BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF027O04

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    145   2e-37   Nicotiana sylvestris
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   2e-36   Nicotiana tomentosiformis
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   2e-36   Populus euphratica
ref|XP_007036519.1|  Transcription factor, putative                     141   6e-36   
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             140   1e-35   
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   4e-35   Solanum tuberosum [potatoes]
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             137   2e-34   
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   3e-34   Solanum lycopersicum
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               136   6e-34   Morus notabilis
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   3e-33   Prunus mume [ume]
emb|CDO98435.1|  unnamed protein product                                134   3e-33   Coffea canephora [robusta coffee]
gb|KJB23747.1|  hypothetical protein B456_004G113000                    133   4e-33   Gossypium raimondii
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     133   4e-33   Sesamum indicum [beniseed]
ref|XP_002531628.1|  conserved hypothetical protein                     133   7e-33   Ricinus communis
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     132   7e-33   Lagerstroemia indica [crape-myrtle]
emb|CAN73757.1|  hypothetical protein VITISV_026326                     133   9e-33   Vitis vinifera
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    132   2e-32   Nelumbo nucifera [Indian lotus]
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         131   2e-32   Jatropha curcas
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   2e-32   Nicotiana tomentosiformis
ref|XP_008393304.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   3e-32   
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    130   3e-32   Vitis vinifera
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   4e-32   Nicotiana sylvestris
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     130   5e-32   Malus domestica [apple tree]
ref|XP_002533412.1|  transcription factor, putative                     130   9e-32   Ricinus communis
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   1e-31   Fragaria vesca subsp. vesca
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    128   3e-31   Citrus sinensis [apfelsine]
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             127   4e-31   Citrus clementina [clementine]
gb|KDP20116.1|  hypothetical protein JCGZ_05885                         127   7e-31   Jatropha curcas
gb|KJB34353.1|  hypothetical protein B456_006G061600                    126   8e-31   Gossypium raimondii
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   8e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-30   Pyrus x bretschneideri [bai li]
gb|KJB34352.1|  hypothetical protein B456_006G061600                    126   1e-30   Gossypium raimondii
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                127   1e-30   
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    126   2e-30   Eucalyptus grandis [rose gum]
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   Populus euphratica
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   Populus euphratica
ref|XP_002311458.2|  zinc finger family protein                         125   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    126   2e-30   
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     125   2e-30   
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     125   3e-30   Populus euphratica
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                125   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   5e-30   Citrus sinensis [apfelsine]
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             125   6e-30   Citrus clementina [clementine]
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    124   7e-30   Vitis vinifera
emb|CDP00619.1|  unnamed protein product                                124   8e-30   Coffea canephora [robusta coffee]
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              123   2e-29   Gossypium arboreum [tree cotton]
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   3e-29   
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    123   3e-29   
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    122   3e-29   Theobroma cacao [chocolate]
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   3e-29   Solanum tuberosum [potatoes]
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             121   7e-29   Phaseolus vulgaris [French bean]
gb|AGM20692.1|  COL6-2                                                  121   9e-29   Populus tomentosa [Chinese white poplar]
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   9e-29   Cicer arietinum [garbanzo]
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   1e-28   Solanum tuberosum [potatoes]
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   1e-28   
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       120   1e-28   Glycine max [soybeans]
gb|AHI45078.1|  COL domain class transcription factor                   120   2e-28   Boehmeria nivea [Chinese silk-plant]
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                120   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  119   3e-28   Medicago truncatula
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             120   3e-28   Prunus persica
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       119   5e-28   Glycine max [soybeans]
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   5e-28   
gb|KJB34354.1|  hypothetical protein B456_006G061600                    118   7e-28   Gossypium raimondii
gb|AFK37106.1|  unknown                                                 118   9e-28   Medicago truncatula
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   9e-28   Nicotiana tomentosiformis
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    118   1e-27   Fragaria vesca subsp. vesca
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             117   1e-27   Phaseolus vulgaris [French bean]
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                118   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   2e-27   
emb|CDX81527.1|  BnaC02g18310D                                          117   2e-27   
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   2e-27   Prunus mume [ume]
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               117   3e-27   Morus notabilis
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   3e-27   Eucalyptus grandis [rose gum]
emb|CDY44890.1|  BnaA02g13920D                                          116   4e-27   Brassica napus [oilseed rape]
gb|EPS73837.1|  hypothetical protein M569_00919                         116   5e-27   Genlisea aurea
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   5e-27   Nicotiana sylvestris
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          116   7e-27   Glycine max [soybeans]
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   7e-27   Solanum lycopersicum
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     115   1e-26   Lagerstroemia indica [crape-myrtle]
ref|XP_010546462.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   2e-26   Glycine max [soybeans]
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    114   2e-26   Glycine soja [wild soybean]
ref|XP_010543105.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             114   4e-26   Phaseolus vulgaris [French bean]
emb|CDY65591.1|  BnaC05g50730D                                          113   5e-26   Brassica napus [oilseed rape]
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     113   8e-26   Brassica rapa
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             112   8e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             112   1e-25   Capsella rubella
gb|KJB16228.1|  hypothetical protein B456_002G218400                    112   1e-25   Gossypium raimondii
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   2e-25   Camelina sativa [gold-of-pleasure]
dbj|BAH19571.1|  AT1G68520                                              110   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    111   2e-25   Solanum lycopersicum
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   3e-25   
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 111   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13173.1|  unknown protein                                         111   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  111   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   4e-25   Brassica rapa
gb|AHI45077.1|  COL domain class transcription factor                   111   4e-25   Boehmeria nivea [Chinese silk-plant]
emb|CDY67920.1|  BnaAnng25560D                                          110   4e-25   Brassica napus [oilseed rape]
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   5e-25   Camelina sativa [gold-of-pleasure]
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   110   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       110   6e-25   Glycine max [soybeans]
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    110   6e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24402.1|  BnaCnng04690D                                          110   7e-25   Brassica napus [oilseed rape]
gb|AAM61001.1|  putative B-box zinc finger protein                      110   7e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       110   7e-25   Cucumis sativus [cucumbers]
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   7e-25   
gb|KEH44219.1|  zinc finger constans-like protein                       110   7e-25   Medicago truncatula
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   8e-25   Cicer arietinum [garbanzo]
gb|KHN32039.1|  Zinc finger protein CONSTANS-LIKE 16                    110   8e-25   Glycine soja [wild soybean]
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    110   9e-25   Cucumis melo [Oriental melon]
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   1e-24   
emb|CDY36106.1|  BnaA08g19420D                                          109   1e-24   Brassica napus [oilseed rape]
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       109   1e-24   Glycine max [soybeans]
gb|AFX73409.1|  constans-like protein 5                                 109   1e-24   Gossypium hirsutum [American cotton]
emb|CDY03851.1|  BnaC07g10760D                                          109   1e-24   
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   2e-24   Brassica rapa
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   2e-24   Camelina sativa [gold-of-pleasure]
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              108   2e-24   Gossypium arboreum [tree cotton]
emb|CDY51133.1|  BnaA07g37160D                                          108   2e-24   Brassica napus [oilseed rape]
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   3e-24   
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   3e-24   Tarenaya hassleriana [spider flower]
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    108   4e-24   Arabis alpina [alpine rockcress]
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002888669.1|  zinc finger (B-box type) family protein            108   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    108   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             108   5e-24   Capsella rubella
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    106   8e-24   
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             107   1e-23   
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             107   1e-23   Phaseolus vulgaris [French bean]
gb|KGN63817.1|  hypothetical protein Csa_1G023050                       106   1e-23   Cucumis sativus [cucumbers]
ref|XP_004155029.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    103   2e-23   
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    105   4e-23   Cucumis melo [Oriental melon]
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             104   6e-23   Eutrema salsugineum [saltwater cress]
gb|AGI62036.1|  CONSTANS-like 12                                        103   2e-22   Erycina pusilla
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    103   2e-22   Phoenix dactylifera
emb|CDY53119.1|  BnaCnng24470D                                          102   5e-22   Brassica napus [oilseed rape]
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    5e-21   Cucumis sativus [cucumbers]
gb|AGI62031.1|  CONSTANS-like 7                                       98.2    7e-21   Erycina pusilla
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.0    9e-21   
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.8    1e-20   Cucumis melo [Oriental melon]
gb|EPS70096.1|  hypothetical protein M569_04666                       92.4    1e-20   Genlisea aurea
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.2    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.4    3e-20   
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  96.3    7e-20   Brachypodium distachyon [annual false brome]
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.5    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  95.1    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_009409258.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.6    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    5e-19   Elaeis guineensis
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    5e-19   
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  93.2    6e-19   Phoenix dactylifera
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    9e-19   Setaria italica
gb|KHN16247.1|  Zinc finger protein CONSTANS-LIKE 16                  88.2    1e-18   Glycine soja [wild soybean]
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16             93.2    1e-18   Zea mays [maize]
ref|NP_001149548.1|  CCT motif family protein                         91.7    3e-18   Zea mays [maize]
ref|XP_002887511.1|  zinc finger (B-box type) family protein          91.3    3e-18   
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.3    4e-18   Camelina sativa [gold-of-pleasure]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                  91.7    4e-18   
gb|EEE59793.1|  hypothetical protein OsJ_12313                        88.2    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   90.9    5e-18   Camelina sativa [gold-of-pleasure]
gb|ABF98510.1|  CCT motif family protein, expressed                   89.7    8e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051053.1|  Os03g0711100                                     90.5    9e-18   
dbj|BAE98863.1|  hypothetical protein                                 88.2    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.7    2e-17   Zea mays [maize]
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg           89.4    2e-17   Capsella rubella
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                 89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01505.1|  predicted protein                                    89.0    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010479340.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    2e-16   
ref|XP_010479339.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.1    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           84.7    3e-16   
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           84.7    4e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420        85.1    6e-16   Sorghum bicolor [broomcorn]
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   84.3    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    1e-15   Elaeis guineensis
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           82.8    2e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           82.8    2e-15   
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480        83.6    3e-15   Sorghum bicolor [broomcorn]
dbj|BAC42037.1|  putative B-box zinc finger protein                   81.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAF69700.1|AC016041_5  F27J15.10                                   81.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              81.6    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 81.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04456.1|  predicted protein                                    82.4    6e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                        82.4    6e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00428.1|  hypothetical protein OsI_22452                        82.4    7e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001057333.2|  Os06g0264200                                     82.4    9e-15   
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  82.0    1e-14   
ref|XP_001759088.1|  predicted protein                                82.0    1e-14   
ref|XP_001769011.1|  predicted protein                                81.6    2e-14   
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  79.3    3e-14   Arabis alpina [alpine rockcress]
ref|XP_001765504.1|  predicted protein                                80.1    6e-14   
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    8e-14   Setaria italica
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    9e-14   
dbj|BAD15937.1|  zinc finger protein-like                             79.3    9e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.0    1e-13   
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    1e-13   Zea mays [maize]
ref|XP_001751672.1|  predicted protein                                79.3    1e-13   
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920        79.0    1e-13   
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   77.4    1e-13   
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.0    1e-13   
ref|XP_001769217.1|  predicted protein                                79.0    2e-13   
ref|NP_001140584.1|  uncharacterized protein LOC100272654             77.8    3e-13   Zea mays [maize]
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834           75.9    1e-12   Selaginella moellendorffii
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640        75.5    1e-12   Amborella trichopoda
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000           75.5    2e-12   Selaginella moellendorffii
dbj|BAJ87752.1|  predicted protein                                    75.5    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89584.1|  predicted protein                                    74.7    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY07382.1|  BnaA07g24610D                                        67.8    7e-12   Brassica napus [oilseed rape]
ref|XP_001771896.1|  predicted protein                                73.6    8e-12   
emb|CDY04231.1|  BnaC06g25840D                                        64.7    1e-10   
ref|XP_001765858.1|  predicted protein                                65.1    3e-09   
ref|XP_010479901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  64.3    6e-09   Camelina sativa [gold-of-pleasure]
gb|ACF35197.1|  COb                                                   64.3    7e-09   Brassica nigra
gb|ACF35201.1|  COb                                                   64.3    7e-09   Brassica nigra
gb|AAC27695.1|  CONSTANS homolog                                      64.3    8e-09   Brassica napus [oilseed rape]
ref|XP_001417557.1|  predicted protein                                63.9    1e-08   Ostreococcus lucimarinus CCE9901
dbj|BAL41877.1|  CO                                                   61.2    1e-08   Cardamine glauca
ref|XP_010463643.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
dbj|BAL41876.1|  CO                                                   60.8    2e-08   Cardamine resedifolia
dbj|BAL41865.1|  CO                                                   60.5    2e-08   Cardamine bellidifolia [alpine bittercress]
gb|ACM69281.1|  constans                                              63.2    2e-08   Sinapis alba [bai jie]
dbj|BAL41845.1|  CO                                                   60.5    2e-08   Cardamine nipponica
dbj|BAL41869.1|  CO                                                   60.5    2e-08   Cardamine alpina
dbj|BAL41833.1|  CO                                                   60.5    2e-08   Cardamine nipponica
ref|XP_010485483.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  62.8    2e-08   Camelina sativa [gold-of-pleasure]
dbj|BAO24102.1|  CONSTANS-like protein                                62.8    2e-08   Lemna aequinoctialis
dbj|BAL41832.1|  CO                                                   60.5    2e-08   Cardamine nipponica
ref|XP_010485482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   62.8    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006299343.1|  hypothetical protein CARUB_v10015501mg           62.8    2e-08   Capsella rubella
dbj|BAL41844.1|  CO                                                   60.5    2e-08   Cardamine nipponica
dbj|BAL41839.1|  CO                                                   60.5    2e-08   Cardamine nipponica
dbj|BAL41841.1|  CO                                                   60.5    2e-08   Cardamine nipponica
dbj|BAL41851.1|  CO                                                   60.1    3e-08   Cardamine bellidifolia [alpine bittercress]
ref|XP_002873744.1|  hypothetical protein ARALYDRAFT_488429           62.4    3e-08   
gb|KFK25822.1|  coa                                                   62.4    3e-08   Arabis alpina [alpine rockcress]
