   + ASE K
Sbjct  67   AVEVFNMDSFDGTSEDAAAFLRKQLDCLVSSRPTAVNLADAAVKLKEVISGAMAAASEPK  126

Query  641  TI  646
            ++
Sbjct  127  SV  128



>ref|XP_008337840.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+T S+A+ +
Sbjct  76   EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASAVATTTSDARNV  135



>gb|AFK48892.1| unknown [Medicago truncatula]
Length=304

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            MA+   +    LQ I Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1    MASSDSNATNMLQTIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  437  aiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61   AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  617  ASTASEAKTI  646
            A+T SEA+ +
Sbjct  121  AATTSEARGV  130



>ref|XP_009359722.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=382

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+  S+A+ +
Sbjct  76   EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASAVATNTSDARNV  135



>ref|XP_006396132.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36911.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=341

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL++ICYKRGSLQLLDQRKLPL+T YL+I+N+ DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKSICYKRGSLQLLDQRKLPLETTYLEIRNSVDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  637
            AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  A+T  E 
Sbjct  66   AVEVFNFNGFDGSSTDAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALATTTIEP  125

Query  638  KTI  646
            K+I
Sbjct  126  KSI  128



>ref|XP_008388900.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ ++ A+T  +A  +
Sbjct  76   EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASEVATTTXDASKV  135



>ref|XP_006396133.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36912.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=372

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL++ICYKRGSLQLLDQRKLPL+T YL+I+N+ DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKSICYKRGSLQLLDQRKLPLETTYLEIRNSVDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  637
            AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  A+T  E 
Sbjct  66   AVEVFNFNGFDGSSTDAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALATTTIEP  125

Query  638  KTI  646
            K+I
Sbjct  126  KSI  128



>ref|XP_009406483.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 109/133 (82%), Gaps = 5/133 (4%)
 Frame = +2

Query  260  ANG----AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa  427
            ANG    A +   +LQ+ICY+RGSL+LLDQRKLPL+T+YLD+K++ DGW AI++MVVRGA
Sbjct  5    ANGSSAAATTAGGSLQSICYERGSLRLLDQRKLPLETVYLDVKDSTDGWTAIRDMVVRGA  64

Query  428  paiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            PAIAIAAALSLAVE  NL+ FNGT++DA S L +KLEYLVSSRPTAVNLSDA  KL  ++
Sbjct  65   PAIAIAAALSLAVEVWNLD-FNGTSEDASSLLIKKLEYLVSSRPTAVNLSDAVEKLRSLV  123

Query  608  TKEASTASEAKTI  646
             K   TA+EAKT+
Sbjct  124  LKTVETATEAKTV  136



>gb|KGN66312.1| hypothetical protein Csa_1G597100 [Cucumis sativus]
Length=381

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D +LQ+ICYKRGSL+LLDQRKLPL+T+YLDIK+A DGW AI++MVVRGAPAIAI+AAL+L
Sbjct  14   DNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVRGAPAIAISAALAL  73

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            A E +N   FNGT  DA SF++ KL+YLVSSRPTAVNL DAA KL E++
Sbjct  74   AAEVNNSAPFNGTPNDAASFIADKLDYLVSSRPTAVNLGDAAIKLKEIV  122



>ref|XP_004144039.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cucumis 
sativus]
Length=395

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D +LQ+ICYKRGSL+LLDQRKLPL+T+YLDIK+A DGW AI++MVVRGAPAIAI+AAL+L
Sbjct  28   DNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVRGAPAIAISAALAL  87

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            A E +N   FNGT  DA SF++ KL+YLVSSRPTAVNL DAA KL E++
Sbjct  88   AAEVNNSAPFNGTPNDAASFIADKLDYLVSSRPTAVNLGDAAIKLKEIV  136



>gb|KFK39882.1| hypothetical protein AALP_AA3G300900 [Arabis alpina]
Length=374

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL++ICYK GSLQLLDQRKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDTADGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE SN   F+G++ DAV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    +TA E K
Sbjct  66   AVEVSNFNAFDGSSADAVAFLQNKLDYLVSSRPTAVNLADAALKLKQVIANALATAIEPK  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_004488081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cicer 
arietinum]
Length=372

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  11   LQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAIAIAAALALAVE  70

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             SNL+ F+G+  DA  FL +KLEYLV+SRPTAVNLSDAATKL E+I+  A+T SEA+ +
Sbjct  71   VSNLDDFSGSTDDAAYFLHKKLEYLVTSRPTAVNLSDAATKLKEIISMAAATTSEARGV  129



>ref|XP_010467106.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelina sativa]
Length=374

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66   AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_010412762.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=369

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66   AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_010488779.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=374

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6    DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
            AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66   AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  641  TI  646
            +I
Sbjct  126  SI  127



>ref|XP_004287647.1| PREDICTED: methylthioribose-1-phosphate isomerase [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y RGSLQLLDQ KLPL + YL+I+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16   SLQAIRYNRGSLQLLDQTKLPLHSTYLNIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  NL  FNGT  +A SF+  KLEYLVSSRPTAVNLSDAATKL +++ K A++ASE K++
Sbjct  76   EVFNLGDFNGTPDEASSFIIMKLEYLVSSRPTAVNLSDAATKLKQIVAKVAASASEYKSV  135



>gb|ACL54299.1| unknown [Zea mays]
Length=166

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+I
Sbjct  67   VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSI  124



>ref|XP_009102357.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brassica rapa]
Length=372

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL++ICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDAADGWSAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  637
            AVE SN   F+G++ +AV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    AS+A+E 
Sbjct  66   AVEVSNFSGFDGSSAEAVAFLENKLDYLVSSRPTAVNLADAALKLKQVIANALASSAAEP  125

Query  638  KTI  646
             +I
Sbjct  126  NSI  128



>ref|XP_006280656.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
 gb|EOA13554.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
Length=370

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D TL++ICYK GSLQLLDQRKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6    DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDTADGWKAIQEMVVRGAPAIAIAAALSL  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  637
            AVE  N   F+G++ DAV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    A+TA E 
Sbjct  66   AVEVFNFNGFDGSSTDAVAFLDNKLDYLVSSRPTAVNLADAAVKLKQVIKNALATTAIEP  125

Query  638  KTI  646
            K+I
Sbjct  126  KSI  128



>ref|XP_003577698.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brachypodium 
distachyon]
Length=368

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAALSLAVE
Sbjct  8    LQSILYDRGSLRLLDQRKLPLEEVYIDVKDSTDGWNAIRDMVVRGAPAIAIAAALSLAVE  67

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
              N + F GT+++A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++ + A TA +AK+I
Sbjct  68   VFN-QDFIGTSEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVLRTAETAKDAKSI  125



>sp|A2ZCP0.1|MTNA_ORYSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Oryza 
sativa Indica Group]
 gb|EAY80374.1| hypothetical protein OsI_35550 [Oryza sativa Indica Group]
Length=374

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S LE F GT  +A +F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +AK I
Sbjct  67   VSGLEDFTGTPAEAAAFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETEKDAKAI  125



>emb|CDY33397.1| BnaA07g04420D [Brassica napus]
Length=373

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQ-RKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            D TL++ICYK GSLQLLDQ RKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAALS
Sbjct  6    DTTLKSICYKPGSLQLLDQQRKLPLETTYLEIRDAADGWSAIQEMVVRGAPAIAIAAALS  65

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASE  634
            LAVE SN   F+G++ +AV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    AS+A+E
Sbjct  66   LAVEVSNFSGFDGSSAEAVTFLENKLDYLVSSRPTAVNLADAALKLKQVIANALASSAAE  125

Query  635  AKTI  646
              +I
Sbjct  126  PNSI  129



>gb|EMS50123.1| Methylthioribose-1-phosphate isomerase [Triticum urartu]
Length=367

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL
Sbjct  2    GESSALQSILYDRGALRLLDQRKLPLEEVYIDVKDSADGWNAIRDMVVRGAPAIAIAAAL  61

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A TA +
Sbjct  62   SLAVEV-NDHDFTGTPVEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSRTAETAKD  120

Query  635  AKTI  646
            AK+I
Sbjct  121  AKSI  124



>ref|NP_001105275.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AAU86895.1| isopentenyl-diphosphate delta isomerase 2 [Zea mays]
Length=367

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+I
Sbjct  67   VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSI  124



>gb|ACG37871.1| methylthioribose-1-phosphate isomerase [Zea mays]
Length=367

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+I
Sbjct  67   VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSI  124



>sp|B6TZD1.1|MTNA_MAIZE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=ZmIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Zea mays]
 gb|ACG42464.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AFW60581.1| methylthioribose-1-phosphate isomerase isoform 1 [Zea mays]
 gb|AFW60582.1| methylthioribose-1-phosphate isomerase isoform 2 [Zea mays]
Length=367

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+I
Sbjct  67   VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSI  124



>ref|NP_001067511.1| Os11g0216900 [Oryza sativa Japonica Group]
 sp|Q0ITU1.1|MTNA_ORYSJ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=OsIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF27874.1| Os11g0216900 [Oryza sativa Japonica Group]
 tpd|FAA00313.1| TPA: eukaryotic translation initiation factor 2B-like putative 
methylthioribose-1-phosphate isomerase [Oryza sativa Japonica 
Group]
 gb|EEE51856.1| hypothetical protein OsJ_33377 [Oryza sativa Japonica Group]
Length=374

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S LE F GT  +A  F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +AK I
Sbjct  67   VSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETEKDAKAI  125



>ref|XP_004979099.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Setaria 
italica]
Length=367

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 1/119 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7    LQSIVYARGSLRLLDQRKLPLEVDYIDVKDSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
             S L+ F GT   A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA +AK I
Sbjct  67   VSGLD-FTGTPAGAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKTAETAKDAKAI  124



>gb|ABA92066.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA92067.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=508

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            A  E   LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAA
Sbjct  134  AMGELGALQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAA  193

Query  449  alslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
            AL+LAVE S LE F GT  +A  F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T 
Sbjct  194  ALALAVEVSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETE  253

Query  629  SEAKTI  646
             +AK I
Sbjct  254  KDAKAI  259



>sp|Q9AYT7.1|MTNA_HORVU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=HvIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Hordeum vulgare]
 dbj|BAB21393.1| IDI2 [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL
Sbjct  2    GESSALQSILYGRGALRLLDQRKLPLEEVYVDVKDSADGWNAIRDMVVRGAPAIAIAAAL  61

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++  A TA +
Sbjct  62   SLAVEV-NDHNFIGTPAEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSTTAETAKD  120

Query  635  AKTI  646
            AK+I
Sbjct  121  AKSI  124



>dbj|BAJ86257.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL
Sbjct  2    GESSALQSILYGRGALRLLDQRKLPLEEVYVDVKDSADGWNAIRDMVVRGAPAIAIAAAL  61

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            SLAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++  A TA +
Sbjct  62   SLAVEV-NDHNFIGTPAEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSTTAETAKD  120

Query  635  AKTI  646
            AK+I
Sbjct  121  AKSI  124



>ref|XP_006662829.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oryza 
brachyantha]
Length=367

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
             E   LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL
Sbjct  2    GESCALQSIVYHRGSLRLLDQRKLPLEVAYIDVKCSTDGWNAIRDMVVRGAPAIAIAAAL  61

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            +LAVE S L+ F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +
Sbjct  62   ALAVEVSGLD-FTGTPAEAASFVSEKLEYLVSSRPTAVNLSDAATKLQSLVSRTAETEKD  120

Query  635  AKTI  646
            AK I
Sbjct  121  AKAI  124



>gb|EPS64192.1| methylthioribose-1-phosphate isomerase, partial [Genlisea aurea]
Length=341

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            K+LQ+I Y RGSLQLLDQRKLPL+TIYLDIKN++ GW AIK+MVVRGAPAIAIAAALSLA
Sbjct  1    KSLQSIRYSRGSLQLLDQRKLPLETIYLDIKNSEAGWIAIKDMVVRGAPAIAIAAALSLA  60

Query  464  veasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            VE SN+E F G  +DA  F+S KL+YLV+SRPTAVNLSDAA KL +V+
Sbjct  61   VEVSNMEDFIGDPEDAALFISNKLDYLVTSRPTAVNLSDAAEKLKKVV  108



>emb|CDY70356.1| BnaCnng67980D [Brassica napus]
Length=373

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQ-RKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            D TL++ICYK GSLQLLDQ RKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALS
Sbjct  6    DTTLKSICYKPGSLQLLDQQRKLPLETTYLEIRDTADGWSAIQEMVVRGAPAIAIAAALS  65

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASE  634
            LAVE SN   F+G++ +AV+FL +KL+YLVSSRPTAVNL+DA+ KL +VI    AS+A+E
Sbjct  66   LAVEVSNFSGFDGSSAEAVAFLEKKLDYLVSSRPTAVNLADASLKLKQVIANALASSAAE  125

Query  635  AKTI  646
              +I
Sbjct  126  PNSI  129



>ref|XP_006842716.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
 gb|ERN04391.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
Length=372

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            E+ +LQ+I Y  G L+LLDQ++LP +++YLDI N + GW AIK++VVRGAPAIAI+AALS
Sbjct  12   EEGSLQSIRYSPGRLELLDQQRLPHESVYLDINNTESGWIAIKDLVVRGAPAIAISAALS  71

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            LAVE SNL++F+GT+ DA SFL +KLEYLVSSRPTAVNLSDAAT+L E++ K A+
Sbjct  72   LAVEVSNLKSFDGTSTDAASFLVKKLEYLVSSRPTAVNLSDAATRLKEIVLKAAT  126



>gb|ADE77025.1| unknown [Picea sitchensis]
Length=384

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  272  HSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  451
            + E+ TLQ+I Y RG LQLLDQRKLP  ++Y+DI+++  GW AI +MVVRGAPAIAI+AA
Sbjct  8    NGEENTLQSIRYSRGRLQLLDQRKLPHDSVYIDIQDSTAGWHAIHDMVVRGAPAIAISAA  67

Query  452  lslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
            LSLAVE +NL + + +  DA+SFL ++LE+LVSSRPTAVNLSDAATKLN+V+ K  +  S
Sbjct  68   LSLAVEVANLGSVDWSVNDAISFLQKRLEFLVSSRPTAVNLSDAATKLNDVVLKATNDMS  127