ref|XP_006844170.1|  hypothetical protein AMTR_s00006p00262710        62.4    3e-08   Amborella trichopoda
ref|XP_010913626.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   62.4    3e-08   Elaeis guineensis
ref|NP_186887.1|  zinc finger protein CONSTANS-LIKE 2                 62.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AFK29460.1|  putative flowering-time constans protein              62.0    4e-08   Arabidopsis lyrata subsp. lyrata
gb|AFK29462.1|  putative flowering-time constans protein              62.0    4e-08   Arabidopsis halleri subsp. halleri
ref|XP_010420262.1|  PREDICTED: zinc finger protein CONSTANS-like     62.4    4e-08   Camelina sativa [gold-of-pleasure]
gb|ACF35204.1|  COb                                                   62.0    4e-08   Brassica nigra
gb|AFK29459.1|  putative flowering-time constans protein              62.0    4e-08   Arabidopsis kamchatica
gb|ACF35203.1|  COb                                                   62.0    4e-08   Brassica nigra
ref|XP_002884316.1|  hypothetical protein ARALYDRAFT_477472           62.0    4e-08   
ref|XP_010102982.1|  Zinc finger protein CONSTANS-LIKE 5              62.0    4e-08   Morus notabilis
gb|ACF35205.1|  COb                                                   62.0    4e-08   Brassica nigra
gb|ACF35199.1|  COb                                                   62.0    4e-08   Brassica nigra
gb|AAC27696.1|  CONSTANS homolog                                      62.0    4e-08   Brassica napus [oilseed rape]
ref|XP_010453734.1|  PREDICTED: zinc finger protein CONSTANS-like     62.0    4e-08   Camelina sativa [gold-of-pleasure]
dbj|BAO24101.1|  CONSTANS-like protein                                61.6    5e-08   Lemna gibba
ref|XP_010914103.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  61.2    7e-08   Elaeis guineensis
ref|XP_008805435.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  61.2    7e-08   Phoenix dactylifera
gb|ABG57263.1|  CONSTANS-like 1                                       61.2    8e-08   Medicago sativa [alfalfa]
emb|CDQ51989.1|  constans like                                        59.3    8e-08   Fagus sylvatica
ref|XP_010417237.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  60.8    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006405043.1|  hypothetical protein EUTSA_v10000258mg           60.8    8e-08   Eutrema salsugineum [saltwater cress]
emb|CAL29797.1|  CONSTANS protein                                     61.2    8e-08   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|AAG27546.1|  constans-like protein                                 61.2    9e-08   Brassica nigra
ref|XP_003588808.1|  CONSTANS-like protein                            60.8    9e-08   Medicago truncatula
gb|ACF35195.1|  COa                                                   60.8    9e-08   Brassica nigra
gb|ACF35189.1|  COa                                                   60.8    9e-08   Brassica nigra
ref|XP_009121540.1|  PREDICTED: zinc finger protein CONSTANS          60.8    1e-07   
gb|ACF35187.1|  COa                                                   60.8    1e-07   
gb|ACF35196.1|  COa                                                   60.8    1e-07   
gb|ACF35180.1|  COa                                                   60.8    1e-07   
gb|ACF35181.1|  COa                                                   60.8    1e-07   
gb|ACF35158.1|  COa                                                   60.8    1e-07   
gb|ACF35193.1|  COa                                                   60.8    1e-07   
gb|ACF35176.1|  COa                                                   60.8    1e-07   
ref|XP_006294708.1|  hypothetical protein CARUB_v10023746mg           60.5    1e-07   
ref|NP_197088.1|  zinc finger protein CONSTANS                        60.8    1e-07   
gb|ACJ66258.1|  constans-like protein                                 60.8    1e-07   
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           60.5    1e-07   
ref|XP_004498823.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  60.8    1e-07   
ref|XP_002962523.1|  hypothetical protein SELMODRAFT_438224           59.7    1e-07   
ref|XP_006287957.1|  hypothetical protein CARUB_v10001192mg           60.8    1e-07   
ref|XP_006288045.1|  hypothetical protein CARUB_v10001279mg           60.8    1e-07   
gb|KFK37702.1|  hypothetical protein AALP_AA3G017800                  60.5    1e-07   
gb|KFK32611.1|  hypothetical protein AALP_AA6G266600                  60.5    1e-07   
ref|NP_197089.1|  zinc finger protein CONSTANS-LIKE 1                 60.5    1e-07   
gb|AAM62947.1|  zinc finger protein constans-like 8                   60.1    1e-07   
gb|AAN09838.1|  COL1 protein                                          60.5    1e-07   
gb|ACF35241.1|  COL1                                                  60.1    2e-07   
gb|AAN09809.1|  COL1 protein                                          60.5    2e-07   
gb|ACF35231.1|  COL1                                                  60.5    2e-07   
gb|ACF35220.1|  COL1                                                  60.5    2e-07   
gb|ACF35216.1|  COL1                                                  60.1    2e-07   
gb|AAN09808.1|  COL1 protein                                          60.5    2e-07   
gb|AAX47173.1|  CONSTANS-LIKE b                                       60.1    2e-07   
gb|AAN09841.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09813.1|  COL1 protein                                          60.1    2e-07   
gb|ACF35206.1|  COL1                                                  60.1    2e-07   
gb|AAN09828.1|  COL1 protein                                          60.1    2e-07   
gb|ACF35207.1|  COL1                                                  60.1    2e-07   
gb|AAN09815.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09810.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09820.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09846.1|  COL1 protein                                          60.1    2e-07   
gb|ACF35233.1|  COL1                                                  60.1    2e-07   
gb|ACF35219.1|  COL1                                                  60.1    2e-07   
gb|AAN09817.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09830.1|  COL1 protein                                          60.1    2e-07   
gb|AAG27547.1|  constans-like protein                                 60.1    2e-07   
gb|AAN09822.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09819.1|  COL1 protein                                          60.1    2e-07   
gb|ACF35247.1|  COL1                                                  60.1    2e-07   
gb|ACF35243.1|  COL1                                                  60.1    2e-07   
gb|ACF35228.1|  COL1                                                  60.1    2e-07   
gb|ACF35236.1|  COL1                                                  60.1    2e-07   
gb|ACF35229.1|  COL1                                                  60.1    2e-07   
gb|ACF35198.1|  COb                                                   60.1    2e-07   
gb|AAP42647.1|  constans-like protein                                 60.1    2e-07   
gb|ACF35240.1|  COL1                                                  60.1    2e-07   
gb|ACF35226.1|  COL1                                                  60.1    2e-07   
gb|AAN09826.1|  COL1 protein                                          60.1    2e-07   
gb|AAN09848.1|  COL1 protein                                          60.1    2e-07   
gb|ACF35232.1|  COL1                                                  60.1    2e-07   
gb|ABC69350.1|  constans-like                                         59.3    2e-07   
gb|AAN09831.1|  COL1 protein                                          60.1    2e-07   
gb|ADR51712.1|  Hd1-like protein                                      60.1    2e-07   
ref|XP_010268200.1|  PREDICTED: B-box zinc finger protein 24-like...  59.3    2e-07   
ref|NP_001031887.1|  zinc finger protein CONSTANS                     59.7    2e-07   
emb|CDX69493.1|  BnaA10g18420D                                        60.1    2e-07   
ref|XP_010268201.1|  PREDICTED: B-box zinc finger protein 24-like...  58.9    2e-07   
ref|XP_010259762.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  60.1    2e-07   
ref|NP_180052.1|  zinc finger protein CONSTANS-LIKE 3                 59.7    2e-07   
ref|XP_011082019.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  59.7    2e-07   
emb|CDY36171.1|  BnaC04g37230D                                        59.7    2e-07   
ref|XP_009140597.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3   59.3    2e-07   
emb|CDY45597.1|  BnaA04g14640D                                        59.3    2e-07   
ref|XP_010492434.1|  PREDICTED: zinc finger protein CONSTANS-like     59.7    2e-07   
ref|XP_007223811.1|  hypothetical protein PRUPE_ppa010704mg           58.9    2e-07   
emb|CDY71818.1|  BnaAnng38870D                                        59.3    2e-07   
ref|XP_010273779.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  59.7    2e-07   
ref|XP_008222603.1|  PREDICTED: salt tolerance protein-like           58.9    3e-07   
ref|XP_006400110.1|  hypothetical protein EUTSA_v10015486mg           59.7    3e-07   
ref|XP_002878801.1|  hypothetical protein ARALYDRAFT_481339           59.3    3e-07   
ref|XP_007223099.1|  hypothetical protein PRUPE_ppa007083mg           59.7    3e-07   
ref|XP_010472497.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  59.3    3e-07   
dbj|BAC92734.1|  Hd1-like protein                                     59.7    3e-07   
ref|XP_006400111.1|  hypothetical protein EUTSA_v10013895mg           59.7    3e-07   
ref|NP_973530.1|  zinc finger protein CONSTANS-LIKE 3                 58.2    3e-07   
gb|KFK25823.1|  hypothetical protein AALP_AA8G166000                  59.3    3e-07   
dbj|BAC92732.1|  Hd1-like protein                                     59.3    3e-07   
ref|XP_009604722.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  59.3    3e-07   
gb|ACN62415.1|  CONSTANS-like protein                                 59.3    4e-07   
gb|AFK29461.1|  putative flowering-time constans protein              59.3    4e-07   
gb|AGW80455.1|  constans-like protein                                 59.3    4e-07   
emb|CDX90969.1|  BnaC02g06280D                                        58.9    4e-07   
ref|XP_004309809.1|  PREDICTED: B-box zinc finger protein 24          58.2    4e-07   
ref|XP_001767984.1|  predicted protein                                59.3    4e-07   
gb|ADX97323.1|  CONSTANS                                              58.9    4e-07   
ref|XP_010048286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   58.9    4e-07   
ref|XP_008782090.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  59.3    4e-07   
ref|XP_008223533.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5   59.3    4e-07   
gb|AAC35496.1|  CONSTANS-like 1 protein                               58.9    4e-07   
ref|XP_002873745.1|  hypothetical protein ARALYDRAFT_488432           58.9    4e-07   
gb|KCW80523.1|  hypothetical protein EUGRSUZ_C01876                   58.9    4e-07   
gb|AAM74064.1|AF490469_1  CONSTANS-like protein                       58.9    4e-07   
gb|ACF35177.1|  COa                                                   58.9    5e-07   
gb|ACF35183.1|  COa                                                   58.9    5e-07   
gb|ACF35148.1|  COa                                                   58.9    5e-07   
ref|XP_010492435.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.9    5e-07   
gb|ACF35186.1|  COa                                                   58.9    5e-07   
ref|XP_004291989.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   58.5    5e-07   
gb|ACF35182.1|  COa                                                   58.9    5e-07   
gb|EYU22036.1|  hypothetical protein MIMGU_mgv1a008870mg              58.9    5e-07   
gb|ABK96477.1|  unknown                                               58.9    5e-07   
gb|ACF35155.1|  COa                                                   58.9    5e-07   
gb|ACF35147.1|  COa                                                   58.9    5e-07   
ref|XP_010928631.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.9    5e-07   
gb|AIE41594.1|  zinc finger protein CONSTANS-LIKE 3                   58.5    5e-07   
ref|XP_009117976.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   58.5    5e-07   
ref|XP_009373735.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   58.9    5e-07   
gb|AAQ55455.1|  Col-2-like protein                                    58.5    5e-07   
dbj|BAC92733.1|  Hd1-like protein                                     58.9    5e-07   
ref|XP_011044957.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.5    6e-07   
ref|XP_002324936.1|  CONSTANS-like protein 2                          58.5    6e-07   
ref|XP_010548562.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3   58.5    6e-07   
emb|CDY71884.1|  BnaAnng39160D                                        58.5    6e-07   
gb|ABH09237.1|  CONSTANS-like protein                                 58.5    6e-07   
ref|XP_009378311.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.5    7e-07   
gb|ADA67904.1|  CONSTANS                                              58.5    7e-07   
ref|XP_009378312.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.5    7e-07   
ref|XP_009758697.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.5    7e-07   
emb|CDX85529.1|  BnaA02g02840D                                        58.2    7e-07   
ref|XP_009777143.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    7e-07   
ref|XP_002309695.1|  CONSTANS-like protein 2                          58.5    7e-07   
ref|XP_002277953.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5   58.2    7e-07   
ref|XP_011031404.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|XP_010692981.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   58.2    8e-07   
ref|XP_004253053.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|XP_006342453.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|XP_008789696.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|XP_008341828.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|NP_001288811.1|  zinc finger protein CONSTANS-LIKE 2              58.2    8e-07   
ref|XP_009359063.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    8e-07   
ref|XP_008789698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    9e-07   
ref|XP_009359064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    9e-07   
ref|XP_011078988.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  58.2    9e-07   
ref|XP_009126071.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.8    9e-07   
ref|XP_011082793.1|  PREDICTED: B-box zinc finger protein 22-like     57.4    9e-07   
gb|ACC95130.1|  COL2                                                  57.8    1e-06   
ref|XP_010268187.1|  PREDICTED: B-box zinc finger protein 24-like...  57.0    1e-06   
gb|ADX97322.1|  CONSTANS                                              57.8    1e-06   
emb|CDY26470.1|  BnaC09g41980D                                        57.8    1e-06   
emb|CDP14453.1|  unnamed protein product                              57.8    1e-06   
ref|XP_010268186.1|  PREDICTED: B-box zinc finger protein 24-like...  57.0    1e-06   
ref|NP_001278944.1|  zinc finger protein CONSTANS-LIKE 2-like         57.8    1e-06   
emb|CAL29796.1|  CONSTANS-like1 protein                               57.8    1e-06   
ref|XP_008379481.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   57.8    1e-06   
gb|KHG25074.1|  Zinc finger CONSTANS-LIKE 4 -like protein             57.8    1e-06   
gb|AJR28784.1|  CONSTANS-like 5 protein                               57.8    1e-06   
ref|XP_009121539.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.8    1e-06   
gb|KJB55148.1|  hypothetical protein B456_009G065600                  57.8    1e-06   
gb|AJR28762.1|  CONSTANS-like 5 protein                               57.8    1e-06   
ref|XP_007011648.1|  CONSTANS-like 4                                  57.8    1e-06   
ref|XP_011462636.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5   57.8    1e-06   
gb|AJR28780.1|  CONSTANS-like 5 protein                               57.8    1e-06   
ref|XP_010108302.1|  Zinc finger protein CONSTANS-LIKE 4              57.8    1e-06   
emb|CAP09655.1|  CONSTANS protein                                     57.8    1e-06   
ref|XP_010429472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.4    1e-06   
ref|XP_009590370.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.4    1e-06   
gb|ADL36677.1|  COL domain class transcription factor                 57.8    1e-06   
ref|XP_006845571.1|  hypothetical protein AMTR_s00019p00192190        57.8    1e-06   
ref|XP_009765376.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2   57.4    1e-06   
ref|XP_002436860.1|  hypothetical protein SORBIDRAFT_10g010050        57.4    1e-06   
gb|AAM74062.1|AF490467_1  CONSTANS-like protein                       57.4    1e-06   
ref|XP_002533687.1|  zinc finger protein, putative                    57.4    1e-06   
gb|ABV55996.1|  constans                                              57.4    1e-06   
ref|XP_010420264.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.4    1e-06   
gb|KDP33477.1|  hypothetical protein JCGZ_07048                       57.4    2e-06   
gb|ABW82153.1|  Hd1                                                   57.4    2e-06   
gb|AAS00054.1|  CONSTANS-like protein CO1                             57.4    2e-06   
ref|XP_008220621.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   57.4    2e-06   
ref|XP_006450227.1|  hypothetical protein CICLE_v10008813mg           57.4    2e-06   
ref|XP_001778228.1|  predicted protein                                54.3    2e-06   
ref|NP_001233839.1|  CONSTANS 1                                       57.4    2e-06   
ref|XP_010453736.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.4    2e-06   
ref|XP_006483500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.4    2e-06   
gb|AJR28785.1|  CONSTANS-like 5 protein                               57.0    2e-06   
gb|AAX20015.1|  CONSTANS-like b                                       57.0    2e-06   
gb|AJR28808.1|  CONSTANS-like 5 protein                               57.0    2e-06   
gb|AFX73406.1|  constans-like protein 2                               57.0    2e-06   
ref|XP_007222404.1|  hypothetical protein PRUPE_ppa008143mg           57.0    2e-06   
gb|AJR28809.1|  CONSTANS-like 5 protein                               57.0    2e-06   
gb|ADW65758.1|  CONSTANS-like protein                                 57.0    2e-06   
ref|XP_004138691.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.0    2e-06   
gb|AJR28781.1|  CONSTANS-like 5 protein                               57.0    2e-06   
ref|XP_008445288.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4   57.0    2e-06   
ref|XP_010525138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  57.0    2e-06   
gb|AJR28763.1|  CONSTANS-like 5 protein                               57.0    2e-06   
gb|ADL36673.1|  COL domain class transcription factor                 56.2    2e-06   
gb|AAC99310.1|  CONSTANS-like protein 2                               57.0    2e-06   
gb|ADD60708.1|  putative heading date 1 protein                       57.0    2e-06   
ref|XP_002506129.1|  hypothetical protein MICPUN_63995                57.0    2e-06   
gb|ADN97077.1|  CONSTANS-like protein                                 56.6    2e-06   
dbj|BAQ21284.1|  Constans/Heading date 1                              57.0    2e-06   
dbj|BAQ21293.1|  Constans/Heading date 1                              57.0    2e-06   
ref|XP_008386560.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  56.6    2e-06   
gb|AHL20264.1|  salt tolerance protein                                56.2    2e-06   
dbj|BAQ21305.1|  Constans/Heading date 1                              56.6    3e-06   
dbj|BAQ21365.1|  homolog of Constans/Heading date 1                   56.6    3e-06   
dbj|BAQ21286.1|  Constans/Heading date 1                              56.6    3e-06   
ref|XP_007216433.1|  hypothetical protein PRUPE_ppa022228mg           53.9    3e-06   
gb|AAS67378.1|  CONSTANS 2                                            56.6    3e-06   
gb|ABF82229.1|  constans-like 1 protein                               56.6    3e-06   
gb|AIP90449.1|  HD1                                                   56.6    3e-06   
ref|XP_003563958.1|  PREDICTED: zinc finger protein HD1               56.6    3e-06   
gb|KEH21799.1|  zinc finger constans-like protein                     56.6    3e-06   
dbj|BAG12868.1|  B-box transcription factor                           56.6    3e-06   
dbj|BAQ21368.1|  homolog of Constans/Heading date 1                   56.6    3e-06   
dbj|BAI59737.1|  Heading date1                                        56.6    3e-06   
ref|NP_001274795.1|  CONSTANS                                         56.6    3e-06   
gb|ABF83899.2|  constance-like protein                                56.6    3e-06   
ref|XP_006373512.1|  CONSTANS-like protein CO2                        56.6    3e-06   
ref|XP_006373513.1|  hypothetical protein POPTR_0017s14410g           56.6    3e-06   
ref|XP_006338307.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  56.6    3e-06   
gb|KDP43803.1|  hypothetical protein JCGZ_23011                       56.2    3e-06   
gb|AEK05663.1|  constans-1                                            56.2    3e-06   
ref|XP_003056761.1|  predicted protein                                56.6    3e-06   
gb|AEW46250.1|  salt tolerance protein                                55.8    3e-06   