Query  632  EAKTI  646
            + + I
Sbjct  128  KPEAI  132



>ref|XP_001754539.1| predicted protein [Physcomitrella patens]
 gb|EDQ80509.1| predicted protein, partial [Physcomitrella patens]
Length=362

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L AI Y+RGSLQLLDQRKLP ++IY DIK+A  GW AI +MVVRGAPAIAIAAAL+LAVE
Sbjct  1    LLAIRYRRGSLQLLDQRKLPYESIYSDIKDAVAGWAAISDMVVRGAPAIAIAAALALAVE  60

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
              +L+ F+G   +AV+FL  +L+YLVSSRPTAVNL++AAT L  +    A    +A+ +
Sbjct  61   VESLKPFSGAGLEAVAFLKNRLDYLVSSRPTAVNLAEAATNLLNICQAVADKGDDAEAV  119



>ref|XP_002992382.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
 gb|EFJ06532.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
Length=368

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D  L+AI Y RGSL+LLDQR+LP + +YLD+ ++  GW AIK+MVVRGAPAIAIAAALSL
Sbjct  4    DGALRAIVYNRGSLRLLDQRELPFKIVYLDVNDSGTGWKAIKDMVVRGAPAIAIAAALSL  63

Query  461  aveasNLETFN-GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
            AVE  NL      T QDA+  L ++L+YLVSSRPTAVNL+DAA KL +V +  AST
Sbjct  64   AVEVHNLRPGKVTTPQDALLLLQKRLDYLVSSRPTAVNLADAAEKLKKVASVAAST  119



>gb|KFK23167.1| hypothetical protein AALP_AAs73675U000500 [Arabis alpina]
Length=132

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 7/119 (6%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
            E  TL++ICYK GSL LLDQRKL L+T YL+I++  D W AI+EMVVRGAPAIAIAA LS
Sbjct  5    EYTTLKSICYKPGSLHLLDQRKLLLETTYLEIRDTVDRWSAIQEMVVRGAPAIAIAATLS  64

Query  458  laveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            LAV   N+  F+G++ D V+FL        ++RPTAVNL+DAA KL  VI     TA+E
Sbjct  65   LAVAVFNVNAFHGSSADDVAFLQ-------NNRPTAVNLADAALKLKHVIANTLVTATE  116



>ref|XP_002967758.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
 gb|EFJ31105.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
Length=368

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D  L+AI Y RGSL+LLDQR+LP + +YLD+ ++  GW AIK+MVVRGAPAIAIAAALSL
Sbjct  4    DGALRAIIYNRGSLRLLDQRELPFKIVYLDVNDSGTGWKAIKDMVVRGAPAIAIAAALSL  63

Query  461  aveasNLETFN-GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
            AVE  NL      T QDA   L ++L+YLVSSRPTAVNL+DAA KL  V +  AST
Sbjct  64   AVEVHNLRPGEVTTPQDAHLLLRKRLDYLVSSRPTAVNLADAAEKLKRVASVAAST  119



>gb|KJB82983.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=345

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  359  IYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLE  538
            +YLDI  + DGW+AI++MVVRGAPAIAIAAALSLAVE +NL+ FNG ++DA SFL  KLE
Sbjct  1    MYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSLAVEVANLKDFNGGSKDAASFLESKLE  60

Query  539  YLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            YLVSSRPTAVNLSDAA KL E+I+K AST +  +++
Sbjct  61   YLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPESV  96



>gb|EMF09885.1| methylthioribose-1-phosphate isomerase [Sphaerulina musiva SO2202]
Length=389

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+ GSLQ+L+Q KLP Q  Y +IK+A+DGW AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIRYQPGSLQILNQLKLPHQEEYDEIKSAEDGWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             +N+ T +  A++  +F+ +KLEYLV+SRPTAVNL+DAA KL +++T  A
Sbjct  63   LTNM-TSSEKAEEVAAFIVEKLEYLVTSRPTAVNLADAAGKLKKIVTSAA  111



>gb|EPS29452.1| hypothetical protein PDE_04401 [Penicillium oxalicum 114-2]
Length=385

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 3/114 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y +G L++LDQ +LP    Y+ I+ A+DGW+AIK+M VRGAPAIAI A L+LA E
Sbjct  2    LQAIKYDQGHLEILDQLQLPFVEKYIPIQTAEDGWNAIKDMKVRGAPAIAIVAMLALASE  61

Query  470  asNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
               L++ +    + Q+A + ++QKLEYLV+SRPTAVNL+DAA KL  V+T +A 
Sbjct  62   LHALQSADKIPDSPQEAETLIAQKLEYLVTSRPTAVNLADAARKLGAVVTTQAG  115



>gb|EYE93514.1| Methylthioribose-1-phosphate isomerase [Aspergillus ruber CBS 
135680]
Length=380

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ KLP    Y+ I+ A++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIRYTNGDLTIIDQLKLPFVEEYIPIRTAEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            E   L   +  +  A++   F+ +KL YLV+SRPTAVNLSDAA KL  ++T+ ASTA  A
Sbjct  62   EVHQLVNNKKLSAAAEEVRIFIVEKLHYLVTSRPTAVNLSDAAHKLEVLVTERASTAGSA  121



>ref|XP_007780227.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
 gb|EON64910.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
Length=395

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 6/122 (5%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RGSLQ+LDQ KLP   +Y DI+ + D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYTRGSLQILDQLKLPHAEVYDDIRTSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  470  asNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI---TKEASTAS  631
              N+ T    +   ++   F+ +KLEYLV+SRPTAVNL+DAA KL + +    K+ S + 
Sbjct  63   LENIATKGELSQFGEEVKVFIEEKLEYLVTSRPTAVNLADAARKLKKAVEEAAKDDSVSG  122

Query  632  EA  637
            EA
Sbjct  123  EA  124



>gb|AGT02428.1| S-methyl-5-thioribose-1-phosphate isomerase [Strigomonas culicis]
Length=369

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            AH   KTL++I Y++GSLQLLDQRKLPL++++ D++  +D W AIKEM VRGAPAIA++A
Sbjct  2    AHPHKKTLESIKYEKGSLQLLDQRKLPLESVFDDVRTVEDIWTAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            AL +A+ A+N +       A  AV FL +  +Y+++SRPTAVNL +  +++ E + + + 
Sbjct  62   ALGIAIAAANKQKAGEFADASAAVQFLLESCDYVMTSRPTAVNLFNCLSQVKEQVRRLSE  121

Query  623  TASEAKTI  646
            TA+  + +
Sbjct  122  TAATVEAV  129



>ref|XP_007681661.1| hypothetical protein BAUCODRAFT_319460 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC91246.1| hypothetical protein BAUCODRAFT_319460 [Baudoinia compniacensis 
UAMH 10762]
Length=389

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI YK GSLQ+L+Q KLP Q  Y ++KN+ DGW AIKEM  RG       A ++    
Sbjct  3    LEAIRYKPGSLQILNQLKLPHQEEYDEVKNSTDGWHAIKEMRTRG---APAIAIVAALSL  59

Query  470  asNLET--FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
            A  L+T   +  A++  +F+ +KL+YLV+SRPTAVNL+DAA KL +++   A  AS
Sbjct  60   AVELQTGAVSDQAEEVSAFIIEKLDYLVTSRPTAVNLADAARKLKKIVESAAKHAS  115



>gb|EKG14703.1| Initiation factor 2B-related protein [Macrophomina phaseolina 
MS6]
Length=383

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+RGSLQ+LDQ +LP + +Y ++ +A+D W AIKEM  RGAPAIAI AAL LAVE
Sbjct  3    LQAIKYQRGSLQILDQLRLPHEEVYDEVHSAQDAWHAIKEMRTRGAPAIAIVAALGLAVE  62

Query  470  asNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
               +   N     A++   F+ +KL YLV+SRPTAVNL+DAA KLN+ +
Sbjct  63   LETIAAKNELSSVAEEVKVFVEEKLSYLVTSRPTAVNLADAARKLNKTV  111



>gb|EPY28944.1| methylthioribose-1-phosphate isomerase [Strigomonas culicis]
 gb|EPY34737.1| methylthioribose-1-phosphate isomerase [Strigomonas culicis]
Length=403

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            AH   KTL++I Y++GSLQLLDQRKLPL++++ D++  +D W AIKEM VRGAPAIA++A
Sbjct  36   AHPHKKTLESIKYEKGSLQLLDQRKLPLESVFDDVRTVEDIWTAIKEMRVRGAPAIAVSA  95

Query  449  alslaveasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            AL +A+ A+N +       A  AV FL +  +Y+++SRPTAVNL +  +++ E + + + 
Sbjct  96   ALGIAIAAANKQKAGEFADASAAVQFLLESCDYVMTSRPTAVNLFNCLSQVKEQVRRLSE  155

Query  623  TASEAKTI  646
            TA+  + +
Sbjct  156  TAATVEAV  163



>gb|KIW03172.1| S-methyl-5-thioribose-1-phosphate isomerase [Verruconis gallopava]
Length=382

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+RGSL +LDQ +LP  T +  ++ A +GW AIK M  RGAPAIAI AALSLAVE
Sbjct  3    LQAIRYERGSLLVLDQLQLPYTTHFDSVRTATEGWHAIKSMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
             ++ ET +   ++  +F+ +KLEYLV+SRPTAVNL+DAA KL E I +EA +A  A
Sbjct  63   LTH-ETLSTIPEEVAAFIIEKLEYLVTSRPTAVNLADAARKL-EAIVEEAKSAEGA  116



>ref|XP_011114920.1| hypothetical protein H072_9321 [Dactylellina haptotyla CBS 200.50]
 gb|EPS37093.1| hypothetical protein H072_9321 [Dactylellina haptotyla CBS 200.50]
Length=384

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL++LDQ  LP Q++Y+ + +   GW AI+ M VRGAPAIAI AALSLAV
Sbjct  3    TLLAIKYARGSLEILDQLLLPHQSVYIPVNDVLTGWQAIRSMQVRGAPAIAIVAALSLAV  62

Query  467  easN-LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            E +N  +T   T Q AV  + +KL+YLV+SRPTAVNL+DAA KL
Sbjct  63   ELNNAFDTAPATPQSAVELIHEKLDYLVTSRPTAVNLADAAGKL  106



>ref|XP_002151818.1| translation initiation factor, putative [Talaromyces marneffei 
ATCC 18224]
 sp|B6QRG1.1|MTNA_PENMQ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20818.1| translation initiation factor, putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX45181.1| Methylthioribose-1-phosphate isomerase [Talaromyces marneffei 
PM1]
Length=384

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2    SLQAIKYADNQLQIIDQLQLPFVTEYIPIRSAQDGWHAIKEMRVRGAPAIAIVAILSLAV  61

Query  467  easNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
            E S ++T    + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+   T
Sbjct  62   ELSEIQTAGKLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFETMVTEHTKT  117



>ref|XP_003236958.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
118892]
 gb|EGD85409.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
118892]
 gb|EZF13162.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR850]
 gb|EZF39692.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
100081]
 gb|EZF50216.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
288.86]
 gb|EZF60848.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
289.86]
 gb|EZF71366.1| methylthioribose-1-phosphate isomerase [Trichophyton soudanense 
CBS 452.61]
 gb|EZF82175.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR1448]
 gb|EZF92925.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR1459]
 gb|EZG03937.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
735.88]
 gb|EZG14501.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
202.88]
 gb|KDB31425.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum D6]
Length=385

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2    SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   E  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   ELTELMDHEKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQK  113



>gb|KEQ84160.1| Methylthioribose-1-phosphate isomerase [Aureobasidium pullulans 
EXF-150]
Length=395

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 9/125 (7%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+AI YKRG L +LDQ +LP   +Y ++K+A+D W AIKEM  RG       A ++   
Sbjct  2    SLEAIKYKRGQLDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRG---APAIAIVAALG  58

Query  467  easNLETFNG------TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
             A  LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++   A   
Sbjct  59   LAVELELIAGKKELSSVAEEVEFFIKEKLEYLVTSRPTAVNLADAARKLQKIVQTAAKAQ  118

Query  629  SEAKT  643
            S + T
Sbjct  119  SASGT  123



>gb|AGT02618.1| S-methyl-5-thioribose-1-phosphate isomerase [Strigomonas oncopelti]
Length=369

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            AH   KTL++I Y++GSLQLLDQRKLPL++++ D+   +D W AIKEM VRGAPAIA++A
Sbjct  2    AHPHKKTLESIKYEKGSLQLLDQRKLPLESVFDDVLTVEDIWSAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLN---EVITK  613
            AL +AV A N +       A  A++FL +  +Y+++SRPTAVNL +  T++    EV+  
Sbjct  62   ALGIAVAALNKQKKGDFADANAAINFLLESCDYVMTSRPTAVNLFNCLTQVKEKVEVMRH  121

Query  614  EASTASE  634
             A T  E
Sbjct  122  TAKTVEE  128



>ref|XP_661894.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 sp|Q5B590.1|MTNA_EMENI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
nidulans FGSC A4]
 gb|EAA60042.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF77829.1| TPA: translation initiation factor, putative (AFU_orthologue; 
AFUA_4G05830) [Aspergillus nidulans FGSC A4]
Length=379

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 4/114 (4%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI YK G L ++DQ +LP    Y++I+ +++GW AIK M VRGAPAIAI AALSLA E
Sbjct  3    LEAIRYKDGKLSIIDQLQLPFTERYIEIRTSEEGWQAIKNMQVRGAPAIAIVAALSLASE  62

Query  470  asNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
               L   N    TA+D  +F+ ++L +LVSSRPTAVNLSDAA KL EVI  E S
Sbjct  63   LHELSIRNKISTTAEDVTAFIRERLGHLVSSRPTAVNLSDAARKL-EVIVSERS  115



>dbj|GAM36840.1| hypothetical protein TCE0_022f06253 [Talaromyces cellulolyticus]
Length=384

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2    SLQAIKYADNQLQIIDQLQLPFVTEYIPIRSAQDGWHAIKEMRVRGAPAIAIVAILSLAV  61

Query  467  easNLE---TFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            E S ++   T + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+ 
Sbjct  62   ELSEIQTAGTLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFEAMVTEH  114



>ref|XP_001216022.1| hypothetical protein ATEG_07401 [Aspergillus terreus NIH2624]
 sp|Q0CFY3.1|MTNA_ASPTN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
terreus NIH2624]
 gb|EAU31663.1| hypothetical protein ATEG_07401 [Aspergillus terreus NIH2624]
Length=377

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ +LP    Y+ I N+++GW AIK+M VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIKYNNGDLAIIDQLQLPHVEKYVTIHNSEEGWHAIKDMRVRGAPAIAIVAALALAS  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASE  634
            E   L   +  +  A+D  +F+ +KL YLVSSRPTAVNLSDAA KL  V+ + A +  + 
Sbjct  62   ELHGLMAHDKLSPEAEDVQTFVVEKLRYLVSSRPTAVNLSDAARKLEVVVAQSARAPGAT  121

Query  635  AKTI  646
             KT+
Sbjct  122  GKTV  125



>emb|CCX34105.1| Similar to Methylthioribose-1-phosphate isomerase; acc. no. C5FY68 
[Pyronema omphalodes CBS 100304]
Length=375

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y RGSL +LDQ +LP  +IY+ I   + GWDAIK MVVRGAPAIAI AAL+LAV
Sbjct  2    SLQAIKYTRGSLTILDQLRLPHASIYVPISTCEAGWDAIKRMVVRGAPAIAIVAALALAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            E  +++      Q     + ++LEYLV+SRPTAVNL+DAA KLN V+ ++A  A E 
Sbjct  62   ELVDIKAAELEPQQQRQRIQERLEYLVTSRPTAVNLADAAGKLN-VVAQKAFEAGEG  117



>emb|CBJ48521.1| eukaryotic translation initiation factor 2B family protein / 
eIF-2B family protein [Ectocarpus siliculosus]
Length=759

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +2

Query  299  ICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveasN  478
            I Y RGSLQ+L+Q KLP +T Y+D++ A+D +DAIK M+VRGAP IAI AAL LAVEAS+
Sbjct  8    IRYTRGSLQVLNQLKLPHETEYMDVRGAEDAFDAIKTMMVRGAPLIAIVAALGLAVEASS  67

Query  479  LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
              T NGTAQ+A S L +KL+YL +SR TAVNL++A   L   I+ EA+
Sbjct  68   GATQNGTAQEASSMLHEKLDYLKTSRETAVNLANACDALKTTISGEAA  115



>gb|KFH66789.1| S-methyl-5-thioribose-1-phosphate isomerase [Mortierella verticillata 
NRRL 6337]
Length=387

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y+RGSL ++DQ  LP +T+Y+ I     G DAIK M VRGAPAIAI AAL+LAV
Sbjct  5    TLQAIRYQRGSLDIIDQLLLPHETLYIPISTLALGHDAIKTMKVRGAPAIAIVAALTLAV  64

Query  467  easNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
               +  T     +AQDAV+F+ + LE+L +SRPTAVNL DAA KL + + + A TA+  +
Sbjct  65   VLVDAATAPRLTSAQDAVAFIEESLEFLKTSRPTAVNLFDAAHKLAKGVREAAVTATSGQ  124

Query  641  TI  646
             I
Sbjct  125  EI  126



>gb|AGT02734.1| S-methyl-5-thioribose-1-phosphate isomerase [Strigomonas galati]
Length=369

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            AH   KTL++I Y++GSLQLLDQRKLPL++++ ++   +D W AIKEM VRGAPAIA++A
Sbjct  2    AHPHKKTLESIKYEKGSLQLLDQRKLPLESVFDEVLTVEDIWTAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            AL +AV A N +       A  AV FL +  +Y+++SRPTAVNL +  T++ E + +   
Sbjct  62   ALGIAVAALNKQKKGELADANAAVHFLLESCDYVMTSRPTAVNLFNCLTQVKEKVERLRH  121

Query  623  TA  628
            TA
Sbjct  122  TA  123



>gb|EGD96919.1| translation initiation factor [Trichophyton tonsurans CBS 112818]
Length=385

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2    SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   +  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   ELTELMDHDKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQK  113



>ref|XP_007929107.1| hypothetical protein MYCFIDRAFT_204427 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME80035.1| hypothetical protein MYCFIDRAFT_204427 [Pseudocercospora fijiensis 
CIRAD86]
Length=385

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y   SLQ+L+Q KLP Q  Y ++K A+DGW AIK+M  RGAPAIAI AALSLAVE
Sbjct  3    LEAIRYAPCSLQILNQLKLPHQEEYDEVKTAEDGWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             SN +T +  A++  +F+ +KL+YLV+SRPTAVNL+DA  KL +++T  A+
Sbjct  63   LSNNKTSD-KAEEVAAFIVEKLDYLVTSRPTAVNLADAVGKLKKIVTSAAA  112



>gb|EGE01404.1| S-methyl-5-thioribose-1-phosphate isomerase [Trichophyton equinum 
CBS 127.97]
 gb|EZF31897.1| methylthioribose-1-phosphate isomerase [Trichophyton interdigitale 
H6]
 gb|KDB23619.1| methylthioribose-1-phosphate isomerase [Trichophyton interdigitale 
MR816]
Length=385

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2    SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   +  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   ELTELMDHDKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQK  113



>gb|EME39638.1| hypothetical protein DOTSEDRAFT_75327 [Dothistroma septosporum 
NZE10]
Length=391

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y+ GSL +L+Q KLP Q  Y +IK A+DGW AIK+M  RGAPAIAI AALSLAVE
Sbjct  3    LEAIRYEPGSLYILNQLKLPHQEEYDEIKTAEDGWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
             +N +  +  A++  +F+ +KL YLV+SRPTAVNL+DAA KL ++    A+ +S+
Sbjct  63   LTNTKVSD-KAEEVAAFIIEKLNYLVTSRPTAVNLADAAGKLKKITESAAAQSSD  116



>ref|XP_001794215.1| hypothetical protein SNOG_03661 [Phaeosphaeria nodorum SN15]
 gb|EAT88866.2| hypothetical protein SNOG_03661 [Phaeosphaeria nodorum SN15]
Length=378

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIKEM  RGAPAIAI AALSLAVE
Sbjct  3    LQAIKYTRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKEMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             +N++  +  A++   F+++KLEYLV+SRPTAVNL+DAA KL + IT EA+
Sbjct  63   LTNMK-LSSIAEEVQVFITEKLEYLVTSRPTAVNLADAAGKLKK-ITDEAA  111



>ref|XP_003850691.1| hypothetical protein MYCGRDRAFT_73955 [Zymoseptoria tritici IPO323]
 gb|EGP85667.1| hypothetical protein MYCGRDRAFT_73955 [Zymoseptoria tritici IPO323]
Length=389

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 5/117 (4%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y+ GSLQ+L+Q KLP Q  Y  I++A+DGW AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LEAIRYQPGSLQILNQLKLPHQEEYDHIRSAEDGWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  640
              +  T +  A++  +F+ +KL+YLV+SRPTAVNL+DAA KL +++     TAS A+
Sbjct  63   LQSTTTSD-HAEEVAAFILEKLDYLVTSRPTAVNLADAAGKLKKIV----DTASNAE  114



>ref|XP_002843502.1| methylthioribose-1-phosphate isomerase [Arthroderma otae CBS 
113480]
 sp|C5FY68.1|MTNA_ARTOC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arthroderma 
otae CBS 113480]
 gb|EEQ34466.1| methylthioribose-1-phosphate isomerase [Arthroderma otae CBS 
113480]
Length=385

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2    SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   E  +  A +  +++ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   ELTELMDHEKLSTEADEVEAYILEKLDYLVTSRPTAVNLSDAAIKLKTLVQK  113



>ref|XP_001820594.2| methylthioribose-1-phosphate isomerase [Aspergillus oryzae RIB40]
Length=366

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  467  easNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +
Sbjct  62   ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAE  113



>ref|XP_002842304.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86495.1| unnamed protein product [Tuber melanosporum]
Length=363

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 5/119 (4%)
 Frame = +2

Query  287  TLQAICYKR--GSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            +LQAI Y     +LQ+LDQ KLP +++Y+ I   +D +DAIK MVVRGAPAIAI AAL+L
Sbjct  2    SLQAILYTPTPPALQILDQLKLPHESVYVPICTCEDAYDAIKRMVVRGAPAIAIVAALAL  61

Query  461  av--easNLETFNG-TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
            AV   +  L +  G +A DA +++ ++L+YLV SRPTAVNL+DAA KL  V++ EA TA
Sbjct  62   AVELSSGGLPSEVGESAGDARAYVHRRLDYLVQSRPTAVNLADAAGKLKAVVSAEAGTA  120



>sp|Q2UIM3.1|MTNA_ASPOR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
oryzae RIB40]
 dbj|BAE58592.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=381

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  467  easNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +
Sbjct  62   ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAE  113



>gb|AGT02795.1| S-methyl-5-thioribose-1-phosphate isomerase [Angomonas desouzai]
Length=373

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +2

Query  257  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  436
            M++  H  +KTL++I Y+ GSL+LLDQRKLPL+T+Y D+K  +D W AIKEM VRGAPAI
Sbjct  1    MSSKPH--NKTLESIRYENGSLKLLDQRKLPLETVYDDVKTVQDIWTAIKEMRVRGAPAI  58

Query  437  aiaaalslaveasNLETFNGTAQD--AVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT  610
            A++AAL +AV A N       + D  A++FL    +Y+++SRPTAVNL +   ++ + + 
Sbjct  59   AVSAALGIAVAAQNKLAQKEISDDESAITFLLDSCDYVMTSRPTAVNLFNCLQEIKKQVE  118

Query  611  KEASTASEAKTI  646
            +  +T S A+ +
Sbjct  119  RMRTTPSSAEEV  130



>ref|XP_002480786.1| translation initiation factor, putative [Talaromyces stipitatus 
ATCC 10500]
 sp|B8M7D2.1|MTNA_TALSN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Talaromyces 
stipitatus ATCC 10500]
 gb|EED20352.1| translation initiation factor, putative [Talaromyces stipitatus 
ATCC 10500]
Length=384

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2    SLQAIKYFDNQLQIIDQLQLPFVTEYIPIRSAQDGWYAIKEMRVRGAPAIAIVAILSLAV  61

Query  467  easNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            E + + T    + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+ 
Sbjct  62   ELNEIHTAGKLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFENMVTEH  114



>gb|EIT82996.1| putative translation initiation factor [Aspergillus oryzae 3.042]
Length=381

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 79/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  467  easNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +
Sbjct  62   ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAE  113



>gb|EER36752.1| translation initiation factor [Histoplasma capsulatum H143]
Length=206

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A
Sbjct  62   ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRA  115



>ref|XP_001933231.1| methylthioribose-1-phosphate isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 sp|B2VZQ8.1|MTNA_PYRTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Pyrenophora 
tritici-repentis Pt-1C-BFP]
 gb|EDU45421.1| methylthioribose-1-phosphate isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=392

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 3/116 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
             SN++     A++   F+++KL+YLV+SRPTAVNL+DAA KL  +   E++ ASE 
Sbjct  63   LSNMK-LPSVAEEVKVFITEKLDYLVTSRPTAVNLADAAGKLQRI--TESAAASEG  115



>ref|XP_001540232.1| hypothetical protein HCAG_04072 [Histoplasma capsulatum NAm1]
 sp|A6R364.1|MTNA_AJECN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Histoplasma 
capsulatum NAm1]
 gb|EDN07562.1| hypothetical protein HCAG_04072 [Histoplasma capsulatum NAm1]
Length=391

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A
Sbjct  62   ELHTLATSNQLSAEPKDVGQLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRA  115



>ref|XP_007583690.1| putative methylthioribose-1-phosphate isomerase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD48853.1| putative methylthioribose-1-phosphate isomerase protein [Neofusicoccum 
parvum UCRNP2]
Length=1824

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 9/112 (8%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+RGSLQ+LDQ +LP   +Y DI +A+D W AIKEM  RG       A ++    
Sbjct  3    LQAIKYERGSLQILDQLRLPHAEVYDDIHSAQDAWHAIKEMRTRG---APAIAIVAALAL  59

Query  470  asNLET------FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            A  LET       +  A++    ++Q L+YLV+SRPTAVNL+DAA KL +++
Sbjct  60   AVQLETTAKNDELSSIAEEVRESIAQALDYLVTSRPTAVNLADAARKLRKIV  111



>ref|XP_001267437.1| translation initiation factor, putative [Neosartorya fischeri 
NRRL 181]
 sp|A1CY38.1|MTNA_NEOFI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Neosartorya 
fischeri NRRL 181]
 gb|EAW25540.1| translation initiation factor, putative [Neosartorya fischeri 
NRRL 181]
Length=387

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L ++DQ +LP    ++ I+  +D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5    LQAIRYSRGKLAIIDQLQLPYVEKFITIQTPEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
             + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T
Sbjct  65   LNTLIVHDKLSSGAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISDHADT  119



>gb|KEQ71351.1| Methylthioribose-1-phosphate isomerase [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=395

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 9/112 (8%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RG       A ++    
Sbjct  3    LEAIKYSRGKLDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRG---APAIAIVAALGL  59

Query  470  asNLETFNGT------AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            A  LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++
Sbjct  60   AVELELIAGKNELSKFAEEVEVFIKEKLEYLVTSRPTAVNLADAARKLEKIV  111



>ref|XP_003172192.1| methylthioribose-1-phosphate isomerase [Microsporum gypseum CBS 
118893]
 gb|EFR01781.1| methylthioribose-1-phosphate isomerase [Microsporum gypseum CBS 
118893]
Length=385

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2    SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            E + L   +  +  A +  +++ +KL+YLV+SRPTAVNLSDAA KL  ++
Sbjct  62   ELTELMDHDKLSAEADEVEAYILEKLDYLVTSRPTAVNLSDAAIKLKALV  111



>gb|EER36747.1| conserved hypothetical protein [Histoplasma capsulatum H143]
Length=329

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A
Sbjct  62   ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRA  115