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 95/137 (69%), Gaps = 15/137 (11%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MM+S +RKTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1    MMTS-ERKTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHER  59

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL        +++  +  K V  D   S P+WH+GFTRK RTPRN K    Q       
Sbjct  60   VRL------ETSSNKSTDTKFV--DQTASQPSWHQGFTRKARTPRNGKNKSTQIGQRKKD  111

Query  585  EESVNPVLPFVPEMGSD  635
            EE++      VPEMGS+
Sbjct  112  EENM------VPEMGSE  122



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 95/137 (69%), Gaps = 15/137 (11%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MM+S+  KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1    MMTSES-KTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSVHSANQLASRHER  59

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL TSS+ +         K V  D   S P+WH+GFTRK RTPRN K    Q       
Sbjct  60   VRLETSSNKSTDT------KFV--DQTVSQPSWHQGFTRKARTPRNGKNKSTQIGQRKKD  111

Query  585  EESVNPVLPFVPEMGSD  635
            EE++      VPEMGS+
Sbjct  112  EENM------VPEMGSE  122



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 97/135 (72%), Gaps = 12/135 (9%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            RK ANA+ GKTARACDSCL KRARWFCVADDAFLCQ+CD SVHSAN LASRHQRVRL T+
Sbjct  5    RKAANAMGGKTARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLETA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK----QNSGGVAVEE  590
            SS   ++S       ++ D D SPPAWH+GFTRK RTPR+   + K    Q       E+
Sbjct  65   SSYRISSS-------LNTDQDYSPPAWHQGFTRKARTPRHNSNSNKSLLVQKLLKDDREK  117

Query  591  SVNPVLPFVPEMGSD  635
             +NP LP VPE+GS+
Sbjct  118  VLNP-LPLVPEIGSE  131



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 96/138 (70%), Gaps = 12/138 (9%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M++D +K ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1    MTTD-KKAANAMGGKTARACDGCLRKRARWYCAADDAFLCQGCDTSVHSANQLASRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT--KKQNSGGVA  581
            RL        A+    S  + +  + D+PPAWH+GFTRK RTPR  K    ++++ G V 
Sbjct  60   RL------ETASFSKFSASVTNRTNQDAPPAWHQGFTRKARTPRQNKSMLGQQKDEGKVF  113

Query  582  VEESVNPVLPFVPEMGSD  635
               S+NP+ P VPE+GS+
Sbjct  114  ---SLNPLDPVVPEIGSE  128



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 96/133 (72%), Gaps = 10/133 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            RK ANA+ GKTARACDSCL KRARWFCVADDAFLCQ+CD SVHSAN LASRHQRVRL T+
Sbjct  5    RKAANAMGGKTARACDSCLRKRARWFCVADDAFLCQACDASVHSANQLASRHQRVRLETA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRN--AKRTKKQNSGGVAVEESV  596
            SS   ++S       ++ D D SPPAWH+GFTRK RTPR+   K    Q       E+ +
Sbjct  65   SSYRISSS-------LNTDQDYSPPAWHQGFTRKARTPRHNSNKSLLVQQLLKDDREKVL  117

Query  597  NPVLPFVPEMGSD  635
            NP LP VPE+GS+
Sbjct  118  NP-LPLVPEIGSE  129



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 94/141 (67%), Gaps = 26/141 (18%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MM+S   KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVS+HSAN LASRH+R
Sbjct  1    MMTSGS-KTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHER  59

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK----RTKKQNSG  572
            VRL T S+ +          I    D    PAWH+GFTRK RTPRN K    R +K+N  
Sbjct  60   VRLDTCSNKST---------ITKLVDKTHQPAWHQGFTRKARTPRNGKKAQIRQRKKN--  108

Query  573  GVAVEESVNPVLPFVPEMGSD  635
                EE+       VPE+GSD
Sbjct  109  ----EENR------VPEIGSD  119



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 11/136 (8%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSSD +K ANA+ GKTARACDSCL KRARW+C ADDAFLCQ CD SVHSAN LA RH RV
Sbjct  1    MSSD-KKVANAVGGKTARACDSCLRKRARWYCAADDAFLCQGCDASVHSANPLARRHGRV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL        A+   +   +V++      PAWH+GFTRK RTPR+ K T  Q S     E
Sbjct  60   RL------KTASFKPNDDSLVENYV----PAWHQGFTRKARTPRHGKPTALQQSKSTDHE  109

Query  588  ESVNPVLPFVPEMGSD  635
            E +   LP VPEMGS+
Sbjct  110  EPIPNPLPLVPEMGSE  125



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 15/133 (11%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            ++K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RV+L  
Sbjct  4    EKKAANAVGGNTARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKLQA  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR---TKKQNSGGVAVEE  590
            +SS +  ++LL++ +        SPPAWH+GFTRK RTPR+  +     K +   V    
Sbjct  64   ASSKSNQSTLLAADQ--------SPPAWHKGFTRKARTPRHNNKPPFMAKDDKEKV----  111

Query  591  SVNPVLPFVPEMG  629
            S+NP LPFVPE+G
Sbjct  112  SLNPPLPFVPEIG  124



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MM+S + KTANAI GKTARACDSCLSKRARWFC ADDAFLCQSCDVS+HSAN LASRH+R
Sbjct  1    MMTS-ESKTANAIGGKTARACDSCLSKRARWFCPADDAFLCQSCDVSIHSANQLASRHER  59

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK  557
            VRL          +  +   I    D    P+WH+GFTRK RTPRN K+ +
Sbjct  60   VRL---------ETCSNKSTITKLVDKTHQPSWHQGFTRKARTPRNGKKAQ  101



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 92/137 (67%), Gaps = 11/137 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +KTANA++GKTARACDSCL KRARWFC ADDAFLCQ+CD SVHSAN LASRH+RVRL TS
Sbjct  5    KKTANAMAGKTARACDSCLRKRARWFCAADDAFLCQACDTSVHSANQLASRHERVRLQTS  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            S               D  DD+  PAWHRGFTRK RTPR+  +   Q +    VE+ ++ 
Sbjct  65   SHKGNYNHSHH-----DLHDDECSPAWHRGFTRKARTPRHNNKPAAQQAKYDDVEKVLSA  119

Query  603  V------LPFVPEMGSD  635
                   LPFVPEM ++
Sbjct  120  ANHRHDPLPFVPEMSNE  136



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 91/132 (69%), Gaps = 15/132 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
             K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RV+L  +
Sbjct  4    EKKANAMGGNTARACDSCLIKRARWFCAADDAFLCQRCDGSVHSANQLASRHERVKLQAA  63

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR---TKKQNSGGVAVEES  593
            SS    ++LL++ +        SPPAWH+GFTRK RTPR+  +     K +   V    S
Sbjct  64   SSKPNQSTLLAADQ--------SPPAWHKGFTRKARTPRHNNKPPFMAKDDKEKV----S  111

Query  594  VNPVLPFVPEMG  629
            +NP LPFVPE+G
Sbjct  112  LNPPLPFVPEIG  123



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 83/130 (64%), Gaps = 11/130 (8%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            KTAN + GKTARACDSCL KRARWFC ADDAFLCQ+CD SVHSAN LASRH+R+RL TSS
Sbjct  6    KTANVLGGKTARACDSCLKKRARWFCAADDAFLCQACDTSVHSANQLASRHERIRLATSS  65

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPV  605
                         I    D++S P WH+GFTRK RTPRN K +              NP 
Sbjct  66   FM----------PIETKGDENSLPTWHQGFTRKARTPRNNKASLVHQPKDEEKMAKANP-  114

Query  606  LPFVPEMGSD  635
            LP VPE+  D
Sbjct  115  LPLVPEISGD  124



>gb|KJB23747.1| hypothetical protein B456_004G113000 [Gossypium raimondii]
Length=418

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 85/131 (65%), Gaps = 8/131 (6%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K AN + GKTARACD CL KRARW+C  DDAFLCQ CD SVHSAN LASRH+RV L   
Sbjct  5    KKAANVMGGKTARACDGCLQKRARWYCADDDAFLCQGCDTSVHSANQLASRHERVSL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
                  AS   +  +    D D+PPAWH+GFTRK RT R  K    Q  G   V  ++NP
Sbjct  62   ----QTASSNFNASMHSTIDQDAPPAWHQGFTRKARTARQNKPMLGQQKGEGTV-LALNP  116

Query  603  VLPFVPEMGSD  635
            + PFVPE+GS+
Sbjct  117  IDPFVPEVGSE  127



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 84/137 (61%), Gaps = 21/137 (15%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M   DQ K ANA+ GKTARACDSCL KRARWFC ADDAFLCQSCDVSVHSAN LASRH+R
Sbjct  1    MNIVDQCKAANALGGKTARACDSCLLKRARWFCAADDAFLCQSCDVSVHSANQLASRHER  60

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL  SS                  +  S PAWH+GFTRK RTPR  K   +       +
Sbjct  61   VRLEASS--------------FKGSEGHSSPAWHQGFTRKARTPRQGKPAAR-------L  99

Query  585  EESVNPVLPFVPEMGSD  635
            +   N   P VPE+ ++
Sbjct  100  QPLANHAFPLVPEINAE  116



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 86/131 (66%), Gaps = 8/131 (6%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA++GKTARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL  S
Sbjct  5    KNVANAVAGKTARACDSCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRLKIS  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            S  +          I       + P+WH+GFTRK RTPRN    K   S     E+S NP
Sbjct  65   SLKSLDI-------ISKGSSVITVPSWHQGFTRKARTPRNGHGNKPLLSLLKIEEKSRNP  117

Query  603  VLPFVPEMGSD  635
            + P VPE+GSD
Sbjct  118  I-PLVPEVGSD  127



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            Q K +N + GKTARACD+CL KRARWFC  DDAFLCQSCD SVHSANLLASRH+RVRL  
Sbjct  8    QSKASNVLGGKTARACDNCLVKRARWFCPGDDAFLCQSCDHSVHSANLLASRHKRVRL--  65

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
                   +S     +I+ D+   SPP+WH GFTRK RTPR  +RT + +   + +   +N
Sbjct  66   -----ETSSSSFKKEILIDNSTTSPPSWHHGFTRKARTPRPWRRTPQLDRHQLPLVPEIN  120

Query  600  PVLPFVPE  623
               PF+ E
Sbjct  121  SEDPFMEE  128



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +3

Query  222  RMMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQ  401
            + M   Q K ANA+ GKTARACD+CL KRARW+C ADDAFLCQ+CD SVHSAN LA RH+
Sbjct  63   QQMDLTQAKVANAMGGKTARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHE  122

Query  402  RVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVA  581
            RVRL             +S K  D   D+S PAWH+GFTRK R+PRN KRT  Q S    
Sbjct  123  RVRL-----------QAASCKNADSMRDNSTPAWHQGFTRKARSPRNVKRTSVQPS---K  168

Query  582  VEESVNPVLPFVPEMGSD  635
             E       P VPE+GS+
Sbjct  169  HENKFPTPPPLVPEIGSE  186



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 90/138 (65%), Gaps = 15/138 (11%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSSD +K ANA+ GKTARACDSCL KRARW+C ADDAFLCQ CD SVHSAN LA RH+RV
Sbjct  1    MSSD-KKAANAVGGKTARACDSCLRKRARWYCAADDAFLCQGCDSSVHSANPLARRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S                   ++S PAWH+GFTRK RTPR+ K    Q      VE
Sbjct  60   RLKTASIKPMLND--------GFLVENSAPAWHQGFTRKARTPRHVKPAALQPP---KVE  108

Query  588  ESV--NPVLPFVPEMGSD  635
            E +  NP LP VPEMG +
Sbjct  109  EPILLNP-LPLVPEMGGE  125



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 85/132 (64%), Gaps = 12/132 (9%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4    HKNVANAVGGKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKT  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
            +S  +       S   V        P+WH+GFTRK RTPR+ K     +      EE + 
Sbjct  64   ASLKSLNLFSKESTSCV--------PSWHQGFTRKARTPRHGKSVNFISKN----EEKIR  111

Query  600  PVLPFVPEMGSD  635
              +PFVPE+GSD
Sbjct  112  NHIPFVPELGSD  123



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 88/136 (65%), Gaps = 20/136 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M+S ++K AN +  KTARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  1    MTSSEKKIANVVGAKTARACDSCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL TSS  ++           +  +  S P+WHRGFTRK RTPRN K ++K         
Sbjct  61   RLKTSSLKSSD----------EFSNSVSVPSWHRGFTRKARTPRNGKNSRKVK-------  103

Query  588  ESVNPVLPFVPEMGSD  635
               NP+   VPE+ SD
Sbjct  104  ---NPIQLVVPEILSD  116



>ref|XP_008393304.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=349

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 84/134 (63%), Gaps = 19/134 (14%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL   
Sbjct  5    KKAANAMGGNTARACDSCLVKRARWFCXADDAFLCQRCDASVHSANQLASRHERVRL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES---  593
                   S   + + +    D + PAWH GF RK R PR+       N  G AV+E    
Sbjct  62   -----QGSSFKANEPMQLTADQATPAWHNGFKRKARXPRH------NNKPGFAVKEEQEK  110

Query  594  --VNPVLPFVPEMG  629
              ++P LPFVPE+G
Sbjct  111  LGLHPPLPFVPEIG  124



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 86/131 (66%), Gaps = 14/131 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ GKTARACD+CL KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  +
Sbjct  5    KKVANAMGGKTARACDNCLHKRARWYCGADDAFLCQACDASVHSANQLAERHERVRLQAA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            S            K  D   D+S PAWH+GFTRK R+PRN KRT  Q S     E     
Sbjct  65   SC-----------KNADSMRDNSTPAWHQGFTRKARSPRNVKRTSVQPSKH---ENKFPT  110

Query  603  VLPFVPEMGSD  635
              P VPE+GS+
Sbjct  111  PPPLVPEIGSE  121



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 88/136 (65%), Gaps = 21/136 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M+S ++K AN +  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MTSSEKKLANVVGAKTARACDSCIRKRARWYCAADDAFLCQTCDSSVHSANPLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S            K  D ++  S P+WHRGFTRK RTPR  K     NSG +   
Sbjct  61   RLKTASL-----------KSSDSENSASVPSWHRGFTRKARTPRIGK-----NSGSIK--  102

Query  588  ESVNPVLPFVPEMGSD  635
               NP+   VPE+ SD
Sbjct  103  ---NPIQLIVPEISSD  115



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 86/133 (65%), Gaps = 17/133 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD  VHSAN LASRHQRVRL  S
Sbjct  5    KKAANAMGGNTARACDSCLVKRARWFCAADDAFLCQRCDALVHSANQLASRHQRVRLQGS  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  590
            S    A+        V    D + PAWH+GF RK RTPR+ K+      G  A +E    
Sbjct  65   SVKANAS--------VQLIADQAAPAWHKGFKRKARTPRHNKK-----PGFAAKDEQEKV  111

Query  591  SVNPVLPFVPEMG  629
             ++P LPFVPE+G
Sbjct  112  GLHPPLPFVPEIG  124



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 87/133 (65%), Gaps = 17/133 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ G T+RACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL  S
Sbjct  5    KKAANAMGGNTSRACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRLQGS  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE----  590
            S    A+        V    D + PAWH+GF RK RTPR+  +      G VA +E    
Sbjct  65   SFKANAS--------VQLIADQAAPAWHKGFKRKARTPRHNNK-----PGFVAKDEQEKV  111

Query  591  SVNPVLPFVPEMG  629
             ++P LPFVPE+G
Sbjct  112  GLHPPLPFVPEIG  124



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (69%), Gaps = 16/137 (12%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M++D RK ANA+SGKTARACD C  KRARWFC ADDAFLCQ+CD SVHSAN LASRH+RV
Sbjct  1    MTND-RKAANALSGKTARACDGCSRKRARWFCAADDAFLCQACDDSVHSANQLASRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK-QNSGGVAV  584
            RL T+SS  +             +  DS PAWH+GF RK RTPRN+   ++ ++   V V
Sbjct  60   RLETASSKISG----------SRNTVDSVPAWHQGFIRKARTPRNSSNKQQLKDEDKVLV  109

Query  585  EESVNPVLPFVPEMGSD  635
               +NP LP VPE+G +
Sbjct  110  ---MNP-LPLVPEIGGE  122



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 85/132 (64%), Gaps = 13/132 (10%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            ++K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSANLLASRH+RVRL +
Sbjct  4    EKKAANAMGGNTARACDSCLVKRARWFCGADDAFLCQRCDASVHSANLLASRHERVRLKS  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
            SS   +    +  P           PAW +G TRK RTPR     K   SG     +++ 
Sbjct  64   SSHKVSDHLAIEPP----------VPAWQQGVTRKARTPRGHGNHK---SGKDEAGKALG  110

Query  600  PVLPFVPEMGSD  635
              +PFVPE+GS+
Sbjct  111  QSMPFVPEIGSE  122



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 19/134 (14%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ G TARACDSCL KRARWFC ADDAFLCQ CD SVHSAN LASRH+RVRL   
Sbjct  5    KKAANAMGGNTARACDSCLVKRARWFCAADDAFLCQRCDASVHSANQLASRHERVRL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES---  593
                   S   + + +    D + PAWHRG  RK RTPR+ K+       G  ++E    
Sbjct  62   -----QGSSFKANEPMQLTADQATPAWHRGVKRKARTPRHNKKP------GFPIKEEQEK  110

Query  594  --VNPVLPFVPEMG  629
              ++P LPFVPE+G
Sbjct  111  VGLHPPLPFVPEIG  124



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 12/136 (9%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M + +++TANA+ GKTARACD CL KRARW+CVADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1    MMTGEKRTANAMGGKTARACDGCLRKRARWYCVADDAFLCQGCDASVHSANQLASRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL      TA++   ++  I +  D D+ P WH+GFTRK RTPR        N+    + 
Sbjct  61   RL-----ETASSCNNNNKLINEHTDKDTVPVWHQGFTRKARTPR-------HNNNKAMLM  108

Query  588  ESVNPVLPFVPEMGSD  635
            +      P VPE+G +
Sbjct  109  QQAKANEPLVPEIGCE  124



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 12/136 (9%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M + +++TANA+ GKTARACD CL KRARW+CVADDAFLCQ CD SVHSAN LASRH+RV
Sbjct  1    MMTGEKRTANAMGGKTARACDGCLLKRARWYCVADDAFLCQGCDASVHSANQLASRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL      TA++   ++  I +  D D+ P WH+GFTRK RTPR        N+    + 
Sbjct  61   RL-----ETASSCNNNNKLINEHTDKDTVPVWHQGFTRKARTPR-------HNNNKAMLV  108

Query  588  ESVNPVLPFVPEMGSD  635
            +      P VPE+G +
Sbjct  109  QQAKANEPLVPEIGCE  124



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 20/133 (15%)
 Frame = +3

Query  237  DQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  416
            ++RK ANA+SGKTARAC+ C  KRARWFC ADDAFLCQSCD SVHSAN LA RH+RVRL 
Sbjct  3    NERKAANALSGKTARACEGCSRKRARWFCAADDAFLCQSCDESVHSANQLARRHERVRL-  61

Query  417  tsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV  596
                     S    P + ++      PAWH+GFTRK RTPR+   + K+           
Sbjct  62   --------ESSSFKPTVSNEYI----PAWHQGFTRKARTPRHNNNSNKKIFNN-------  102

Query  597  NPVLPFVPEMGSD  635
            N  LP VPE+G++
Sbjct  103  NSNLPLVPEIGNE  115



>gb|KJB34353.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=334

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 88/134 (66%), Gaps = 10/134 (7%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD+R  ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH RV
Sbjct  1    MISDKR-AANAMGGKTARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+SS   A+ + +        D D+PPAWH+GFTRK RTPR  +    Q       E
Sbjct  60   RLETASSRFNASVINN-----SATDQDAPPAWHQGFTRKARTPRQNRSILGQQKS----E  110

Query  588  ESVNPVLPFVPEMG  629
              V  + P VPE+G
Sbjct  111  GKVWDLNPLVPEVG  124



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 85/134 (63%), Gaps = 20/134 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD +K ANA+SGKTARACD C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MISD-KKIANAVSGKTARACDCCIRKRARWYCPADDAFLCQTCDSSVHSANQLARRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S   +           DD      P+WHRG TRKPRTPR+ K   K         
Sbjct  60   RLKTASLRRS-----------DDHQQTDIPSWHRGLTRKPRTPRHGKHQSKT--------  100

Query  588  ESVNPVLPFVPEMG  629
            E  NP+   VPE+G
Sbjct  101  EERNPLHVIVPELG  114



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD  VHSAN LA RH+RV L   
Sbjct  5    KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSDVHSANQLARRHERVLL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
             ++++        +        + P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62   KTASSLKPSNKDDRTTAVSKTSAAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>gb|KJB34352.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=414

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 88/134 (66%), Gaps = 10/134 (7%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD+R  ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH RV
Sbjct  1    MISDKR-AANAMGGKTARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+SS   A+ + +        D D+PPAWH+GFTRK RTPR  +    Q       E
Sbjct  60   RLETASSRFNASVINN-----SATDQDAPPAWHQGFTRKARTPRQNRSILGQQKS----E  110

Query  588  ESVNPVLPFVPEMG  629
              V  + P VPE+G
Sbjct  111  GKVWDLNPLVPEVG  124



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 16/133 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA+ G+TARACDSC+ KRA W+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  596
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +EE+  
Sbjct  64   ASLKSSD----------AGSKENSMPSWHGGFTRKARTPRHGKPVSRSK-----IEETTR  108

Query  597  NPVLPFVPEMGSD  635
            N  +P VPE+GSD
Sbjct  109  NIPIPLVPEVGSD  121



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 85/137 (62%), Gaps = 19/137 (14%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA SGKTARACD+C+ +RARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL T
Sbjct  9    HKNAANAFSGKTARACDNCIQRRARWYCAADDAFLCQSCDRSVHSANPLARRHERVRLKT  68