>gb|KEQ63615.1| Methylthioribose-1-phosphate isomerase [Aureobasidium melanogenum 
CBS 110374]
Length=395

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 9/112 (8%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RG       A ++    
Sbjct  3    LEAIKYSRGELDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRG---APAIAIVAALGL  59

Query  470  asNLETFNG------TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
            A  LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++
Sbjct  60   AVELELIAGKNELSNIAEEVELFIKEKLEYLVTSRPTAVNLADAARKLQKIV  111



>gb|KEY83965.1| translation initiation factor [Aspergillus fumigatus var. RP-2014]
Length=387

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y  G+L ++DQ +LP    ++ I+ ++D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5    LQAIRYSHGNLAIIDQLQLPYVEKFITIRTSEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
             + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T
Sbjct  65   LNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISGHADT  119



>gb|EGC42562.1| translation initiation factor [Histoplasma capsulatum H88]
Length=394

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A
Sbjct  62   ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRA  115



>ref|XP_752241.1| translation initiation factor [Aspergillus fumigatus Af293]
 sp|Q4WNI1.1|MTNA_ASPFU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
fumigatus Af293]
 sp|B0Y5C3.1|MTNA_ASPFC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
fumigatus A1163]
 gb|EAL90203.1| translation initiation factor, putative [Aspergillus fumigatus 
Af293]
 gb|EDP49958.1| translation initiation factor, putative [Aspergillus fumigatus 
A1163]
Length=387

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y  G L ++DQ +LP    ++ I+ ++D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5    LQAIRYSHGKLAIIDQLQLPYVEKFITIRTSEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
             + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T
Sbjct  65   LNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISGHADT  119



>sp|C0P108.1|MTNA_AJECG RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Histoplasma 
capsulatum G186AR]
 gb|EEH02644.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=392

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A
Sbjct  62   ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRA  115



>ref|XP_009056765.1| hypothetical protein LOTGIDRAFT_190615 [Lottia gigantea]
 gb|ESO92624.1| hypothetical protein LOTGIDRAFT_190615 [Lottia gigantea]
Length=392

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = +2

Query  281  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            D  L+AI Y RG+L +LDQ +LP  T Y+ IKN +DGWDAIK+M VRGAPAIAI   LS+
Sbjct  6    DSNLKAIRYDRGNLDILDQLQLPTHTEYIPIKNTEDGWDAIKQMKVRGAPAIAIVGCLSM  65

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            AVE  ++E F  + Q+   ++  KL YLV++RPTAVN+ +A+  +++++ +E +T S+
Sbjct  66   AVEIYHME-FQ-SHQEIADYVKDKLNYLVTARPTAVNMKEASDWISKML-QELTTDSD  120



>gb|KGO76677.1| Initiation factor 2B alpha/beta/delta [Penicillium italicum]
Length=382

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa---lsl  460
            LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGAPAIAI A     S 
Sbjct  2    LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
               A N +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+     T+ 
Sbjct  62   LTSAVNSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEVVVVNRTKTSG  118



>ref|XP_002560080.1| Pc14g00860 [Penicillium rubens Wisconsin 54-1255]
 sp|B6H5R4.1|MTNA_PENCW RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Penicillium 
rubens Wisconsin 54-1255]
 emb|CAP74227.1| Pc14g00860 [Penicillium rubens Wisconsin 54-1255]
Length=382

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa---lsl  460
            LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGAPAIAI A     + 
Sbjct  2    LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALAAE  61

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT----KEASTA  628
               A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+T       ST 
Sbjct  62   LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVVTDCTKAPGSTG  121

Query  629  SEAKT  643
             E  T
Sbjct  122  HEVAT  126



>gb|KEQ98081.1| hypothetical protein AUEXF2481DRAFT_63242 [Aureobasidium subglaciale 
EXF-2481]
Length=395

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RG       A ++    
Sbjct  3    LEAIKYSRGKLDILDQLQLPHTEVYNEVKSAQDAWHAIKEMRTRG---APAIAIVAALGL  59

Query  470  asNLETFNGT------AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            A  LE   G       A++   F  +KLEYLV+SRPTAVNL+DAA KL +++   A
Sbjct  60   AVELELIAGKNELSSFAEEVEVFTKEKLEYLVTSRPTAVNLADAARKLQKIVQNAA  115



>ref|XP_003068154.1| methylthioribose-1-phosphate isomerase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 sp|C5PBM5.1|MTNA_COCP7 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER26009.1| methylthioribose-1-phosphate isomerase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EAS28711.3| methylthioribose-1-phosphate isomerase [Coccidioides immitis 
RS]
Length=390

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI YKRG L ++DQ  LP  T ++ I++A+DGW +IKEM VRGAPAIAI A LSLAVE
Sbjct  5    LEAIRYKRGHLLIIDQLLLPHVTRFIPIRSAEDGWHSIKEMHVRGAPAIAIVAMLSLAVE  64

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
             S L   +  +  A+D   ++ +KL+YL +SRPTAVNLSD+  K+  V+ ++  T
Sbjct  65   MSGLVSQQKISKNAEDTRVYIEEKLDYLATSRPTAVNLSDSVRKMKSVLEQKTRT  119



>emb|CDM34949.1| Methylthioribose-1-phosphate isomerase [Penicillium roqueforti 
FM164]
Length=382

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 78/123 (63%), Gaps = 7/123 (6%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa---lsl  460
            LQAI Y +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGAPAIAI A     S 
Sbjct  2    LQAIKYSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE----ASTA  628
               A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+        ST 
Sbjct  62   LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVVVNRTKAPGSTG  121

Query  629  SEA  637
             EA
Sbjct  122  REA  124



>ref|XP_002949511.1| eukaryotic translation initiation factor 2B alpha [Volvox carteri 
f. nagariensis]
 gb|EFJ49530.1| eukaryotic translation initiation factor 2B alpha [Volvox carteri 
f. nagariensis]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 9/102 (9%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQAI Y RGSLQLLDQR LP QT YLD+ + K  W  I++MVVRG              
Sbjct  9    SLQAIRYTRGSLQLLDQRLLPFQTAYLDVPDVKAAWTQIRDMVVRG---APAIGCTGALA  65

Query  467  easNLETFNG------TAQDAVSFLSQKLEYLVSSRPTAVNL  574
             A  L+T  G      + ++A  +++  L+YLV+SRPTAVNL
Sbjct  66   MAVELQTHKGAGTEFSSVKEATDYINSTLDYLVTSRPTAVNL  107



>ref|XP_006678377.1| hypothetical protein BATDEDRAFT_19408 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80893.1| hypothetical protein BATDEDRAFT_19408 [Batrachochytrium dendrobatidis 
JAM81]
Length=399

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 5/121 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y RG L +LDQ  LP +++Y  IK A DG++AIK M VRGAPAIAI AALSLAV
Sbjct  6    TLQAIKYSRGHLDILDQLILPFESVYETIKTAHDGYNAIKTMKVRGAPAIAIVAALSLAV  65

Query  467  easNLETFNGTA-----QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
            E  +  T   +A     QDAV F+S +L  L +SRPTAVNL +AA +L   +   A+ A+
Sbjct  66   ELHSETTHRSSAAFKTPQDAVDFISDRLTLLKTSRPTAVNLFEAADRLLRTVQDAATKAA  125

Query  632  E  634
            +
Sbjct  126  K  126



>ref|XP_003296469.1| hypothetical protein PTT_06581 [Pyrenophora teres f. teres 0-1]
 gb|EFQ95433.1| hypothetical protein PTT_06581 [Pyrenophora teres f. teres 0-1]
Length=392

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             SN++     A++   F+++KL+YLV+SRPTAVNL+DAA KL  +    A+
Sbjct  63   LSNMK-LPSVAEEVNVFIAEKLDYLVTSRPTAVNLADAAGKLRRITESAAA  112



>emb|CDH49387.1| methylthioribose-1-phosphate isomerase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=398

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y  G+LQ+L+Q  LP  TI+  + N +DG  AIK M  RGAPAIAI AALSLA
Sbjct  29   KTLEAIKYTSGNLQILNQLALPHDTIFEPVINVQDGHAAIKTMKTRGAPAIAIVAALSLA  88

Query  464  veasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            V+ +   + N   T  DAV FL + LEYL +SRPTAVNL DAA KL++++   A  A+E 
Sbjct  89   VDVNARRSKNEFKTVDDAVRFLHESLEYLKTSRPTAVNLFDAAAKLDQLVNTVARDATEP  148

Query  638  KTI  646
              +
Sbjct  149  NAV  151



>dbj|GAM84914.1| hypothetical protein ANO11243_029160 [fungal sp. No.11243]
Length=379

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 4/115 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L AI Y  G L +LDQ +LP    Y  I+N++D W AIKEM  RGAPAIAI AAL LAVE
Sbjct  3    LHAIKYTPGRLDILDQLQLPHAEHYDHIRNSEDAWHAIKEMRTRGAPAIAIVAALGLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
              N +  + +AQD   ++  KL YLV+SRPTAVNL+DA  KL +V+    S ASE
Sbjct  63   VFNSDLDSKSAQDVQEYIYDKLAYLVTSRPTAVNLADAVGKLRKVV----SAASE  113



>emb|CDS04006.1| hypothetical protein LRAMOSA06961 [Absidia idahoensis var. thermophila]
Length=372

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y  G+LQ+L+Q  LP  TI+  + N +DG  AIK M  RGAPAIAI AALSLA
Sbjct  3    KTLEAIKYTSGNLQILNQLALPHDTIFEPVINVQDGHAAIKTMKTRGAPAIAIVAALSLA  62

Query  464  veasNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
            V+ +   + N   T  DAV FL + LEYL +SRPTAVNL DAA KL+ ++   A  A++ 
Sbjct  63   VDVNTRRSKNEFKTVDDAVRFLHESLEYLKTSRPTAVNLFDAAAKLDHLVNTVARDATDP  122

Query  638  KTI  646
              +
Sbjct  123  NVV  125



>ref|XP_002627028.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
SLH14081]
 sp|C5JGS0.1|MTNA_AJEDS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Blastomyces 
dermatitidis SLH14081]
 gb|EEQ74668.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
SLH14081]
Length=392

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLAAITYTRGSLSILNQLLLPHQTTYDPLHSACDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFNGTA---QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L   N  +   ++   F+ +KLEYLVSSRPTAVNL++AA +L  +++ +A
Sbjct  62   ELDALAANNQLSPEPKEVEVFIREKLEYLVSSRPTAVNLAEAAGRLGGIVSAKA  115



>ref|XP_008031489.1| hypothetical protein SETTUDRAFT_166325 [Setosphaeria turcica 
Et28A]
 gb|EOA80895.1| hypothetical protein SETTUDRAFT_166325 [Setosphaeria turcica 
Et28A]
Length=392

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 77/105 (73%), Gaps = 1/105 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+RG LQ+LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYERGQLQILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEV  604
             +N++      ++   F+++KL+YLV+SRPTAVNL+DAA KL ++
Sbjct  63   LTNMK-LAAVPEEVKVFITEKLDYLVTSRPTAVNLADAAGKLRKI  106



>gb|KGO39130.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
 gb|KGO49452.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
 gb|KGO55325.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
Length=382

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa---lsl  460
            LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGAPAIAI A     S 
Sbjct  2    LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  631
               A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+     T+ 
Sbjct  62   LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEVVVVNRTKTSG  118



>sp|C5GGE5.1|MTNA_AJEDR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Blastomyces 
dermatitidis ER-3]
 gb|EEQ88736.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ER-3]
 gb|EGE77093.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL38862.1| methylthioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ATCC 26199]
Length=392

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL AI Y RGSL +L+Q  LP QT Y  + +A D W AI EM VRGAPAIAI AALSLAV
Sbjct  2    TLAAITYTRGSLSILNQLLLPHQTTYDPLHSACDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  467  easNLETFNGTA---QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L   N  +   ++   F+ +KLEYLVSSRPTAVNL++AA +L  +++ +A
Sbjct  62   ELDALAANNQLSPEPKEVEVFIREKLEYLVSSRPTAVNLAEAAGRLGGIVSAKA  115



>gb|AGG11452.1| hypothetical protein, partial [Trypanosomatidae sp. TS-2013]
Length=370

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            A   +KTL++I Y  GSL+LLDQR+LPL T++ +IK A+D W AIKEM VRGAPAIA++A
Sbjct  2    AAPHNKTLESIKYANGSLRLLDQRQLPLVTVFDEIKTAEDIWTAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNLETFNG--TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            AL +AV A+N        T  +A ++L +  +Y+ +SRPTAVNL +A T + + +++ A 
Sbjct  62   ALGIAVAAANKHAAGNLKTVDEAKAYLLETCDYVATSRPTAVNLFNAVTFMKKKVSEYAL  121

Query  623  TASE  634
            TA++
Sbjct  122  TATD  125



>gb|AGT02499.1| S-methyl-5-thioribose-1-phosphate isomerase [Angomonas deanei]
Length=372

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 87/124 (70%), Gaps = 7/124 (6%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
             +KTL++I Y++GSL+LLDQRKLPL+T++ DI   +D W AIKEM VRGAPAIA++AAL 
Sbjct  5    HNKTLESIKYEKGSLRLLDQRKLPLETVFDDIITVEDIWTAIKEMRVRGAPAIAVSAALG  64

Query  458  laveasNLETFNGTAQD---AVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK---EA  619
            +A+ A + +  NG  +D   A++FL    +Y+++SRPTAVNL +    + + + K   E 
Sbjct  65   IAIAAQH-KLSNGELRDDESAITFLLDSCDYVMTSRPTAVNLFNCLQDIKKKVEKFRTEP  123

Query  620  STAS  631
            STA 
Sbjct  124  STAG  127



>ref|XP_001695926.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP01263.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=161

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            A+ E   LQAI YKRGSLQLLDQR LP +T YLD+ + K  W  I++MVVRGAPAI    
Sbjct  3    ANDESSALQAIKYKRGSLQLLDQRLLPFRTEYLDVPDVKAAWTQIRDMVVRGAPAIGCTG  62