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR-----TKKQNSGGVAV  584
            +++                     P +WHRGFT+KPRTPR AK      TK +N+     
Sbjct  69   AATPQKHLGE------FSSHHRKKPSSWHRGFTKKPRTPRGAKSALHRATKPENA-----  117

Query  585  EESVNPVLPFVPEMGSD  635
              + NP  P VPE+G D
Sbjct  118  --ARNP-FPVVPEVGGD  131



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 16/133 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA+ G+TARACDSC+ KRARW+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  596
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +E++  
Sbjct  64   ASHKSSG----------AGSQENSMPSWHGGFTRKARTPRHGKPVSQSK-----IEKTKR  108

Query  597  NPVLPFVPEMGSD  635
            N  +P VPE+GSD
Sbjct  109  NIPIPLVPEVGSD  121



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5    KKVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            SS   +     +  +    +  + P+WHRGFTRK RTPR  K            ++ V  
Sbjct  65   SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----QDGVRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5    KKVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            SS   +     +  +    +  + P+WHRGFTRK RTPR  K            ++ V  
Sbjct  65   SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----QDGVRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 16/133 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA+ G+TARACDSC+ KRARW+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVGGRTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  596
            +S  ++               ++S P+WH GFTRK RTPR+ K   +       +E++  
Sbjct  64   ASHKSSG----------AGSQENSMPSWHGGFTRKARTPRHGKPVSQSK-----IEKTKR  108

Query  597  NPVLPFVPEMGSD  635
            N  +P VPE+GSD
Sbjct  109  NIPIPLVPEVGSD  121



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 85/132 (64%), Gaps = 16/132 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            + +ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  5    KSSANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-N  599
                      S   +     ++S P+WH GFTRK RTPR+ K   +       + E++ N
Sbjct  62   -------KTASLKSLDLCSKENSVPSWHGGFTRKARTPRHGKPVSQSK-----IAETIRN  109

Query  600  PVLPFVPEMGSD  635
              +P VPE+GSD
Sbjct  110  IPIPLVPEVGSD  121



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD +VHSAN LA RH+RV L   
Sbjct  5    KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
             ++++        +          P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62   KTASSLKPSNKDDRTXAVSKTSXAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K A+A+ GKTARACDSC+ KRARW+C ADDAFLC++CD +VHSAN LA RH+RV L   
Sbjct  5    KKVAHAVGGKTARACDSCIKKRARWYCAADDAFLCEACDSAVHSANDLARRHERVLL---  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
             ++++        +          P+WHRGFTRKPRTPR  K            +E +  
Sbjct  62   KTASSLKPSNKDDRTXAVSKTSXAPSWHRGFTRKPRTPRGGKSMTHHGKS----KEGIRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (64%), Gaps = 16/133 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             + +ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  
Sbjct  4    NKSSANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL--  61

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  596
                       S   +     ++S P+WH GFTRK RTPR+ K   +       + E++ 
Sbjct  62   --------KTASLKSLDLCSKENSVPSWHGGFTRKARTPRHGKPVSQSK-----IAETIR  108

Query  597  NPVLPFVPEMGSD  635
            N  +P VPE+GSD
Sbjct  109  NIPIPLVPEVGSD  121



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 83/134 (62%), Gaps = 19/134 (14%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSSD  K +NA+ GK+ARACDSCL KRARWFC ADDAFLCQSCD SVHSAN LASRH RV
Sbjct  1    MSSDSSKVSNALGGKSARACDSCLVKRARWFCAADDAFLCQSCDASVHSANQLASRHDRV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGF-TRKPRTPRNAKRTKKQNSGGVAV  584
            RL                K  +     + PAW +GF TRK RTPR+ K T K+    +  
Sbjct  61   RLD---------------KTSNASPPANAPAWQQGFTTRKARTPRHGKPTTKR---LLHE  102

Query  585  EESVNPVLPFVPEM  626
                N +LP VPE+
Sbjct  103  YPPANQLLPPVPEI  116



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 83/131 (63%), Gaps = 7/131 (5%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +K A+A+ GKTARACDSC+ KRARW+C ADD FLCQ+CD +VHSAN LA RH+RV L T+
Sbjct  5    KKVAHAVGGKTARACDSCIKKRARWYCAADDGFLCQACDSAVHSANQLAHRHKRVLLKTA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            SS   +     +  +    +  + P+WHRGFTRK RTPR  K            EE V  
Sbjct  65   SSLKPSNKDDRASAV---SETSAAPSWHRGFTRKARTPRGGKSMTHHGKS----EEGVRN  117

Query  603  VLPFVPEMGSD  635
            + P VPE+G D
Sbjct  118  LFPQVPEVGGD  128



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 86/134 (64%), Gaps = 20/134 (15%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S  +  ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2    SSNKNVANAVGGKTARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
             T+S+ ++ +  LS    V        P+WHRGFTRK RTPR   +  +           
Sbjct  62   KTASNKSSGSESLSDNTHV--------PSWHRGFTRKARTPRKTGKPIR-----------  102

Query  594  VNPVLPFVPEMGSD  635
             N  LP VPE+G+D
Sbjct  103  -NVTLPLVPEVGAD  115



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 86/134 (64%), Gaps = 20/134 (15%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S  +  ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2    SSNKNVANAVGGKTARACDNCIKKRARWYCAADDAFLCQACDASVHSANPLARRHERVRL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
             T+S+ ++ +  LS    V        P+WHRGFTRK RTPR   +  +           
Sbjct  62   KTASNKSSGSESLSDNTHV--------PSWHRGFTRKARTPRKTGKPIR-----------  102

Query  594  VNPVLPFVPEMGSD  635
             N  LP VPE+G+D
Sbjct  103  -NVTLPLVPEVGAD  115



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 13/132 (10%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            ++  ANA+ GKTARACDSC+ KRAR++C ADDAFLCQ+CD+SVHSAN LA RH+RVRL T
Sbjct  4    EKNVANAVGGKTARACDSCIRKRARFYCAADDAFLCQACDMSVHSANPLARRHERVRLKT  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
            +S                D  ++S P+WH+GFTRK RTPR+ K     +    + E + N
Sbjct  64   ASLKLPG----------ADSLENSMPSWHQGFTRKARTPRHGK--PAAHPAFKSDELTRN  111

Query  600  PVLPFVPEMGSD  635
            P LPFVPE+G+D
Sbjct  112  P-LPFVPEIGAD  122



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 88/136 (65%), Gaps = 16/136 (12%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD RK ANA+ GKTARACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MVSD-RKLANAMGGKTARACDNCIRKRARWYCAADDAFLCQNCDASVHSANPLARRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL TSS   +           +   + S P+WHRGFT+K RTPR+ K  K ++      +
Sbjct  60   RLKTSSLKPSK----------ELSLEISVPSWHRGFTKKARTPRSGKHAKSKSD-----Q  104

Query  588  ESVNPVLPFVPEMGSD  635
            E     L  VPE+ SD
Sbjct  105  EPARSPLHLVPEICSD  120



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 90/135 (67%), Gaps = 12/135 (9%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD+R  ANA+ GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH RV
Sbjct  1    MISDKR-AANAMGGKTARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK-KQNSGGVAV  584
            RL T+SS   A+ + +        D D+ PAWH+GFTRK RTPR  +  + +Q S G   
Sbjct  60   RLETASSRFNASVINN-----SATDQDALPAWHQGFTRKARTPRQNRSIQGQQKSDG---  111

Query  585  EESVNPVLPFVPEMG  629
               V  + P VPE+G
Sbjct  112  --KVWDLNPLVPEVG  124



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD RK ANA+ GK+ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  7    MVSD-RKLANAVGGKSARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERV  65

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S S+      +  +I       S P+WH+GFTRK RTPR  K  K  N+    + 
Sbjct  66   RLKTASISSFDDGSKAGLQI-------SVPSWHQGFTRKARTPRQKKPGKLINNSEDPIN  118

Query  588  ESVNPVLPFVPEM  626
               +P L  VPE+
Sbjct  119  RISHP-LHLVPEI  130



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 92/137 (67%), Gaps = 11/137 (8%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+SSD RK A A+ GK+ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1    MVSSD-RKLATAVGGKSARACDNCVKKRARWYCTADDAFLCQSCDSSVHSANPLARRHER  59

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL T+S+ ++     S  ++       S P+WH+GFTRK RTPR  K  +  +   V+ 
Sbjct  60   VRLKTASTKSSDDESRSGLQV-------SVPSWHQGFTRKARTPRQKKHNRLSSDELVS-  111

Query  585  EESVNPVLPFVPEMGSD  635
               ++  L  VPE+ S+
Sbjct  112  --GISNPLHLVPEVCSE  126



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+
Sbjct  5    KNVANAVGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRLKTA  64

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            S  ++           +   +   P+WH+GFTRK RT R  K +  Q       + + NP
Sbjct  65   SLQSSGH---------EAPLESFAPSWHKGFTRKARTRRPTKASIHQKLKAEHTKRNSNP  115

Query  603  VLPFVPEMGSD  635
              P VPE+G+D
Sbjct  116  -FPLVPEIGAD  125



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (66%), Gaps = 8/137 (6%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4    ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKT  63

Query  420  ---sssstaaasllssPKIVd--dddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
                  S++++S    P +         S P+WHRGFTRK RTPR+ ++  K    G  +
Sbjct  64   SSLKQPSSSSSSDDYFPDLESPLSISSVSVPSWHRGFTRKVRTPRHGRKASKSAGDGDVI  123

Query  585  EESVNPVLPFVPEMGSD  635
            +   NP+   VPE+ SD
Sbjct  124  QR--NPI-HLVPEILSD  137



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 76/133 (57%), Gaps = 19/133 (14%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+  KTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  5    KDAGALGAKTARACDSCISRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRL----  60

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR---NAKRTKKQNSGGVAVEESV  596
                        +        +  AWH GFTRK RTPR   N+K +  Q      V  + 
Sbjct  61   ------------QTASSKVATTTHAWHSGFTRKARTPRHNNNSKHSALQQRLKEEVLFNN  108

Query  597  NPVLPFVPEMGSD  635
              VLP VPE+G +
Sbjct  109  GSVLPLVPELGGE  121



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 86/133 (65%), Gaps = 16/133 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
             +  ANA+ G+TARACDSC+ KRA W+C ADDAFLCQ+CD SVHSANLLA RH+RVRL +
Sbjct  4    NKSLANAVRGRTARACDSCIKKRASWYCAADDAFLCQACDSSVHSANLLARRHERVRLKS  63

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV-  596
            +S  ++               ++S P+ H GFTRK RTPR+ K   +       +EE+  
Sbjct  64   ASLKSSD----------AGSKENSMPSGHGGFTRKARTPRHGKPVSRSK-----IEETTR  108

Query  597  NPVLPFVPEMGSD  635
            N  +P VPE+GSD
Sbjct  109  NIPIPLVPEVGSD  121



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 18/139 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+ GKTARACD+C++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+
Sbjct  3    KNVANAVGGKTARACDNCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK--------RTKKQNSGGV  578
            S  +  +   S   I      +  P+WH GFT+K RTPR+ K        +T K +S G 
Sbjct  63   SYKSTGSGSGSGEFI------NCGPSWHHGFTKKARTPRHGKQYSASTTLQTTKSSSPG-  115

Query  579  AVEESVNPVLPFVPEMGSD  635
               ++ NP    VPEMG D
Sbjct  116  --RKNYNP-FHLVPEMGFD  131



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S ++K ANA+  KTARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL
Sbjct  2    SSEKKLANAVGAKTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRL  61

Query  414  Gtsssstaaas-llssPKIVddddddSPPAWHRGFTRKPRTPR----NAKRTKKQNSGGV  578
             TSS  ++     L S         +S P+WHRGFTRK RTPR    +AKR K       
Sbjct  62   KTSSIKSSDEFPNLGSTVSGSGSGSESVPSWHRGFTRKARTPRHGNKHAKRVKSTEEEEE  121

Query  579  AVEESVNPVLPFVPEMGSD  635
              EE  NP+   VPE+ SD
Sbjct  122  DEEEMKNPIQLVVPEILSD  140



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 79/131 (60%), Gaps = 18/131 (14%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+ GKTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  5    KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRL----  60

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNSGGVAVEESVNP  602
                     +S K+       +  AWH GFTRK RTPR N+K    Q      V  +   
Sbjct  61   -------QTASSKVT------TTHAWHSGFTRKARTPRHNSKHFALQQRLKDEVLFNNTS  107

Query  603  VLPFVPEMGSD  635
            VLP VPE+G +
Sbjct  108  VLPLVPELGGE  118



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 79/131 (60%), Gaps = 18/131 (14%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+ GKTARACDSC+S+RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL    
Sbjct  2    KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHGCDTLVHSANQLASRHERVRL----  57

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNSGGVAVEESVNP  602
                     +S K+       +  AWH GFTRK RTPR N+K    Q      V  +   
Sbjct  58   -------QTASSKVT------TTHAWHSGFTRKARTPRHNSKHFALQQRLKDEVLFNNTS  104

Query  603  VLPFVPEMGSD  635
            VLP VPE+G +
Sbjct  105  VLPLVPELGGE  115



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 88/136 (65%), Gaps = 8/136 (6%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MS  +   +  +  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1    MSCKKAVPSGVVGYKTARACDSCVKKRARWYCAADDAFLCQACDNSVHSANSLARRHTRV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+SSS +++S  S  K          P WHRGFTRK RTPR+  ++K  +     VE
Sbjct  61   RLKTASSSPSSSSSWSRDK--------PAPTWHRGFTRKARTPRSNGKSKTNSDHVPHVE  112

Query  588  ESVNPVLPFVPEMGSD  635
             S +P+ P VPE+  D
Sbjct  113  ASRDPMFPVVPEIFGD  128



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 80/133 (60%), Gaps = 20/133 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD RK ++ I GK+ARACDSC+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RV
Sbjct  1    MDSD-RKLSDTIVGKSARACDSCIKKRARWYCAADDAFLCQSCDSSVHSANSLARRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
             L             S  KI        P  WH+GFTRK RTPR+    KK      A+ 
Sbjct  60   LL----------KSASIHKI-----KSEPSNWHQGFTRKARTPRH----KKNGKAAAALF  100

Query  588  ESVNPVLPFVPEM  626
             + N  LP VPE+
Sbjct  101  SNTNHPLPLVPEI  113



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 74/130 (57%), Gaps = 18/130 (14%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            A A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSANLLASRH+RVRL      
Sbjct  11   AGALGAKTARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRHERVRL------  64

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV--NPV  605
                      +        +  AWH GFTRK RTPR+ K +  Q       E+ +     
Sbjct  65   ----------QTASAKVTTTAQAWHSGFTRKARTPRHNKNSSIQQQQQRLKEKVLFNTSF  114

Query  606  LPFVPEMGSD  635
            LP VPE+G +
Sbjct  115  LPLVPELGGE  124



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 80/134 (60%), Gaps = 13/134 (10%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S  +K ANA+  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV L
Sbjct  2    SSNKKVANAVGAKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
                 + ++         V   D+ + P+WH GFTRK RTPR  K            +E 
Sbjct  62   ----KTASSVKPTDKDDQVSVSDNPAAPSWHGGFTRKARTPRQGKHKS---------QEG  108

Query  594  VNPVLPFVPEMGSD  635
                 P VPE+G+D
Sbjct  109  ARNRFPQVPEVGAD  122



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 76/132 (58%), Gaps = 17/132 (13%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+ GKTARACDSC+S+RARWFC ADDAFLC +CD  VHSAN LASRH+RVRL    
Sbjct  5    KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRL----  60

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR--NAKRTKKQNSGGVAVEESVN  599
                                 +  AWH GFTRK RTPR  N+K    Q      V  +  
Sbjct  61   -----------QTASSKATTTTTHAWHSGFTRKARTPRHNNSKHFALQQRLKDEVLFNNT  109

Query  600  PVLPFVPEMGSD  635
             VLP VPE+G +
Sbjct  110  SVLPLVPELGGE  121



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 76/132 (58%), Gaps = 17/132 (13%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+ GKTARACDSC+S+RARWFC ADDAFLC +CD  VHSAN LASRH+RVRL    
Sbjct  5    KDAGALGGKTARACDSCVSRRARWFCAADDAFLCHACDTLVHSANQLASRHERVRL----  60

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR--NAKRTKKQNSGGVAVEESVN  599
                                 +  AWH GFTRK RTPR  N+K    Q      V  +  
Sbjct  61   -----------QTASSKATTTTTHAWHSGFTRKARTPRHNNSKHFALQQRLKHEVLFNNT  109

Query  600  PVLPFVPEMGSD  635
             VLP VPE+G +
Sbjct  110  SVLPLVPELGGE  121



>gb|KJB34354.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=404

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 80/123 (65%), Gaps = 9/123 (7%)
 Frame = +3

Query  261  ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  440
            + GKTARACD CL KRARW+C ADDAFLCQ CD SVHSAN LASRH RVRL T+SS   A
Sbjct  1    MGGKTARACDGCLRKRARWYCSADDAFLCQGCDTSVHSANQLASRHTRVRLETASSRFNA  60

Query  441  asllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP  620
            + + +        D D+PPAWH+GFTRK RTPR  +    Q       E  V  + P VP
Sbjct  61   SVINN-----SATDQDAPPAWHQGFTRKARTPRQNRSILGQQKS----EGKVWDLNPLVP  111

Query  621  EMG  629
            E+G
Sbjct  112  EVG  114



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 74/130 (57%), Gaps = 18/130 (14%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            A A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSANLLASRH++VRL      
Sbjct  11   AGALGAKTARACDSCLRRRARWFCAADDAFLCHGCDNLVHSANLLASRHEKVRL------  64

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV--NPV  605
                      +        +  AWH GFTRK RTPR+ K +  Q       E+ +     
Sbjct  65   ----------QTASAKVTTTAQAWHSGFTRKARTPRHNKNSSIQQQQQRLKEKVLFNTSF  114

Query  606  LPFVPEMGSD  635
            LP VPE+G +
Sbjct  115  LPLVPELGGE  124



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M SD RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MVSD-RKLASAMGGKTTRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK  560
            RL  +S    ++   + P + +     S P+WHRGFTRK RTPRN ++  K
Sbjct  60   RL-KTSPLKESSPDENFPNL-ESPVSVSLPSWHRGFTRKARTPRNGRKVSK  108



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 79/125 (63%), Gaps = 18/125 (14%)
 Frame = +3

Query  261  ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  440
            + GKTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+SS  + 
Sbjct  19   VGGKTARACDSCIKKRARWYCAADDAFLCQACDSSVHSANQLARRHERVRLKTASSIKST  78

Query  441  asllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP  620
             +  S  K          P+WHRGFTRKPRTPR   ++    +             P VP
Sbjct  79   TNSGSCDK-------SEVPSWHRGFTRKPRTPRGQGKSAAPRN-----------RFPLVP  120

Query  621  EMGSD  635
            E+G+D
Sbjct  121  EVGAD  125



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 83/141 (59%), Gaps = 19/141 (13%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSS + K  NA+  KTARACDSC+  RARW+C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1    MSSTKNK-GNAVGAKTARACDSCIRNRARWYCAADDAFLCQACDSSVHSANPLARRHHRV  59

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKK---------  560
            RL   S   A                 + P+WH+GFT+KPRTPR+ K   K         
Sbjct  60   RLKIVSHIEANKK--------SFSGTGNGPSWHKGFTKKPRTPRHGKNGNKALKNPFDVV  111

Query  561  -QNSGGVAVEESVNPVLPFVP  620
             +++   + EESV+ VL  VP
Sbjct  112  PEDTNSNSHEESVDEVLYRVP  132



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+SSD R  A+A+ GK+ RACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1    MISSD-RNMASAVGGKSVRACDNCVRKRARWYCAADDAFLCQSCDSSVHSANPLARRHER  59

Query  405  VRLGtss-sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR--TKKQNSGG  575
            VRL T+S  S+   S    P+I        PP WH+GFTRK RTPR  K    K+++S G
Sbjct  60   VRLKTTSFKSSLDGSSDQLPQI-----QIPPPTWHQGFTRKARTPRQKKNNSNKQRSSFG  114

Query  576  VAVEE  590
              V E
Sbjct  115  HLVPE  119



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 9/104 (9%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+ GKTARACDSC+ KRARW+C ADDAFLC SCD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLANAVGGKTARACDSCVKKRARWYCAADDAFLCHSCDSSVHSANPLACRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
            S+     +  S P          P  WH+GFTRK RTPR  K++
Sbjct  63   SAGKHRHASSSPPH---------PATWHQGFTRKARTPRGGKKS  97



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  AN + GKTARACDSCL +RARWFC ADDAFLC SCD SVHSAN LA RH+RV L ++
Sbjct  3    KNLANVVGGKTARACDSCLKRRARWFCAADDAFLCHSCDGSVHSANPLARRHERVLLKSA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
            S         S P          PP WH+GFTRK RTPR  K++
Sbjct  63   SPGKQRHDSSSPPH---------PPTWHQGFTRKARTPRGGKKS  97



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 80/134 (60%), Gaps = 13/134 (10%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S  +K AN++  KTARACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV L
Sbjct  2    SSNKKVANSLGAKTARACDSCIRKRARWYCAADDAFLCQACDSSVHSANQLARRHERVLL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
                 + ++         V   D+ + P+WHRGF RK RTPR  K            +E 
Sbjct  62   ----KTASSLKPTDKDDQVSVSDNPAAPSWHRGFRRKARTPRQGKHK---------CQEG  108

Query  594  VNPVLPFVPEMGSD  635
                 P VPE+G+D
Sbjct  109  SRNRFPQVPEVGAD  122



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 79/129 (61%), Gaps = 10/129 (8%)
 Frame = +3

Query  261  ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  440
            + GKTARACD+C+ KRARW+C ADDAFLCQ+CD+SVHSAN LA RH+RVRL        A
Sbjct  17   VGGKTARACDNCVKKRARWYCAADDAFLCQACDLSVHSANSLARRHERVRL------KTA  70

Query  441  asllssPKIVddddddSPPAWHRGFTRKPRTPRNAK----RTKKQNSGGVAVEESVNPVL  608
            +S      +  ++ D + P WHRGFTRK RTPRN K      K Q +             
Sbjct  71   SSSSLIKPLPTEESDLTAPTWHRGFTRKARTPRNGKNHVTHPKLQKNQSRDHHHHHQQFD  130

Query  609  PFVPEMGSD  635
            P VPE+ SD
Sbjct  131  PLVPEICSD  139



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            +RK A A   KTARACDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+RVRLGT
Sbjct  4    ERKAAKAFGAKTARACDSCLRRRARWYCTADDAFLCQGCDSSVHSANQLARRHERVRLGT  63

Query  420  sssstaaasllssPKIVddd-----dddSPPAWHRGFTRKPRTPRNAKR  551
            +SS ++        K+         D+ + PAWH GFTRK RTPR +K+
Sbjct  64   ASSLSSRIGCGGGAKLPSSAPPQFVDNSAAPAWHGGFTRKARTPRISKK  112



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  AN + GKTARACDSCL +RARW+C ADDAFLC SCD SVHSAN LA RH+RV L ++
Sbjct  3    KNLANVVGGKTARACDSCLKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVLLKSA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
            S         S P          PP WH+GFTRK RTPR  K++
Sbjct  63   SPGKQRHDSSSPPH---------PPTWHQGFTRKARTPRGGKKS  97



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 79/131 (60%), Gaps = 23/131 (18%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            RK AN + GK+ARACD+C  KRARW+C ADDAFLCQSCD SVHS   L+ RH+RVRL   
Sbjct  47   RKLANVVGGKSARACDNCGKKRARWYCAADDAFLCQSCDSSVHSDRALSRRHERVRLK--  104

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK---KQNSGGVAVEES  593
                               +D SPP WHRGFT+K RTPR  K  K   ++ +GG    E+
Sbjct  105  ---------------TSTGEDVSPPTWHRGFTKKARTPRQKKNGKFHLEEPTGGKT--EN  147

Query  594  VNPVLPFVPEM  626
             NP L  VPE+
Sbjct  148  HNP-LYLVPEI  157



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 87/135 (64%), Gaps = 4/135 (3%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL  
Sbjct  4    ERKLASAMGGKTVRACDNCIRKRARWYCPADDAFLCQNCDSSVHSANPLARRHERVRL-K  62

Query  420  sssstaaasllssPKI---VddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  590
            +SS   ++   + P +   V      S P+WHRGFTRK RTPRN ++  K        E 
Sbjct  63   TSSLKESSPDENFPNLESPVSVSVSVSVPSWHRGFTRKARTPRNGRKVSKSTEEEEEEEV  122

Query  591  SVNPVLPFVPEMGSD  635
             +   +  VPE+ SD
Sbjct  123  ILKNPIHLVPEILSD  137



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 81/138 (59%), Gaps = 27/138 (20%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSS  +  ANA+  KTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MSSATKNAANAVGAKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S  +                   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61   RLKTASYKSTDE--------QQQQQQQQPPTWH---TKKPRTPRHGKHSRNNN-------  102

Query  588  ESVNPVLPF--VPEMGSD  635
                   PF  VPE GS+
Sbjct  103  -------PFHLVPEEGSE  113



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 87/142 (61%), Gaps = 13/142 (9%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T
Sbjct  4    ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVHSANPLARRHERVRLKT  63

Query  420  sssstaaasllssPKIV----------ddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
            SS    ++   SS                    S P+WHRGFTRK RTPR  ++  K   
Sbjct  64   SSLKQTSSPSSSSDDYFPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQGRKASKSAG  123

Query  570  GGVAVEESVNPVLPFVPEMGSD  635
             G  + +  NP+   VPE+ SD
Sbjct  124  DGDVIRK--NPI-HLVPEILSD  142



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 80/125 (64%), Gaps = 17/125 (14%)
 Frame = +3

Query  261  ISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaa  440
            ++G++ARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL T+S ++  
Sbjct  1    MAGRSARACDNCVRKRARWYCAADDAFLCQSCDSSVHSANTLARRHERVRLKTASINSRT  60

Query  441  asllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVP  620
                   KI       S P W +GFTRKPRTPR+ K  K            +NP L  VP
Sbjct  61   FDDDDEMKI-----SVSVPTWDQGFTRKPRTPRHKKHGK-----------LLNP-LHLVP  103

Query  621  EMGSD  635
            EM S+
Sbjct  104  EMCSE  108



>ref|XP_010546462.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like, partial 
[Tarenaya hassleriana]
Length=258

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 77/121 (64%), Gaps = 14/121 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  2    KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
               +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59   --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHDL  110

Query  594  V  596
            V
Sbjct  111  V  111



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 81/138 (59%), Gaps = 32/138 (23%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSS  +  ANA+ GKTARACD C++KRARW+C ADDAFLCQ+CD SVH AN LA RH+RV
Sbjct  1    MSSATKNAANAVGGKTARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S                 D+   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61   RLKTASYK-------------STDERRQPPTWH---TKKPRTPRHGKHSRNNN-------  97

Query  588  ESVNPVLPF--VPEMGSD  635
                   PF  VPE GS+
Sbjct  98   -------PFHLVPEEGSE  108



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 81/138 (59%), Gaps = 32/138 (23%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            MSS  +  ANA+ GKTARACD C++KRARW+C ADDAFLCQ+CD SVH AN LA RH+RV
Sbjct  1    MSSATKNAANAVGGKTARACDGCITKRARWYCAADDAFLCQACDSSVHLANPLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL T+S                 D+   PP WH   T+KPRTPR+ K ++  N       
Sbjct  61   RLKTASYK-------------STDERRQPPTWH---TKKPRTPRHGKHSRNNN-------  97