Query  449  alslaveasNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            AL++AVE   L+      G+AQ+A+ F++Q L++L   R    +L+DA  +L
Sbjct  63   ALAMAVELHALKGAGAAFGSAQEALEFINQTLDFLPPHR---RDLADACNRL  111



>ref|XP_007708817.1| hypothetical protein COCCADRAFT_2167 [Bipolaris zeicola 26-R-13]
 gb|EUC36860.1| hypothetical protein COCCADRAFT_2167 [Bipolaris zeicola 26-R-13]
Length=392

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AALSLAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+
Sbjct  63   LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAA  112



>ref|XP_003726311.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase-like [Strongylocentrotus purpuratus]
Length=376

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI YKRGSL++L+Q+ LPL+++Y ++K+A DG+ AIK+M VRGAPAIAI  +L +AV
Sbjct  23   TLKAIRYKRGSLEILNQKLLPLESVYEELKSADDGFYAIKDMKVRGAPAIAIVGSLCVAV  82

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            E +++ TF   + D V+F+S++  +L ++RPTAVN+S+A  +L
Sbjct  83   ELTHM-TFENKS-DLVAFISKQFRHLNTARPTAVNMSEAVKRL  123



>ref|NP_001077883.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05978.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=328

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  407  EMVVRGapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAA  586
            EMVVRGAPAIAIAAALSLAVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA
Sbjct  2    EMVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAA  61

Query  587  TKLNEVITKEASTASEAKTI  646
             KL  VI K  +TA+EAK+I
Sbjct  62   LKLKHVIAKALATATEAKSI  81



>gb|EFX71518.1| hypothetical protein DAPPUDRAFT_308831 [Daphnia pulex]
Length=352

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  GSL++LDQ  LP    Y+ I N +D W AI+EM VRGAPAIAI  +LSLAV
Sbjct  3    TLQAIKYNDGSLEILDQLLLPESCTYISINNVQDAWSAIREMKVRGAPAIAIVGSLSLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNL---SDAATKL-NEVITKEASTASE  634
            E   L     T +D  S + +KL+YLV+SRPTAVN+   ++A  KL N ++ K +  A+E
Sbjct  63   ELRKLAAPE-TKKDLHSLVKEKLDYLVTSRPTAVNMQLAAEACVKLSNNLVDKASVDAAE  121

Query  635  AKTI  646
            AK +
Sbjct  122  AKDV  125



>ref|XP_007702121.1| hypothetical protein COCSADRAFT_38815 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62015.1| hypothetical protein COCSADRAFT_38815 [Bipolaris sorokiniana 
ND90Pr]
Length=392

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L AI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LHAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
             +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL + IT+ A+   EA
Sbjct  63   LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLRK-ITENAAAKEEA  116



>ref|XP_001199953.2| PREDICTED: methylthioribose-1-phosphate isomerase-like [Strongylocentrotus 
purpuratus]
Length=321

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI YKRGSL++L+Q+ LPL+++Y ++K+A DG+ AIK+M VRGAPAIAI  +L +AV
Sbjct  2    TLKAIRYKRGSLEILNQKLLPLESVYEELKSADDGFYAIKDMKVRGAPAIAIVGSLCVAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            E +++ TF   + D V+F+S++  +L ++RPTAVN+S+A  + 
Sbjct  62   ELTHM-TFENKS-DLVAFISKQFRHLNTARPTAVNMSEAVKRF  102



>gb|EMD90991.1| hypothetical protein COCHEDRAFT_1176662 [Bipolaris maydis C5]
 gb|ENI05925.1| hypothetical protein COCC4DRAFT_31803 [Bipolaris maydis ATCC 
48331]
Length=392

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+
Sbjct  63   VTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAA  112



>ref|XP_011120963.1| hypothetical protein AOL_s00076g108 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50344.1| hypothetical protein AOL_s00076g108 [Arthrobotrys oligospora 
ATCC 24927]
Length=374

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 76/118 (64%), Gaps = 4/118 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG+L +LDQ  LP Q+IY+ + +    W+AIK M VRGAPAIAI A LSLAVE
Sbjct  3    LQAIKYTRGTLSILDQLFLPHQSIYISVPDVTTAWNAIKTMQVRGAPAIAIVAVLSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  643
              N    N  + +    + QKL+YLV+SRPTAVNL+DA+ KL  +    A+   E  T
Sbjct  63   LHN----NPPSSNPKEEIHQKLDYLVTSRPTAVNLADASNKLKSLTNSVANETPEIVT  116



>gb|EUN32000.1| hypothetical protein COCVIDRAFT_86317 [Bipolaris victoriae FI3]
Length=392

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W A+K+M  RGAPAIAI AALSLAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAVKDMRTRGAPAIAIVAALSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+
Sbjct  63   LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAA  112



>ref|XP_007691907.1| hypothetical protein COCMIDRAFT_105818 [Bipolaris oryzae ATCC 
44560]
 gb|EUC41567.1| hypothetical protein COCMIDRAFT_105818 [Bipolaris oryzae ATCC 
44560]
Length=392

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3    LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+
Sbjct  63   LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAA  112



>gb|EKV08512.1| Methylthioribose-1-phosphate isomerase [Penicillium digitatum 
Pd1]
 gb|EKV10165.1| Methylthioribose-1-phosphate isomerase [Penicillium digitatum 
PHI26]
Length=382

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa---lsl  460
            LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGAPAIAI A     S 
Sbjct  2    LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  461  aveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
               A +    + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+
Sbjct  62   LTSAVDSGKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVV  110



>gb|EPB91090.1| S-methyl-5-thioribose-1-phosphate isomerase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=388

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  18   KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  77

Query  464  veasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            V+  N     G   T   AV FL + LEYL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  78   VDV-NARFEQGEFETVDQAVKFLLESLEYLKTSRPTAVNLFDAAAKLEHLINTTAKTAQE  136

Query  635  AKTI  646
              T+
Sbjct  137  PVTV  140



>ref|XP_001271470.1| translation initiation factor, putative [Aspergillus clavatus 
NRRL 1]
 sp|A1CGN9.1|MTNA_ASPCL RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
clavatus NRRL 1]
 gb|EAW10044.1| translation initiation factor, putative [Aspergillus clavatus 
NRRL 1]
Length=385

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y  G L ++DQ +LP    Y+++  +KD W AIK+M VRGAPAIAI AAL+LA 
Sbjct  2    TLEAIRYSTGKLVIIDQLQLPYVEKYIEVPTSKDAWHAIKKMRVRGAPAIAIVAALALAS  61

Query  467  easNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   ++  A
Sbjct  62   ELHTLMAHDKLSNRAEEVRLFIQEKLDYLVSSRPTAVNLSDAARKLAAHVSDHA  115



>ref|XP_008104502.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Anolis carolinensis]
Length=341

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+AI Y+RGSL++L+Q  LP Q++Y  + + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2    SLEAIRYRRGSLEILNQLLLPQQSLYEAVGSVRQGWEAIRSMKVRGAPAIAIIGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E  N  T   +  +  +F+   L YLVS+RPTAVN++ AA +L  ++ +EA
Sbjct  62   ELHNKTTTEESVDNLETFVLDSLSYLVSARPTAVNMAQAAQELGRIVRQEA  112



>ref|XP_003218379.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
 ref|XP_008104501.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
Length=359

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+AI Y+RGSL++L+Q  LP Q++Y  + + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2    SLEAIRYRRGSLEILNQLLLPQQSLYEAVGSVRQGWEAIRSMKVRGAPAIAIIGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E  N  T   +  +  +F+   L YLVS+RPTAVN++ AA +L  ++ +EA
Sbjct  62   ELHNKTTTEESVDNLETFVLDSLSYLVSARPTAVNMAQAAQELGRIVRQEA  112



>ref|XP_003833699.1| hypothetical protein LEMA_P064600.1 [Leptosphaeria maculans JN3]
 emb|CBX90334.1| hypothetical protein LEMA_P064600.1 [Leptosphaeria maculans JN3]
Length=479

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            S    LQAI Y RG L++LDQ KLP    Y  + ++ D W AIK+M  RGAPAIAI AAL
Sbjct  85   SSKMVLQAIKYSRGRLEILDQLKLPHSEEYDSMYSSTDAWHAIKDMRTRGAPAIAIVAAL  144

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            +LAVE +N++  +  A++   F+++KL+YLV+SRPTAVNL+DAA KL  +  + A+
Sbjct  145  ALAVELANMK-LSSIAEEVKVFVTEKLDYLVTSRPTAVNLADAAGKLRRITEETAA  199



>gb|EHA19257.1| hypothetical protein ASPNIDRAFT_54270 [Aspergillus niger ATCC 
1015]
Length=382

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 3/109 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQAI Y  G L ++DQ +LP    Y+ ++++++ W AIK+M VRGAPAIAI AAL+LA 
Sbjct  2    TLQAIRYNDGDLSIIDQLQLPYVERYITVQSSEEAWHAIKDMRVRGAPAIAIVAALALAS  61

Query  467  easNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEV  604
            E   L   N    +A    +F+++KL+YLVSSRPTAVNL+DAA KL  V
Sbjct  62   ELHRLMACNNIPSEAPEVQAFIAKKLDYLVSSRPTAVNLADAARKLRAV  110



>ref|XP_002584032.1| S-methyl-5-thioribose-1-phosphate isomerase [Uncinocarpus reesii 
1704]
 sp|C4JWQ7.1|MTNA_UNCRE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Uncinocarpus 
reesii 1704]
 gb|EEP82134.1| S-methyl-5-thioribose-1-phosphate isomerase [Uncinocarpus reesii 
1704]
Length=386

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RG L ++DQ +LP  T ++ I +++ GW AIK M VRGAPAIAI A LSLAVE
Sbjct  5    LEAIKYDRGRLFIIDQLQLPHVTKFIPIDSSEAGWHAIKAMQVRGAPAIAIVAVLSLAVE  64

Query  470  asNLETFNGT---AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
              NL + N      +D  +++ QK++YLVSSRPTAVNLSD+A K+  ++ + A
Sbjct  65   MLNLVSENMIPEDGEDVRAYIEQKMDYLVSSRPTAVNLSDSAQKIKLLLDQRA  117



>ref|NP_973428.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 ref|NP_001031339.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20446.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AAM91239.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05976.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05977.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=326

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  410  MVVRGapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAAT  589
            MVVRGAPAIAIAAALSLAVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA 
Sbjct  1    MVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAAL  60

Query  590  KLNEVITKEASTASEAKTI  646
            KL  VI K  +TA+EAK+I
Sbjct  61   KLKHVIAKALATATEAKSI  79



>ref|XP_500138.1| YALI0A16698p [Yarrowia lipolytica]
 sp|Q6CGS4.1|MTNA_YARLI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Yarrowia 
lipolytica CLIB122]
 emb|CAG84070.1| YALI0A16698p [Yarrowia lipolytica CLIB122]
Length=372

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 81/125 (65%), Gaps = 14/125 (11%)
 Frame = +2

Query  287  TLQAICY--KRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  460
            +L+AI Y  K  +L +LDQ +LP ++ Y+ I N+ DGW AIK+MVVRGAPAIAI A LSL
Sbjct  2    SLEAIRYDEKNHTLTILDQLRLPHESEYVPINNSDDGWKAIKDMVVRGAPAIAIVAILSL  61

Query  461  aveasNLETFNG-------TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            A     +E  +G       T  +  SF+S +L+YL +SRPTAVNLSDA     +++  + 
Sbjct  62   A-----VELVHGGKVSRDQTRAEVGSFISDRLDYLNTSRPTAVNLSDAVGSFKKLVQTQT  116

Query  620  STASE  634
             +ASE
Sbjct  117  GSASE  121



>ref|XP_004993054.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
 gb|EGD74153.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
Length=378

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 3/116 (3%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            +E+K L+AI Y+ G L +++Q KLPL T Y  I + +DGWDAI+EM VRGAPAIAI AAL
Sbjct  13   AENK-LEAIRYRDGQLSIINQLKLPLVTEYDAISSVQDGWDAIREMRVRGAPAIAIVAAL  71

Query  455  slaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            SLAVE     TF  +A DA +F+   L++L +SRPTAVNL +AA KL  +  K A+
Sbjct  72   SLAVELHK-RTF-ASAGDAAAFIKTSLDHLRTSRPTAVNLFEAANKLEALSAKLAA  125



>dbj|GAN06082.1| translation initiation factor [Mucor ambiguus]
Length=377

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 80/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  7    KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  464  veasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            V+  N     G   T   AV FL + L+YL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  67   VDV-NARFEQGEFETVDQAVKFLLESLDYLKTSRPTAVNLFDAAAKLENLINTTAKTAQE  125

Query  635  AKTI  646
              T+
Sbjct  126  PVTV  129



>emb|CEP08072.1| hypothetical protein [Parasitella parasitica]
Length=377

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  7    KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  464  veasNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            V+A        FN T  +AV FL + L+YL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  67   VDAHTRFQQGQFN-TVDEAVKFLLESLDYLKTSRPTAVNLFDAAAKLEYLIKSTAETAQE  125

Query  635  AKTI  646
               +
Sbjct  126  PANV  129



>gb|AGT02556.1| S-methyl-5-thioribose-1-phosphate isomerase [Herpetomonas muscarum]
Length=371

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +2

Query  278  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  457
             + TL++I Y +GSL+LLDQRKLPL+T + D+K   D W AIKEM VRGAPAIA++AAL 
Sbjct  5    HNTTLESIKYSKGSLRLLDQRKLPLETTFDDVKTVDDIWLAIKEMRVRGAPAIAVSAALG  64

Query  458  laveasNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
            +AV A +      F  TA DAV FL     ++++SRPTAVNL +    L + +   A+  
Sbjct  65   IAVAAQHRLDEGAFKSTA-DAVKFLLDSCTHVMTSRPTAVNLFNCLNDLKKKVEAFAALG  123

Query  629  SEAKTI  646
            +E + +
Sbjct  124  NEKEVV  129



>ref|XP_009008789.1| hypothetical protein HELRODRAFT_62224, partial [Helobdella robusta]
 gb|ESO12069.1| hypothetical protein HELRODRAFT_62224, partial [Helobdella robusta]
Length=356