Query  588  ESVNPVLPF--VPEMGSD  635
                   PF  VPE GS+
Sbjct  98   -------PFHLVPEEGSE  108



>ref|XP_010543105.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=311

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 77/121 (64%), Gaps = 14/121 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA RH+RVRL   
Sbjct  2    KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
               +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59   --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHDL  110

Query  594  V  596
            V
Sbjct  111  V  111



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 20/145 (14%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRHQRV+L
Sbjct  2    NNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHQRVKL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
             T+SS    +  L+  K V         AWH GFTRK RTPR++ + ++Q    +  E  
Sbjct  62   QTASSKLNYSDTLNHNKKV---------AWHSGFTRKARTPRHSTKLQEQQQKKIHEEGE  112

Query  594  V----------NPV-LPFVPEMGSD  635
                       N + LP VPE+GS+
Sbjct  113  EEQQQQQVFFNNTISLPLVPELGSE  137



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 72/112 (64%), Gaps = 13/112 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2    KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S      S         +    SPP     WH+GFTRKPRTPR +   KK N
Sbjct  62   SPVATKYSS-------HNHSASSPPLEAATWHQGFTRKPRTPRGS--GKKNN  104



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            + +AN + GKTARACDSCL +RARW+C ADDAFLC SCD S+HSAN LA RH+RV L ++
Sbjct  3    KNSANVVGGKTARACDSCLKRRARWYCAADDAFLCHSCDGSIHSANPLARRHERVLLKSA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
            S         S P          PP WH+GFTRK RT R  K++
Sbjct  63   SPGKQRHDSSSPPH---------PPTWHQGFTRKARTRRGGKKS  97



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 15/107 (14%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+ GKTARACDSC+ +RARW+C ADDAFLC SCD SVHSAN LA RH+RVRL +S
Sbjct  3    KSLANAVGGKTARACDSCVKRRARWYCAADDAFLCHSCDGSVHSANPLARRHERVRLKSS  62

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRT  554
            SS                    SPP    WH+GFTRK RTPR  K++
Sbjct  63   SSGK------------HRHASSSPPHRATWHQGFTRKARTPRGGKKS  97



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 75/131 (57%), Gaps = 23/131 (18%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL ++
Sbjct  2    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNP  602
            SS                     PP WH+GFTRK RTPR  K++                
Sbjct  62   SSGKH-----------RHVPTSPPPTWHQGFTRKARTPRGGKKSHTM------------V  98

Query  603  VLPFVPEMGSD  635
               FVPEM ++
Sbjct  99   FHDFVPEMSTE  109



>gb|KJB16228.1| hypothetical protein B456_002G218400 [Gossypium raimondii]
Length=421

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 86/137 (63%), Gaps = 16/137 (12%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+SS  +K ANA+  KT RACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1    MISS--KKMANAVGAKTVRACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHKR  58

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL T+S  ++           +   +   P+W RGFTRK RT R  K +  +      +
Sbjct  59   VRLKTASVKSSGD---------ELPLESFSPSWDRGFTRKARTRRPVKGSIHRK----PL  105

Query  585  EESVNPVLPFVPEMGSD  635
            +   NPV P VPE+G D
Sbjct  106  KAKNNPV-PVVPEVGID  121



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 73/106 (69%), Gaps = 12/106 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR  551
            S+     + +SSP         SPP    WH+GFTRK RTPR  K+
Sbjct  63   STGKHRHADVSSP---------SPPHQATWHQGFTRKARTPRGGKK  99



>dbj|BAH19571.1| AT1G68520 [Arabidopsis thaliana]
Length=280

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 17/107 (16%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  62

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRT  554
            S                     SPP    WH+GFTRK RTPR  K++
Sbjct  63   S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKS  95



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 73/106 (69%), Gaps = 12/106 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHGCDGSVHSANPLARRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKR  551
            S+     + +SSP         SPP    WH+GFTRK RTPR  K+
Sbjct  63   STGKHRHADVSSP---------SPPHQATWHQGFTRKARTPRGGKK  99



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 89/143 (62%), Gaps = 10/143 (7%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S ++K ANA+  KTARACD+C+ KRARW+C ADDAFLCQSCD SVHSAN LA RH+RVRL
Sbjct  2    SSEKKLANAMGAKTARACDNCIRKRARWYCAADDAFLCQSCDSSVHSANPLARRHERVRL  61

Query  414  Gtsssstaa-----asllssPKIVddddddSPPAWHRGFTRKPRTPR----NAKRTKKQN  566
             TSS  ++       S +S          DS P+WH GFTRK RTPR    +AKR K   
Sbjct  62   KTSSFKSSDDFPNLESTVSGLGSGSGSGSDSIPSWHCGFTRKARTPRYGNKHAKRVKSTE  121

Query  567  SGGVAVEESVNPVLPFVPEMGSD  635
                  E   NP+   VPE+ SD
Sbjct  122  EEEEEEEMK-NPIQLVVPEILSD  143



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 68/106 (64%), Gaps = 19/106 (18%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            AN +  KTAR CD+CL K+A WFC AD+AFLCQSCD SVHSANLLA RH+RVRL      
Sbjct  5    ANCVRAKTARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRL------  58

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
                   +SP+          P W+RGFTRKPRTPR +   K+ NS
Sbjct  59   ----KDSTSPQ-------QEAPTWYRGFTRKPRTPRGS--GKRNNS  91



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 71/115 (62%), Gaps = 19/115 (17%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNS  569
                      +SP +V        SPP     WH GFTRK RTPR +   KK NS
Sbjct  59   --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS  103



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 71/115 (62%), Gaps = 19/115 (17%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  3    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  59

Query  423  ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNS  569
                      +SP +V        SPP     WH GFTRK RTPR +   KK NS
Sbjct  60   --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS  104



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 71/115 (62%), Gaps = 19/115 (17%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  3    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  59

Query  423  ssstaaasllssPKIVddd--dddSPP----AWHRGFTRKPRTPRNAKRTKKQNS  569
                      +SP +V        SPP     WH GFTRK RTPR +   KK NS
Sbjct  60   --------KTASPAVVKHSNHSSASPPHEVATWHHGFTRKARTPRGS--GKKNNS  104



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 11/107 (10%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2    KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKR  551
            S      S         +     PP     WH+GFTRKPRTPR + +
Sbjct  62   SPVATKYSS-------HNHSASCPPLEAATWHQGFTRKPRTPRGSGK  101



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 86/143 (60%), Gaps = 16/143 (11%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M  ++ K  +A+ GKTARACDSCL KRARWFC ADDAFLCQ+CD SVH+AN LAS H+RV
Sbjct  1    MICEKIKAVSAVGGKTARACDSCLRKRARWFCAADDAFLCQACDTSVHAANRLASSHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR--------TKKQ  563
            RL TSS   + +      +      D+S P W RG TRK RTPR+  +          K 
Sbjct  61   RLLTSSFKGSTSVCGEDSQ------DESSPKWLRGLTRKARTPRHNSKAAPAALQLAAKD  114

Query  564  NSGGVAVEESVNPVL--PFVPEM  626
                V V++++N V     VPEM
Sbjct  115  GGDDVFVDKALNLVDQPSIVPEM  137



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 11/107 (10%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ KRARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2    KNLANAVGAKTARACDSCVKKRARWYCAADDAFLCQSCDTLVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKR  551
            S      S         +     PP     WH+GFTRKPRTPR + +
Sbjct  62   SPVATKYSS-------HNHSASCPPLEAATWHQGFTRKPRTPRGSGK  101



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHTCDGSVHSANPLARRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
            S+     +  SSP             WH+GFTRK RTPR  K++
Sbjct  63   STGKHRHASSSSPP--------HQATWHQGFTRKARTPRGGKKS  98



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 17/107 (16%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  62

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRT  554
            S                     SPP    WH+GFTRK RTPR  K++
Sbjct  63   S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKS  95



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 85/147 (58%), Gaps = 26/147 (18%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2    TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNS-------  569
                ++++  +   +PK+          AWH GFTRK RTPR N K +  Q         
Sbjct  62   ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRSNNKHSSLQQQQQKPLHE  108

Query  570  -----GGVAVEESVNPVLPFVPEMGSD  635
                   V    ++  V P VPE+GS+
Sbjct  109  EQGEEEEVFFNNTIISVQPLVPELGSE  135



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 17/107 (16%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  2    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRT  554
            S                     SPP    WH+GFTRK RTPR  K++
Sbjct  62   S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKS  94



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 66/106 (62%), Gaps = 20/106 (19%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            AN +  KTAR CD+CL KRA WFC AD+AFLCQSCD SVHSANLLA RH+RV L      
Sbjct  5    ANGVRAKTARTCDNCLKKRAHWFCAADEAFLCQSCDTSVHSANLLARRHERVPL------  58

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
                   +SP+          P WH GFTRKPRTPR +   K+ NS
Sbjct  59   -----KDTSPQ-------QEAPTWHHGFTRKPRTPRGS--GKRNNS  90



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 17/107 (16%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL ++
Sbjct  2    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP---AWHRGFTRKPRTPRNAKRT  554
            S                     SPP    WH+GFTRK RTPR  K++
Sbjct  62   S--------------AGKYRHASPPHQATWHQGFTRKARTPRGGKKS  94



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 13/97 (13%)
 Frame = +3

Query  258  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssssta  437
            A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL        
Sbjct  11   AEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRL--------  62

Query  438  aasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
                  +       D+ S  +WH+GFT+KPR+PR  K
Sbjct  63   -----QTASFRPSSDNSSAASWHQGFTKKPRSPRMGK  94



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 13/97 (13%)
 Frame = +3

Query  258  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssssta  437
            A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL        
Sbjct  11   AEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRL--------  62

Query  438  aasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
                  +       D+ S  +WH+GFT+KPR+PR  K
Sbjct  63   -----QTASFRPSSDNSSAASWHQGFTKKPRSPRMGK  94



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 79/136 (58%), Gaps = 12/136 (9%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M+   +  ANA+ GKTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MTCSSKNVANAVGGKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANSLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVE  587
            RL             S   I  D+  +  P    GFT+K RTPR  K   K +S      
Sbjct  61   RL----------KTASYKSINGDEFFNCGP--FSGFTKKARTPRQGKHKSKSSSSSEPAR  108

Query  588  ESVNPVLPFVPEMGSD  635
             + N     VPE+G D
Sbjct  109  NNNNIPFHLVPELGFD  124



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 72/132 (55%), Gaps = 21/132 (16%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            + A+  KTARACDSCL +RARWFC ADDAFLC  CD  VHSAN LASRH+RVRL      
Sbjct  7    SGALGAKTARACDSCLRRRARWFCGADDAFLCHGCDTLVHSANQLASRHERVRLQ-----  61

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESV----N  599
                               +  AWH GFTRK RTPR+  +          ++E V    +
Sbjct  62   ------------TASAKVTTAQAWHSGFTRKARTPRHHNKNLLLQQKQQRLKEKVLFNTS  109

Query  600  PVLPFVPEMGSD  635
              LP VPE+G +
Sbjct  110  VFLPLVPEIGGE  121



>gb|KHN32039.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=436

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 85/147 (58%), Gaps = 26/147 (18%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2    TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR-NAKRTKKQNS-------  569
                ++++  +   +PK+          AWH GFTRK RTPR N K +  Q         
Sbjct  62   ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRSNNKHSSLQQQQQKPLHE  108

Query  570  -----GGVAVEESVNPVLPFVPEMGSD  635
                   V    ++  V P VPE+GS+
Sbjct  109  EQGEEEEVFFNNTIISVQPLVPELGSE  135



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M++ +     A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RV
Sbjct  1    MTTRKSVEKTAEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERV  60

Query  408  RLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
            RL              +       D+ S  +WH+GFT+KPR+PR  K
Sbjct  61   RL-------------QTASFRPSSDNSSAASWHQGFTKKPRSPRIGK  94



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 13/97 (13%)
 Frame = +3

Query  258  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssssta  437
            A  GKTARACDSC+SKRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL        
Sbjct  11   AEGGKTARACDSCISKRARWYCAADDAFLCQACDASVHSANSLARRHERVRL--------  62

Query  438  aasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
                  +       D+ S  +WH+GFT+KPR+PR  K
Sbjct  63   -----QTASFRPSSDNSSAASWHQGFTKKPRSPRMGK  94



>emb|CDY36106.1| BnaA08g19420D [Brassica napus]
Length=384

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 17/100 (17%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            AN +  KTAR CD+CL K+A WFC AD+AFLCQSCD SVHSANLLA RH+RVRL      
Sbjct  5    ANCVRAKTARTCDNCLKKQAHWFCAADEAFLCQSCDTSVHSANLLARRHERVRL------  58

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR  551
                   +SP+          P W+ GFTRKPRTPR + +
Sbjct  59   ----KDSTSPQ-------QEAPTWYHGFTRKPRTPRGSGK  87



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 86/147 (59%), Gaps = 26/147 (18%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            +++ K A+A+  +TARAC+SCL  RARW+C ADDAFLC  CD  VHSAN LASRH+RV+L
Sbjct  2    TNEMKEASALGARTARACESCLKVRARWYCAADDAFLCHGCDNMVHSANQLASRHERVKL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR---NAKRTKKQNSGGVAV  584
                ++++  +   +PK+          AWH GFTRK RTPR   N   + KQ      +
Sbjct  62   ---QTASSKVNYSVTPKV----------AWHSGFTRKARTPRHNNNRHSSLKQQQQKKPL  108

Query  585  EE----------SVNPVLPFVPEMGSD  635
             E          +   +LP VPE+GS+
Sbjct  109  HEERGEEEVFFNNTISLLPLVPELGSE  135