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +++AI Y  G+LQ++DQ KLP Q  Y+ IKN +DGW+AIK M VRGAPAIAI   LSLAV
Sbjct  2    SMEAIKYSAGNLQIIDQLKLPSQLDYIQIKNCEDGWNAIKFMQVRGAPAIAIVGGLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            E  + + FN +  +  SF+S +++YL++SRPTAVNL +    L   I + +S
Sbjct  62   EMYS-KDFN-SLSELKSFVSNRMKYLITSRPTAVNLFNLDATLQSFIDEHSS  111



>dbj|GAE00299.1| translation initiation factor, putative [Byssochlamys spectabilis 
No. 5]
Length=379

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y    L +LDQ +LP    Y++I++A++GW AIKEM VRGAPAIAI AALSLAV
Sbjct  2    TLEAIKYDGTQLSILDQLQLPHVVEYIEIRSAEEGWHAIKEMKVRGAPAIAIVAALSLAV  61

Query  467  easNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E   L T    +  A++    + +KL YL +SRPTAVNLSDAA KL   ++  A
Sbjct  62   ELKALVTDGKLSANAEEVQLLIREKLHYLTTSRPTAVNLSDAARKLEAHVSTTA  115



>ref|NP_001104708.1| methylthioribose-1-phosphate isomerase [Danio rerio]
 sp|A9JRE2.1|MTNA_DANRE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Danio 
rerio]
 gb|AAI55627.1| Zgc:172216 protein [Danio rerio]
 gb|AAI71374.1| Zgc:172216 [Danio rerio]
 gb|AAI71376.1| Zgc:172216 [Danio rerio]
Length=353

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP +T+Y +I++ +DG++AIK M VRG       A +    
Sbjct  2    TLEAIRYRSGSLQILNQLLLPRETVYDEIRSVRDGYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G A+D VSF+   L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-AEDLVSFVRDSLCHLTSARPTAVNMGRAARELMEFTENES  108



>gb|EQL00687.1| methylthioribose-1-phosphate isomerase [Ophiocordyceps sinensis 
CO18]
Length=389

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RGSLQ+LDQ +LP +  Y D+    D +DAI  M VRGAPAIAI A+L LAV
Sbjct  3    TLQALKYSRGSLQVLDQLRLPHEFHYDDVATRADAFDAIATMRVRGAPAIAIVASLGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  625
            E         +A DA++ + + L+YL++SRPTAV+L +A  +L   I   A +
Sbjct  63   ELHRGPVPGHSAHDAIAHVDEALDYLMTSRPTAVDLGNAVARLKARIRAGAHS  115



>ref|XP_001742754.1| hypothetical protein [Monosiga brevicollis MX1]
 sp|A9UQ62.1|MTNA_MONBE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Monosiga 
brevicollis]
 gb|EDQ92992.1| predicted protein [Monosiga brevicollis MX1]
Length=361

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y    L +LDQ KLPL+T Y ++ + +DGWDAI+EM VRGAPAIAI AAL++AV
Sbjct  3    TLEAIKYDGEKLLVLDQIKLPLETHYDEVLSIQDGWDAIREMRVRGAPAIAIVAALTIAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
                  TF  TA +  +F+   LE+L +SRPTAVNL + A +L  ++ ++ +  +EA
Sbjct  63   VMKR-STF-ATAAELAAFVRTSLEHLRTSRPTAVNLFEMAGRLEALLQEQPADCTEA  117



>ref|XP_007229603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Astyanax 
mexicanus]
Length=353

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP +T+Y +I++ +DG++AIK M VRG       A +    
Sbjct  2    TLEAIRYRTGSLQILNQLLLPHETVYEEIRSVQDGYEAIKTMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G  +D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GEDPVAFIRESLCHLTSARPTAVNMGRAARELMEFTENES  108



>gb|EIE81164.1| S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus delemar 
RA 99-880]
Length=377

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y RG+L++L+Q  LP +T++  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  7    KTLEAIQYTRGNLRILNQLVLPHETVFESVCNIQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  464  veasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            V+  N     G   T +  V FL   LEYL +SRPTAVNL DAA KL  +I   A  A E
Sbjct  67   VDV-NSRFEKGEFSTVEQVVQFLKDALEYLKTSRPTAVNLFDAAAKLEALIESTAKEAKE  125

Query  635  AKTI  646
              T+
Sbjct  126  PATV  129



>emb|CEI86534.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=377

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = +2

Query  272  HSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  451
            H+  KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RG        A
Sbjct  2    HTATKTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRG-APAIAIVA  60

Query  452  lslaveasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
                    N     G   T    V F+ + LEYL +SRPTAVNL DAA KL  V+   A 
Sbjct  61   ALSLAVDINTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQDSAK  120

Query  623  TASE  634
             A E
Sbjct  121  GAKE  124



>ref|XP_006023465.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
sinensis]
Length=387

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 10/115 (9%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+A+ Y+RGSLQ+LDQ +LP ++ Y  I+  +DG  AI++M VRGAPAIA+   LSLA  
Sbjct  3    LEALRYRRGSLQILDQLQLPQRSCYQAIRGVRDGQAAIRDMRVRGAPAIALVGCLSLA--  60

Query  470  asNLETFNGTA--QDA---VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
               +E   GTA  QDA    +F+ + L+ L S+RPTA N++ AA KL   +T EA
Sbjct  61   ---VELHGGTAGGQDAATVATFVGKALQDLASTRPTARNMAQAAEKLGAAVTHEA  112



>ref|XP_007275439.1| methylthioribose-1-phosphate isomerase [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA35505.1| methylthioribose-1-phosphate isomerase [Colletotrichum gloeosporioides 
Nara gc5]
Length=389

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQA+ Y RG L++LDQ +LP +  Y D+  +++ +D IK M VRGAPAIAI AAL+ AVE
Sbjct  4    LQAVKYTRGRLEVLDQLRLPHEFHYDDVSTSEEAFDCIKSMRVRGAPAIAIVAALAHAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
              N      +AQD VS++  +L+YL  SRPTAV+L++A  +L   I
Sbjct  64   LHNGSCTASSAQDTVSYIDSRLDYLKESRPTAVDLTNAILQLKACI  109



>ref|XP_006790934.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Neolamprologus 
brichardi]
Length=322

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +D ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRTGSLQILNQLLLPHQTVYDDIRSVQDAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_007422307.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Python bivittatus]
 ref|XP_007422308.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Python bivittatus]
Length=359

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y+RGSLQ+L+Q  LP Q++Y +I + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2    SLEALRYRRGSLQILNQLLLPHQSLYEEISSVRQGWEAIRSMKVRGAPAIAIIGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E  N      +  +   F+   L YL+S+RPTAVN++ AA  L   + +EA
Sbjct  62   ELHNKGNEELSLGNLEIFVLDSLSYLISARPTAVNMARAARDLGHFVHQEA  112



>ref|XP_003760740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sarcophilus 
harrisii]
Length=358

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 75/116 (65%), Gaps = 9/116 (8%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+AI Y RGSL +LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIAI   LSLA 
Sbjct  2    SLEAIRYHRGSLHVLDQLLLPQQSHYESVTSVRQAWEAIRAMKVRGAPAIAIVGCLSLA-  60

Query  467  easNLETFNGTAQDA----VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
                +E   G+        V+F+   L+YLV++RPTAVN++ AA +++EV ++EA 
Sbjct  61   ----VELHAGSGGPGLEALVTFVQDSLKYLVTARPTAVNMAQAAREMSEVASQEAG  112



>ref|XP_003455807.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oreochromis 
niloticus]
 ref|XP_004539081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Maylandia 
zebra]
 ref|XP_005735752.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pundamilia 
nyererei]
 ref|XP_005925153.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Haplochromis 
burtoni]
 ref|XP_008278518.1| PREDICTED: methylthioribose-1-phosphate isomerase [Stegastes 
partitus]
Length=353

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +D ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRTGSLQILNQLLLPHQTVYDDIRSVQDAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>gb|EMT32201.1| Methylthioribose-1-phosphate isomerase [Aegilops tauschii]
Length=452

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  395  DAIKEMVVRGapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNL  574
            +AI++MVVRGAPAIAIAAALSLAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNL
Sbjct  127  NAIRDMVVRGAPAIAIAAALSLAVEV-NDHDFTGTPVEAASFVSKKLEYLVSSRPTAVNL  185

Query  575  SDAATKLNEVITKEASTASEAKTI  646
            SDAATKL  ++++ A TA +AK+I
Sbjct  186  SDAATKLQNLVSRTAETAKDAKSI  209



>gb|KIL92878.1| methylthioribose-1-phosphate isomerase [Fusarium avenaceum]
Length=388

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    TLKAVKYSRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIASMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASNAEDTISQIDEALDYLKESRPTAVDLTNAINQLKATIRAVGSTATKEEVI  122



>ref|XP_003057882.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
 gb|EEH57833.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
Length=815

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSLQLLDQ KLP  T+++D+ +    W AIKEM VRGAPAIAIAAAL+LAV
Sbjct  5    TLEAIRYARGSLQLLDQLKLPTSTVFIDVPDCDACWSAIKEMNVRGAPAIAIAAALALAV  64

Query  467  easNLET--FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            EA           A    +F++QK+++L +SRPTAVNL +A  +L
Sbjct  65   EAHKTRDALVASGAAAVATFVTQKMDHLCTSRPTAVNLGEAVIRL  109



>emb|CEF98703.1| Putative translation initiation factor,aIF-2BI/5-methylthioribose-1-phosphate 
isomerase [Ostreococcus tauri]
Length=798

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSL++LDQ +LPL+T Y+D+   +  W  IK+M VRGAPAIAIAAAL+LA 
Sbjct  3    TLEAIAYVRGSLRVLDQLRLPLETTYVDVPTCEACWRCIKDMRVRGAPAIAIAAALALAT  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E          + +  +F  ++ +Y+ +SRPTAVNL +A  ++ +V    A T    +TI
Sbjct  63   ELERTRGRFRASAEVAAFARERFDYMYTSRPTAVNLGEARGRIQKVAMTLAETCDVTETI  122



>gb|KGQ02006.1| methylthioribose-1-phosphate isomerase [Paracoccidioides sp. 
'lutzii' Pb01]
Length=382

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L AI Y  G L +L+Q  LP QT Y  I +A D W AI +M VRGAPAIAI AALSLA+E
Sbjct  3    LIAISYSHGKLSILNQLFLPHQTTYDPIYSACDAWHAIHDMRVRGAPAIAIVAALSLAIE  62

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
              +L      +  A++   F+ +KLEYLVSSRPTAVNL++AA +L +++
Sbjct  63   LYDLIQKGKLSDQAKEVELFIREKLEYLVSSRPTAVNLAEAAGRLGKIV  111



>gb|ENH63320.1| Methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. cubense race 1]
Length=388

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N    +  A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITSSNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>ref|XP_005850664.1| hypothetical protein CHLNCDRAFT_140697 [Chlorella variabilis]
 gb|EFN58562.1| hypothetical protein CHLNCDRAFT_140697 [Chlorella variabilis]
Length=836

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 63/119 (53%), Positives = 83/119 (70%), Gaps = 10/119 (8%)
 Frame = +2

Query  290  LQAICYKRG------SLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  451
            L+AI + RG      SLQLL+QRKLPL+T +LDI   +  W AI++M VRGAPAIAIAAA
Sbjct  3    LEAIRFSRGGGLAPASLQLLEQRKLPLETEWLDIDGPQSAWTAIRDMTVRGAPAIAIAAA  62

Query  452  lslaveasNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            LSLAV+  N      F G A  A ++++Q++++LV+SRPTAVNLS AA  L  +  +EA
Sbjct  63   LSLAVDLINSGGGSQFQGPAA-AAAYVAQQMDFLVTSRPTAVNLSIAAEALKRLAGEEA  120



>emb|CEG65982.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=376

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 78/122 (64%), Gaps = 2/122 (2%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            S  KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AAL
Sbjct  2    SSTKTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRGAPAIAIVAAL  61

Query  455  slav-easNLETFNGTAQD-AVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  628
            SLAV   +  E    T  D  V F+ + LEYL +SRPTAVNL DAA KL  V+ + A  A
Sbjct  62   SLAVDINTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQESAKEA  121

Query  629  SE  634
             E
Sbjct  122  KE  123



>ref|XP_003972078.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Takifugu 
rubripes]
Length=353

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y D+++ +D ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRAGSLQILNQLLLPHQTVYDDLRSVQDAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVNFIRESLYHLTSARPTAVNMGRAARELMEFAENES  108



>emb|CCT63771.1| probable cig2 protein (putative GDP-GTP exchange factor) [Fusarium 
fujikuroi IMI 58289]
Length=388

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N      +A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASSAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|AGT02673.1| S-methyl-5-thioribose-1-phosphate isomerase [Crithidia acanthocephali]
Length=374

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 6/119 (5%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            +     TL++I Y  G L+LLDQRKLPL+T++ D+   +D W+AIKEM VRGAPAIA++A
Sbjct  2    SQPHHATLESIKYTPGYLRLLDQRKLPLETVFDDVLTVEDIWNAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNL----ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            AL +AV   N     E   G A  A  FL Q  +Y+++SRPTAVNL +    L   I K
Sbjct  62   ALGIAVATQNKVKAGELSTGAAVQA--FLLQSCDYVMTSRPTAVNLFNCLRDLKAQIEK  118



>emb|CAG06038.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=344

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y D+++ +D ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRAGSLQILNQLLLPRQTVYDDLRSVQDAYEAIKSMRVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVAFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_006262838.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
mississippiensis]
Length=387

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 10/115 (9%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+A+ Y+RGSLQ+LDQ +LP ++ Y  I+  +DG  AI++M VRGAPAIAI   LSLA  
Sbjct  3    LEALRYRRGSLQILDQLQLPQRSCYEAIRGVRDGQAAIRDMRVRGAPAIAIVGCLSLA--  60

Query  470  asNLETFNGTA--QDA---VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
               +E   GTA  QDA    +F+ + L+ L S+RPTA N++ AA KL    T EA
Sbjct  61   ---VELHGGTAGGQDAATVAAFVGKALQDLASTRPTARNMAQAAEKLGAAATHEA  112



>gb|EQB52140.1| S-methyl-5-thioribose-1-phosphate isomerase [Colletotrichum gloeosporioides 
Cg-14]
Length=389

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQA+ Y RG L++LDQ +LP +  Y D+  +++ +D IK M VRGAPAIAI AAL+ AVE
Sbjct  4    LQAVKYTRGRLEVLDQLRLPHEFHYDDVSTSEEAFDCIKSMRVRGAPAIAIVAALAHAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
              N      +AQD VS++  +L++L  SRPTAV+L++A  +L   I
Sbjct  64   LHNGSCTASSAQDTVSYIDSRLDHLKESRPTAVDLTNAILQLKACI  109



>ref|XP_003080319.1| methylthioribose kinase (ISS) [Ostreococcus tauri]
Length=1089

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSL++LDQ +LPL+T Y+D+   +  W  IK+M VRGAPAIAIAAAL+LA 
Sbjct  294  TLEAIAYVRGSLRVLDQLRLPLETTYVDVPTCEACWRCIKDMRVRGAPAIAIAAALALAT  353

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E          + +  +F  ++ +Y+ +SRPTAVNL +A  ++ +V    A T    +TI
Sbjct  354  ELERTRGRFRASAEVAAFARERFDYMYTSRPTAVNLGEARGRIQKVAMTLAETCDVTETI  413



>ref|WP_026289843.1| methylthioribose-1-phosphate isomerase [Thioalkalivibrio sp. 
ALJ17]
Length=348

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            T++A+ +   SL+LLDQR+LP +T+YLDI +AK   DAI+EMVVRGAPAI I AA  + +
Sbjct  10   TVRAVLWDGTSLKLLDQRRLPRETVYLDIPDAKAAADAIREMVVRGAPAIGITAAYGVVL  69

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
             A  L        D +  L   LE L +SRPTAVNL  A  ++  VI +  +
Sbjct  70   AARRLPA---DTPDWLDVLGPDLERLAASRPTAVNLFWALARMKAVIGQGGA  118



>ref|XP_001594777.1| hypothetical protein SS1G_04585 [Sclerotinia sclerotiorum 1980]
 sp|A7EGZ3.1|MTNA_SCLS1 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Sclerotinia 
sclerotiorum 1980 UF-70]
 gb|EDO02109.1| hypothetical protein SS1G_04585 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=445

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RG L++LDQ +LP + +Y ++   ++ +D+IK M VRGAPAIAI AAL+LAVE
Sbjct  4    LEAIKYGRGRLEVLDQLRLPHEFVYDNVSTCEEAFDSIKSMRVRGAPAIAIVAALALAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  637
              + +  + T Q+AV +++++L+YL+ SRPTAV+LS+ A KL + +++ A+ A+ A
Sbjct  64   LHHEKDGSKTKQEAVQYINKRLDYLLGSRPTAVDLSN-AIKLLKRVSQSAAEATNA  118



>gb|ENH78574.1| methylthioribose-1-phosphate isomerase [Colletotrichum orbiculare 
MAFF 240422]
Length=387

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQA+ Y RG L++LDQ +LP +  Y ++  +++ +D IK M VRGAPAIAI AAL+ AVE
Sbjct  4    LQAVKYTRGRLEVLDQLRLPHEFHYDEVSTSEEAFDCIKSMRVRGAPAIAIVAALAHAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
              N      +AQD++S++  +L+YL  SRPTAV+L++A  +L
Sbjct  64   LHNGSCTTSSAQDSISYIDGRLDYLKESRPTAVDLTNAINQL  105



>gb|EWZ41170.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum Fo47]
Length=388

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   EIHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|EXA01732.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. lycopersici MN25]
 gb|EXL60417.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. radicis-lycopersici 26381]
Length=388

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   EIHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|EXA48565.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. pisi HDV247]
 gb|EXK85847.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. raphani 54005]
 gb|EXM29934.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. vasinfectum 25433]
Length=388

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|EGU81202.1| hypothetical protein FOXB_08352 [Fusarium oxysporum Fo5176]
 gb|EWY96994.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum FOSC 
3-a]
 gb|EXK32422.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. melonis 26406]
 gb|EXL81559.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. conglutinans race 2 54008]
Length=388

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|EMT60763.1| Methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. cubense race 4]
 gb|EXL99853.1| methylthioribose-1-phosphate isomerase [Fusarium oxysporum f. 
sp. cubense tropical race 4 54006]
Length=388

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>gb|EWG45098.1| methylthioribose-1-phosphate isomerase [Fusarium verticillioides 
7600]
Length=388

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    SLKAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+D +S + + L+YL  SRPTAV+L++A  +L   I    STA++ + I
Sbjct  63   ELHNGSITASNAEDTISQIEEALDYLKESRPTAVDLTNAINQLKSTIRAVGSTATKEQVI  122



>ref|XP_010870944.1| PREDICTED: methylthioribose-1-phosphate isomerase [Esox lucius]
Length=353

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP +T++ +++  +DG++AIK M VRGAPAIAI   LSLA 
Sbjct  2    TLEAIRYRAGSLQILNQLLLPHETVFDEVRTVQDGYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  467  easNLETFNGT-AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
                +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  61   ----VELHAGAGGNDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_010740335.1| PREDICTED: methylthioribose-1-phosphate isomerase [Larimichthys 
crocea]
Length=353

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y +I++ +D ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRAGSLQILNQLLLPHQTVYDEIRSVQDAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_003012717.1| hypothetical protein ARB_00968 [Arthroderma benhamiae CBS 112371]
 gb|EFE32077.1| hypothetical protein ARB_00968 [Arthroderma benhamiae CBS 112371]
Length=430

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  320  LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveasNL---ETF  490
            LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++E + L   +  
Sbjct  2    LQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSIELTELMDHDKL  61

Query  491  NGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   SAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQK  102



>ref|XP_005805132.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Xiphophorus 
maculatus]
Length=353

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +  ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRSGSLQILNQLLLPHQTVYEDIRSVQGAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>emb|CEJ01322.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=384

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = +2

Query  284  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  463
            KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  13   KTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRGAPAIAIVAALSLA  72

Query  464  veasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  634
            V+  N     G   T    V F+ + LEYL +SRPTAVNL DAA KL  V+ + A  A E
Sbjct  73   VDI-NTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQESAKEAKE  131



>ref|XP_007570269.1| PREDICTED: methylthioribose-1-phosphate isomerase [Poecilia formosa]
Length=353

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +  ++AIK M VRG       A +    
Sbjct  2    TLEAIRYRSGSLQILNQLLLPHQTVYEDIRSVQGAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_001687079.1| putative translation initiation factor 2 subunit [Leishmania 
major strain Friedlin]
 emb|CAJ09465.1| putative translation initiation factor 2 subunit [Leishmania 
major strain Friedlin]
Length=506

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 88/145 (61%), Gaps = 6/145 (4%)
 Frame = +2

Query  215  TLILNYLQLILK*LMANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGW  394
            T  LN   L L  +M +  H    TL++I Y  GSL+LLDQRKLPL+T++ D+   +D W
Sbjct  118  TTPLNPSLLALSTVMMSKPH--HATLESIKYTPGSLRLLDQRKLPLETVFDDVLTVEDIW  175

Query  395  DAIKEMVVRGapaiaiaaalslaveasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTA  565
             AIKEM VRGAPAIA++AAL +AV     +  NG   + ++  +FL    +++++SRPTA
Sbjct  176  SAIKEMRVRGAPAIAVSAALGIAVATQR-KAANGELKSGREVQTFLLTSCDFVMTSRPTA  234

Query  566  VNLSDAATKLNEVITKEASTASEAK  640
            VNL +    L   + K   T + A+
Sbjct  235  VNLFNCLRDLKAQVDKLDPTKAAAE  259



>ref|XP_003025058.1| hypothetical protein TRV_00716 [Trichophyton verrucosum HKI 0517]
 gb|EFE44447.1| hypothetical protein TRV_00716 [Trichophyton verrucosum HKI 0517]
Length=518

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  320  LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveasNL---ETF  490
            LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++E + L   +  
Sbjct  2    LQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSIELTELMDHDKL  61

Query  491  NGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  613
            +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K
Sbjct  62   SAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQK  102



>ref|XP_004872496.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Heterocephalus glaber]
Length=311

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AICY+ GSL++LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIA+   LSLAVE
Sbjct  3    LEAICYEPGSLRVLDQLLLPQQSRYEAVGSVQQAWEAIRAMKVRGAPAIALVGCLSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
                    G A+ A +F+  +L  LV++RPTAVN++ AA  L + + +EA+
Sbjct  63   LRTGAGGPGPAELA-AFVRDRLNLLVTARPTAVNMARAARDLGDAVAREAA  112



>gb|AGG11646.1| hypothetical protein, partial [Leptomonas pyrrhocoris]
Length=375

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 72/105 (69%), Gaps = 4/105 (4%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            +     TL++I Y  G L+LLDQRKLPL+T++ D+   +D W AIKEM VRGAPAIA++A
Sbjct  2    SQPHHATLESIKYTPGFLRLLDQRKLPLETVFDDVLTVEDIWTAIKEMRVRGAPAIAVSA  61

Query  449  alslaveasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNL  574
            AL +AV   N +  +G   T  +  SFL +  +Y+++SRPTAVNL
Sbjct  62   ALGIAVATQN-KVKDGELRTGAEVQSFLLESCDYVMTSRPTAVNL  105



>gb|EAW84369.1| hypothetical protein MGC3207, isoform CRA_a [Homo sapiens]
Length=222

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2    TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA
Sbjct  62   ELQAGAGGP-GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREA  111



>emb|CCF35223.1| S-methyl-5-thioribose-1-phosphate isomerase, partial [Colletotrichum 
higginsianum]
Length=263

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQA+ Y RG L++LDQ +LP +  Y ++  +++ +D IK M VRGAPAIAI AAL+ AVE
Sbjct  4    LQAVKYTRGRLEVLDQLRLPHEFHYDEVSTSEEAFDCIKSMRVRGAPAIAIVAALAHAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
              N      + QD VS++  +L+YL  SRPTAV+L++A  +L
Sbjct  64   LHNGSCKASSPQDTVSYIDSRLDYLKESRPTAVDLTNAINQL  105



>gb|KFY18962.1| hypothetical protein V491_04642, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=214

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ +LP +++Y D+   +  +D IK M VRGAPAIAI AAL+LAVE
Sbjct  4    LQAIKYTRGKLEVLDQLRLPHESVYDDVSTCEQAFDCIKSMRVRGAPAIAIVAALALAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDA  583
              N E    +    + ++  +L+YL+ SRPTAV+LS+A
Sbjct  64   LENAELNKSSVDGQLKYVHDRLDYLMGSRPTAVDLSNA  101



>sp|Q4Q0R9.2|MTNA_LEIMA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Leishmania 
major]
Length=375

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 84/132 (64%), Gaps = 7/132 (5%)
 Frame = +2

Query  254  LMANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapa  433
            +M+   H+   TL++I Y  GSL+LLDQRKLPL+T++ D+   +D W AIKEM VRGAPA
Sbjct  1    MMSKPHHA---TLESIKYTPGSLRLLDQRKLPLETVFDDVLTVEDIWSAIKEMRVRGAPA  57

Query  434  iaiaaalslaveasNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEV  604
            IA++AAL +AV     +  NG   + ++  +FL    +++++SRPTAVNL +    L   
Sbjct  58   IAVSAALGIAVATQR-KAANGELKSGREVQTFLLTSCDFVMTSRPTAVNLFNCLRDLKAQ  116

Query  605  ITKEASTASEAK  640
            + K   T + A+
Sbjct  117  VDKLDPTKAAAE  128



>ref|XP_010777850.1| PREDICTED: methylthioribose-1-phosphate isomerase [Notothenia 
coriiceps]
Length=254

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL++I Y+ GSLQ+L+Q  LP QT Y +I++ +D ++AIK M VRG       A +    
Sbjct  2    TLESIRYRAGSLQILNQLLLPHQTTYEEIRSVQDAYEAIKSMKVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G   D V+F+ + L +L S+RPTAVN+  AA +L E    E+
Sbjct  59   LAVELRAGAG-GDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENES  108



>ref|XP_004872495.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Heterocephalus glaber]
Length=362

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AICY+ GSL++LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIA+   LSLAVE
Sbjct  3    LEAICYEPGSLRVLDQLLLPQQSRYEAVGSVQQAWEAIRAMKVRGAPAIALVGCLSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
                    G A+ A +F+  +L  LV++RPTAVN++ AA  L + + +EA+
Sbjct  63   LRTGAGGPGPAELA-AFVRDRLNLLVTARPTAVNMARAARDLGDAVAREAA  112



>ref|XP_003798062.1| PREDICTED: methylthioribose-1-phosphate isomerase [Otolemur garnettii]
Length=364

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2    TLEAIRYSRGSLQILDQLLLPHQSCYKSVDSVDQAWEAIRSMKVRGAPAIALVGCLSLAV  61

Query  467  easNLETFNGTAQDA-VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
            E        G   DA V+F+  KL +LV++RPTAVN++ AA  L +   +EA+
Sbjct  62   ELQ--AGAGGPGLDALVAFVRDKLSFLVTARPTAVNMARAAQDLAKDAAQEAA  112



>ref|XP_008087169.1| NagB/RpiA/CoA transferase-like protein [Glarea lozoyensis ATCC 
20868]
 gb|EHL02612.1| putative Methylthioribose-1-phosphate isomerase [Glarea lozoyensis 
74030]
 gb|EPE25850.1| NagB/RpiA/CoA transferase-like protein [Glarea lozoyensis ATCC 
20868]
Length=441

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y+RG+LQ+LDQ +LP + +Y D+   ++ +D IK M VRGAPAIAI AAL+LAVE
Sbjct  4    LQAIKYQRGNLQVLDQLRLPHEFVYDDVFTCEEAFDCIKAMRVRGAPAIAIVAALALAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDA  583
                +     +Q+ V +++ KL+YL+ SRPTAV+LS+A
Sbjct  64   LEQKKDGASNSQELVKYINSKLDYLMGSRPTAVDLSNA  101



>ref|XP_005310723.1| PREDICTED: methylthioribose-1-phosphate isomerase [Chrysemys 
picta bellii]
Length=359

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 6/114 (5%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+A+ Y+RGSL++L+Q  LP ++ Y +I + + GW+AI+ M VRG       A +    
Sbjct  2    SLEALRYRRGSLRVLNQLLLPQRSCYAEIGSVRQGWEAIRAMQVRG---APAIAIVGCLS  58

Query  467  easNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
             A  L    G  Q      +F+   L YLV++RPTAVN++ AA +L    ++EA
Sbjct  59   LAVELHGGAGMGQGKAGLETFIHDSLRYLVTARPTAVNMARAAEELGAFASQEA  112



>gb|EYB31804.1| hypothetical protein FG05_05053 [Fusarium graminearum]
Length=391

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  6    TLQAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  65

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+  +S + + L+YL  SRPTAV+L++A  +L   I +  S+A++ + I
Sbjct  66   ELQNGSITASDAEGTISQIDEALDYLKESRPTAVDLTNAINQLKATIREVGSSATKDQVI  125



>ref|XP_009256337.1| hypothetical protein FPSE_04944 [Fusarium pseudograminearum CS3096]
 gb|EKJ74908.1| hypothetical protein FPSE_04944 [Fusarium pseudograminearum CS3096]
Length=335

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    TLQAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+  +S + + L+YL  SRPTAV+L++A  +L   I    S+A++ + I
Sbjct  63   ELQNGSVTASDAEGTISQIDEALDYLKESRPTAVDLTNAINQLKATIRAVGSSATKDQII  122



>ref|XP_008596336.1| S-methyl-5-thioribose-1-phosphate isomerase [Beauveria bassiana 
ARSEF 2860]
 gb|EJP68121.1| S-methyl-5-thioribose-1-phosphate isomerase [Beauveria bassiana 
ARSEF 2860]
Length=388

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RG LQ+LDQ +LP +  Y ++   ++ +D+I  M  RGAPAIAI A+L LAV
Sbjct  3    TLQAVKYTRGQLQVLDQLRLPHEFHYDNVATREEAFDSIASMRTRGAPAIAIVASLGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N    +G+ QD VS++   L+YL  SRPTAV+L++A  +L   I      A++ + +
Sbjct  63   ELHNGSAPDGSTQDIVSYIDTALDYLKESRPTAVDLTNAINQLKARIRAAGDAATKDEVV  122



>ref|XP_007790511.1| putative methylthioribose-1-phosphate isomerase protein [Eutypa 
lata UCREL1]
 gb|EMR70387.1| putative methylthioribose-1-phosphate isomerase protein [Eutypa 
lata UCREL1]
Length=412

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 72/109 (66%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQAI Y RG L++LDQ +LP +  Y ++  +++ +D IK M VRGAPAIAI AAL+  VE
Sbjct  4    LQAIRYSRGKLEVLDQLRLPHEHHYDEVSTSEEAFDCIKSMRVRGAPAIAIVAALAHGVE  63

Query  470  asNLE---TFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
              N     T   T+++ +S++  +L+YL  SRPTAV+LS+A   L  VI
Sbjct  64   LHNGSCSATATSTSEETISYIDSRLDYLKQSRPTAVDLSNAIAHLKAVI  112



>ref|XP_011323537.1| hypothetical protein FGSG_05053 [Fusarium graminearum PH-1]
 gb|ESU10961.1| hypothetical protein FGSG_05053 [Fusarium graminearum PH-1]
 emb|CEF85881.1| unnamed protein product [Fusarium graminearum]
Length=388

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RG LQ+LDQ +LP +  Y D+ N  + +D+I  M VRGAPAIAI AAL LAV
Sbjct  3    TLQAVKYTRGQLQVLDQLRLPHEFHYDDVSNRTEAFDSIATMRVRGAPAIAIVAALGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N       A+  +S + + L+YL  SRPTAV+L++A  +L   I +  S+A++ + I
Sbjct  63   ELQNGSITASDAEGTISQIDEALDYLKESRPTAVDLTNAINQLKATIREVGSSATKDQVI  122



>gb|KGQ07769.1| Methylthioribose-1-phosphate isomerase [Beauveria bassiana D1-5]
Length=388

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 0/120 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TLQA+ Y RG LQ+LDQ +LP +  Y ++   ++ +D+I  M  RGAPAIAI A+L LAV
Sbjct  3    TLQAVKYTRGQLQVLDQLRLPHEFHYDNVATREEAFDSIASMRTRGAPAIAIVASLGLAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
            E  N    +G+ QD VS++   L+YL  SRPTAV+L++A  +L   I      A++ + +
Sbjct  63   ELHNGSAPDGSTQDIVSYIDTALDYLKESRPTAVDLTNAINQLKARIRAAGDAATKDEVV  122



>gb|KJB07315.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=298

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  410  MVVRGapaiaiaaalslaveasNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAAT  589
            MVVRGAPAIAIAAALSLAVE +N + FNGT+++A SF+  KLEYLVSSRPTAVNLSDAA 
Sbjct  1    MVVRGAPAIAIAAALSLAVEVANFKDFNGTSEEAASFIELKLEYLVSSRPTAVNLSDAAK  60

Query  590  KLNEVITKEAST  625
            KL E+ +  AST
Sbjct  61   KLIEITSNAAST  72



>ref|XP_829164.1| translation initiation factor 2 subunit [Trypanosoma brucei brucei 
TREU927]
 sp|Q383H9.1|MTNA_TRYB2 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Trypanosoma 
brucei brucei TREU927]
 gb|EAN80052.1| translation initiation factor 2 subunit, putative [Trypanosoma 
brucei brucei TREU927]
Length=386

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            S   TL++I Y+RG LQLLDQR+LPL+T+Y DI +  D   AIKEM VRGAPAIA++AAL
Sbjct  3    SAHNTLESIKYRRGVLQLLDQRRLPLETVYCDITSIDDICCAIKEMRVRGAPAIAVSAAL  62

Query  455  slavea------sNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            +LAV A          +   TA D   FL    + ++S+RPTAVNLS    +L + I  +
Sbjct  63   ALAVVAERELKEQRQNSVWKTADDMRQFLLMSCDKMMSARPTAVNLSKVLIQLKKDIETD  122

Query  617  ASTASEA  637
             +   EA
Sbjct  123  KANTMEA  129



>ref|XP_008853657.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Nannospalax galili]
Length=325

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 71/114 (62%), Gaps = 9/114 (8%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AI Y RGSLQ+LDQ +LPL + Y  + + +  W+AI+ M VRGAPAIA+   LSLA  
Sbjct  3    LEAIRYSRGSLQILDQLQLPLHSHYEVLGSVQQAWEAIRAMKVRGAPAIALVGCLSLA--  60

Query  470  asNLETFNGTAQDA----VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
               +E   G         V+F+  +L +LVS+RPTAVN++ AA  L  V  +EA
Sbjct  61   ---VELQAGAGGPGLLALVAFVHDQLNFLVSARPTAVNMARAARDLAHVAAQEA  111



>sp|D0A8W2.1|MTNA_TRYB9 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Trypanosoma 
brucei gambiense DAL972]
 emb|CBH18113.1| translation initiation factor 2 subunit,putative [Trypanosoma 
brucei gambiense DAL972]
Length=386

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +2

Query  275  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  454
            S   TL++I Y+RG LQLLDQR+LPL+T+Y DI +  D   AIKEM VRGAPAIA++AAL
Sbjct  3    SAHNTLESIKYRRGVLQLLDQRRLPLETVYCDITSIDDICCAIKEMRVRGAPAIAVSAAL  62

Query  455  slavea------sNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  616
            +LAV A          +   TA D   FL    + ++S+RPTAVNLS    +L + I  +
Sbjct  63   ALAVVAERELKEQRQNSVWKTADDMRQFLLMSCDKMMSARPTAVNLSKVLIQLKKDIETD  122

Query  617  ASTASEA  637
             +   EA
Sbjct  123  KANTMEA  129



>ref|XP_004872494.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Heterocephalus glaber]
Length=387

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L+AICY+ GSL++LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIA+   LSLAVE
Sbjct  3    LEAICYEPGSLRVLDQLLLPQQSRYEAVGSVQQAWEAIRAMKVRGAPAIALVGCLSLAVE  62

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  622
                    G A+ A +F+  +L  LV++RPTAVN++ AA  L + + +EA+
Sbjct  63   LRTGAGGPGPAELA-AFVRDRLNLLVTARPTAVNMARAARDLGDAVAREAA  112



>ref|NP_115661.1| methylthioribose-1-phosphate isomerase isoform 2 [Homo sapiens]
 emb|CAD38951.1| hypothetical protein [Homo sapiens]
 emb|CAL38102.1| hypothetical protein [synthetic construct]
 emb|CAL37494.1| hypothetical protein, partial [synthetic construct]
 gb|EAW84371.1| hypothetical protein MGC3207, isoform CRA_c [Homo sapiens]
 dbj|BAI46344.1| methylthioribose-1-phosphate isomerase homolog [synthetic construct]
Length=322

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2    TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA
Sbjct  62   ELQAGAGGP-GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREA  111



>sp|C0S1C8.1|MTNA_PARBP RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Paracoccidioides 
brasiliensis Pb03]
 gb|EEH19074.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb03]
Length=386

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 72/109 (66%), Gaps = 3/109 (3%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            L AI Y  G L +L+Q  LP QT Y  I +A D W AI +M VRGAPAIAI AALS+AVE
Sbjct  3    LIAISYSHGKLSILNQLFLPHQTTYDPIYSACDAWHAIHDMRVRGAPAIAIVAALSVAVE  62

Query  470  asNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI  607
              +L      +  A++   F+ +KLEY+ SSRPTAVNL +AA +L +++
Sbjct  63   LYDLIQKGKLSDQAKEVEIFIREKLEYIASSRPTAVNLVEAAGRLGKIV  111



>ref|XP_007591582.1| S-methyl-5-thioribose-1-phosphate isomerase [Colletotrichum fioriniae 
PJ7]
 gb|EXF84772.1| S-methyl-5-thioribose-1-phosphate isomerase [Colletotrichum fioriniae 
PJ7]
Length=387

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +2

Query  290  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  469
            LQA+ Y RG L++LDQ +LP +  Y ++  +++ +D IK M VRGAPAIAI AAL+ AVE
Sbjct  4    LQAVKYTRGRLEVLDQLRLPHEFHYDEVSTSEEAFDCIKSMRVRGAPAIAIVAALAHAVE  63

Query  470  asNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  646
              N       +QD V+++  +L+YL  SRPTAV+L++A  +L   I   ++   ++KTI
Sbjct  64   LHNGSCTTSASQDTVTYIDSRLDYLKESRPTAVDLTNAINQLKAHI--RSAPQDDSKTI  120



>gb|ERS95656.1| methylthioribose-1-phosphate isomerase [Sporothrix schenckii 
ATCC 58251]
Length=394

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSL +LDQ +LP +  Y  +  + + +D I+ M VRGAPAIAI A+L+LAV
Sbjct  4    TLEAIRYTRGSLDVLDQLRLPHEHHYDAVSTSSEAFDCIRSMRVRGAPAIAIVASLALAV  63

Query  467  easNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE  601
            E    +T      +AQ+AVS++  +L+YL+ SRPTAV+L++A T L +
Sbjct  64   ELGAADTQTKIGASAQEAVSYIDSRLDYLLESRPTAVDLANAITLLKK  111



>emb|CCC53713.1| putative translation initiation factor 2 subunit [Trypanosoma 
vivax Y486]
Length=384

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = +2

Query  269  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  448
            AH   +TL++I Y  G LQLLDQR+LP +T++ DI +  D   AIKEM VRGAPAIA++ 
Sbjct  2    AHPHKETLESIKYHNGKLQLLDQRRLPHETVFDDICSIGDICKAIKEMRVRGAPAIAVSG  61

Query  449  alslaveasNLETFNG--------TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLN-E  601
            AL++AV A      +G        TA +A+ F+ +  + +++SRPTAVNLS   T+L  +
Sbjct  62   ALAIAVAAE--RKLHGKDDGVPLRTADEALCFILKSCDTVMTSRPTAVNLSKTLTQLKAD  119

Query  602  VITKEASTASE  634
            ++  +A  A E
Sbjct  120  LVAAKAGRAEE  130



>ref|XP_001418690.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 sp|A4S068.1|MTNA_OSTLU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO96983.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=365

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +L+AI Y RG+L+LLDQ  LPL+T Y+D+++    W  IK+M VRGAPAIAIAAAL+LAV
Sbjct  3    SLEAIRYARGNLELLDQLALPLETKYIDVRDCNACWRCIKDMNVRGAPAIAIAAALALAV  62

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL  595
            E         T + A +F+ ++ +++ +SRPTAVNL +A  ++
Sbjct  63   ELEAKRGTLTTCEAAEAFVRERFDHMYTSRPTAVNLGEAKNRI  105



>ref|XP_002099512.1| GE23315 [Drosophila yakuba]
 sp|B4PNE2.1|MTNA_DROYA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
yakuba]
 gb|EDW99224.1| GE23315 [Drosophila yakuba]
Length=364

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 6/122 (5%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            +LQ+I Y RGSL++LDQ  LP Q+ YL ++  +DGW  I +M VRG              
Sbjct  2    SLQSIKYSRGSLEILDQLLLPGQSKYLVVRGVEDGWKVINKMQVRG-APAIAIVGCLSLA  60

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  634
               N E F  T +     +  KL YLVS+RPTAVN+  AA +L    N++   EA   +E
Sbjct  61   VEINPEDFE-TKKSLRQEIEGKLNYLVSARPTAVNMKIAADELITLANDLYKDEAINVTE  119

Query  635  AK  640
             K
Sbjct  120  MK  121



>ref|XP_004060186.1| PREDICTED: methylthioribose-1-phosphate isomerase [Gorilla gorilla 
gorilla]
Length=369

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = +2

Query  287  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  466
            TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2    TLEAIRYSRGSLQILDQLLLPQQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  467  easNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  619
            E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA
Sbjct  62   ELQAGAGGP-GLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREA  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000