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 85/137 (62%), Gaps = 16/137 (12%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+SS  +K ANA+  KT RACDSC+  RARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1    MISS--KKMANAVGAKTVRACDSCIRGRARWYCAADDAFLCQACDSSVHSANPLARRHKR  58

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL T+S  ++           +   +   P+W RGFTRK RT R  K +  +      +
Sbjct  59   VRLKTASVKSSGD---------ELPLESFSPSWDRGFTRKARTRRPVKGSIHRK----PL  105

Query  585  EESVNPVLPFVPEMGSD  635
            +   NPV P VPE+G D
Sbjct  106  KAKNNPV-PVVPEVGID  121



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 71/112 (63%), Gaps = 15/112 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2    KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S  +             +    SPP     WH GFTRKPRTPR +   KK N
Sbjct  62   SKHSNHN---------HNHSPSSPPHEAATWHHGFTRKPRTPRGS--GKKNN  102



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2    KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKR  551
            S  +             +    SPP     WH GFTRKPRTPR + +
Sbjct  62   SKHSNHN---------HNHSPSSPPHEAATWHHGFTRKPRTPRGSGK  99



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 69/103 (67%), Gaps = 8/103 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC  CD SVHSAN LA RH+RVRL T+
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHCCDGSVHSANPLARRHERVRLKTA  62

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR  551
            S+     +  SSP             WH+GFTRK RTPR  K+
Sbjct  63   STGKHRHASSSSPP--------HETTWHQGFTRKARTPRGGKK  97



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 79/128 (62%), Gaps = 14/128 (11%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            ANA+  KT RACDSC+ KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL T+S  
Sbjct  2    ANAVGAKTVRACDSCIKKRARWYCAADDAFLCQACDSSVHSANPLARRHKRVRLKTASVK  61

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLP  611
            ++           +   +   P W RGFTRK RT R  K +  +      ++   NPV P
Sbjct  62   SSGD---------ELPLESFSPTWDRGFTRKARTRRPVKGSIHRK----LLKAKNNPV-P  107

Query  612  FVPEMGSD  635
             VPE+G D
Sbjct  108  VVPEVGID  115



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2    KSLASAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKR  551
            S  +             +    SPP     WH GFTRKPRTPR + +
Sbjct  62   SKHSNHN---------HNHSPSSPPHEAATWHHGFTRKPRTPRGSGK  99



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 76/121 (63%), Gaps = 14/121 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            + +ANA+ GKTARACDSC+ +RARW+C +DDAFLCQ+CD SVHSAN LA R +RVRL   
Sbjct  2    KSSANAVGGKTARACDSCVKRRARWYCPSDDAFLCQACDGSVHSANPLARRPERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPPA---WHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
               +A++S    P  V      SPP    WH GFTRK RTPR +    K N   V   + 
Sbjct  59   --KSASSSRTHRPTTV------SPPGTAKWHHGFTRKARTPRGSGSAGKPNQRAVFFHDL  110

Query  594  V  596
            V
Sbjct  111  V  111



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M  ++++++A A++ +TARACDSCL +RARWFC ADDAFLCQSCD SVHSAN LA RH+R
Sbjct  1    MSYAEKQRSAGAVAARTARACDSCLRRRARWFCEADDAFLCQSCDASVHSANPLARRHRR  60

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRN  542
            VRL T+S S+ ++S  S P      D   PP W  GF RKPRTPR 
Sbjct  61   VRLDTASCSSPSSSSSSPPTDDVSGDHSMPP-WLHGFKRKPRTPRG  105



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 62/108 (57%), Gaps = 16/108 (15%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  +NA+  KTARACDSC+ +RARW+C ADDAFLCQ CD SVHSAN LA RH+RVRL   
Sbjct  2    KSLSNAVGAKTARACDSCVKRRARWYCAADDAFLCQVCDGSVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQN  566
                         K         P  WH GF RK RTPR     KK N
Sbjct  59   -------------KSASSVPPPGPATWHHGFARKARTPRGGGGRKKTN  93



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL ++
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDGLVHSANPLARRHERVRLKSA  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
            S +            V    +     WH GFTRK RTPR     K   S
Sbjct  62   SPA------------VAKHSNHEAATWHHGFTRKARTPRGGSGKKNHQS  98



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 14/112 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S +          K  +     SPP     WH GFTRK RTPR +   KK N
Sbjct  62   SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGS--GKKNN  103



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 66/104 (63%), Gaps = 8/104 (8%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+ GKTARACDSC+ +RARW+C ADDAFLC +CD SVHSAN LA RH+RVRL   
Sbjct  3    KSLASAVGGKTARACDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRL---  59

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRT  554
                  ++     +            WH+GFTRK RTPR  K++
Sbjct  60   -----KSASSGKHRHASSSSPSHQSTWHQGFTRKARTPRGGKKS  98



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 14/112 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S +          K  +     SPP     WH GFTRK RTPR +   KK N
Sbjct  62   SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGS--GKKNN  103



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 69/107 (64%), Gaps = 12/107 (11%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKR  551
            S +          K  +     SPP     WH GFTRK RTPR + +
Sbjct  62   SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGSGK  100



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 14/112 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL T+
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S +          K  +     SPP     WH GFTRK RTPR +   KK N
Sbjct  62   SPAAV--------KHSNHSSSASPPHEAATWHHGFTRKARTPRGS--GKKNN  103



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 13/112 (12%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
                   +  ++ K  +     SPP     WH GFTRK RTPR +   KK N
Sbjct  59   -----KTASPAAAKHSNHSPSASPPHGAATWHHGFTRKARTPRGSA-GKKNN  104



>ref|XP_004138344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=273

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 73/123 (59%), Gaps = 21/123 (17%)
 Frame = +3

Query  267  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  446
            G+TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS       
Sbjct  4    GRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS-------  56

Query  447  llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEM  626
                    +  D   P  W +GFTRK RTPR+     K +S   +       V   VPE+
Sbjct  57   -------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISSSKAS-------VFSIVPEI  102

Query  627  GSD  635
            G+D
Sbjct  103  GND  105



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 68/115 (59%), Gaps = 19/115 (17%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVd------dddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
                      +SP +V                WH GFTRK RTPR +   KK NS
Sbjct  59   --------KTASPAVVKHSNHSSSSPPHEAATWHHGFTRKARTPRGS--GKKNNS  103



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 79/132 (60%), Gaps = 27/132 (20%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            S  +  A A+ GKTARACDSC++KRARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  2    STAKNAAIAVGGKTARACDSCITKRARWYCAADDAFLCQACDSSVHSANPLARRHERVRL  61

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
             T+S  +             D+    PP WH   T+K RTPR+ K ++           S
Sbjct  62   KTASYKS------------TDEQQQQPPTWH---TKKARTPRHGKHSR-----------S  95

Query  594  VNPVLPFVPEMG  629
             NP    VPE+G
Sbjct  96   SNP-FHLVPEVG  106



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 78/130 (60%), Gaps = 22/130 (17%)
 Frame = +3

Query  249  TANAISG-KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            T+ A++G +TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS
Sbjct  3    TSTAMTGGRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS  62

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPV  605
                           +  D   P  W +GFTRK RTPR+     K +S   +       V
Sbjct  63   --------------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISSSKAS-------V  101

Query  606  LPFVPEMGSD  635
               VPE+G+D
Sbjct  102  FSIVPEIGND  111



>ref|XP_004155029.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=202

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 64/101 (63%), Gaps = 14/101 (14%)
 Frame = +3

Query  267  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  446
            G+TAR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL TSS       
Sbjct  4    GRTARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRLETSS-------  56

Query  447  llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNS  569
                    +  D   P  W +GFTRK RTPR+     K +S
Sbjct  57   -------FNSTDHLPPTPWLKGFTRKARTPRSNNNNNKISS  90



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 82/134 (61%), Gaps = 14/134 (10%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M  +++++ A+A+  KTAR CD CL +RARWFC ADDAFLCQ+CDVSVHSAN LA RH+R
Sbjct  1    MGCTEKQRPASAVGAKTARPCDGCLRRRARWFCEADDAFLCQACDVSVHSANPLARRHRR  60

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAV  584
            VRL T+S S   ++        D   D + PAW  G  RKPRTPR           GVA 
Sbjct  61   VRLKTASFSGFLSTTE------DGLGDHATPAWLHGCKRKPRTPRGKP--------GVAG  106

Query  585  EESVNPVLPFVPEM  626
              +   V P VP++
Sbjct  107  APTAAKVEPLVPDL  120



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 65/120 (54%), Gaps = 22/120 (18%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaaslls  455
            AR CDSCL KRARWFC ADDAFLCQSCDVSVHSAN LA RH R+RL              
Sbjct  21   ARVCDSCLCKRARWFCAADDAFLCQSCDVSVHSANQLARRHDRIRL-------------E  67

Query  456  sPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMGSD  635
            +       D   P  W +GFTRK RTPR         S    +  S   V   VPE+G+D
Sbjct  68   TSSFNSTTDHLPPTPWLKGFTRKARTPR---------SNNNKISSSKASVFSIVPEIGND  118



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL   
Sbjct  2    KSLANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL---  58

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQN  566
              + + A++  S              WH GFTRK RTPR +   KK N
Sbjct  59   -KTASPAAVKHSSHSSSASPPHEAATWHHGFTRKARTPRGS--GKKNN  103



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 1/103 (1%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  ANA+  KTARACDSC+ +RARW+C ADDAFLCQSCD  VHSAN LA RH+RVRL +S
Sbjct  2    KSVANAVGAKTARACDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKSS  61

Query  423  ssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR  551
            +S   +    +          ++   WH GFTRK RTPR + +
Sbjct  62   ASPKHSNHNHNHSASSSSPLHEA-ATWHHGFTRKARTPRGSGK  103



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 57/97 (59%), Gaps = 15/97 (15%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            A AI GKTARACD C+ +RARWFC ADDAFLC  CD  +HSAN LA RH R+R       
Sbjct  15   AAAIGGKTARACDGCIRRRARWFCAADDAFLCDPCDSHIHSANQLAGRHHRLR-------  67

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRN  542
                               + P+WH GFTRKPRTPR+
Sbjct  68   --------LKSSSSTTLSVATPSWHHGFTRKPRTPRS  96



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 78/135 (58%), Gaps = 21/135 (16%)
 Frame = +3

Query  231  SSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVR  410
            S  QR +A A+  +TARACDSCL +RARW+C ADDAFLCQ+CD SVHSAN LA RH R+R
Sbjct  6    SDKQRFSAGALGARTARACDSCLRRRARWYCGADDAFLCQACDSSVHSANPLARRHHRLR  65

Query  411  LGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEE  590
            L             SS      + +D+PP W  GF RK RTPR     K   +G   +E 
Sbjct  66   L----------KTSSSSPPSTANSEDAPPPWLHGFRRKARTPRG----KPAPAGPPKLE-  110

Query  591  SVNPVLPFVPEMGSD  635
                  P VP++ +D
Sbjct  111  ------PLVPDLEAD  119



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 69/112 (62%), Gaps = 15/112 (13%)
 Frame = +3

Query  243  RKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGts  422
            +  A+A+  K ARACDSC+ +RARW+C ADDAFLCQSCD  VHSANLLA RH+RV L ++
Sbjct  2    KSLASAVGAKRARACDSCVKRRARWYCAADDAFLCQSCDTLVHSANLLARRHERVLLKSA  61

Query  423  ssstaaasllssPKIVddddddSPP----AWHRGFTRKPRTPRNAKRTKKQN  566
            S  +             +    SPP     WH G +RKPRTPR +   KK N
Sbjct  62   SKHSNHN---------HNHSPSSPPHEAATWHHGVSRKPRTPRGS--GKKNN  102



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MMS  ++  ANA+ GKTARACDSC+ KRARW+C ADDAFLCQSCD +VHSAN LA RHQR
Sbjct  1    MMS--RKNIANAVGGKTARACDSCVRKRARWYCAADDAFLCQSCDTTVHSANPLARRHQR  58

Query  405  VRL  413
            +RL
Sbjct  59   LRL  61



>gb|AGI62031.1| CONSTANS-like 7 [Erycina pusilla]
Length=314

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            +S   R  ANA+ G TARACD CL KRARW+C ADDAFLCQSCD SVHSAN LA RHQR+
Sbjct  4    LSRKHRSAANAVGGSTARACDGCLRKRARWYCGADDAFLCQSCDSSVHSANPLARRHQRL  63

Query  408  RL  413
            RL
Sbjct  64   RL  65



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (60%), Gaps = 19/134 (14%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            SD++++A A+  KTARACDSCL +RARW+C ADDAFLC +CD SVHSAN LA RH R+RL
Sbjct  7    SDEQRSARALGAKTARACDSCLRRRARWYCAADDAFLCMACDASVHSANPLARRHHRLRL  66

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
              SSSS++     +S   +        P W  GF R  RTP    R K   +G   +E  
Sbjct  67   KISSSSSSPPPSSNSDDAL--------PPWLHGFKRGARTP----RIKPTMAGPPKLE--  112

Query  594  VNPVLPFVPEMGSD  635
                 P VP++ +D
Sbjct  113  -----PLVPDLEAD  121



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            MMS  ++  ANA+ GKTARACDSC+ +RARW+C ADDAFLCQSCD +VHSAN LA RHQR
Sbjct  1    MMS--RKNIANAVGGKTARACDSCVRRRARWYCAADDAFLCQSCDTTVHSANPLARRHQR  58

Query  405  VRL  413
            +RL
Sbjct  59   LRL  61



>gb|EPS70096.1| hypothetical protein M569_04666, partial [Genlisea aurea]
Length=81

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 24/105 (23%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+SS   + ANA++G+TARACD C+  RARW+C ADDAFLCQSCD +VHS++    RH R
Sbjct  1    MVSS---RAANAVAGRTARACDYCVKTRARWYCAADDAFLCQSCDSTVHSSS-AKRRHHR  56

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPR  539
            VRL T+S                       P W  GFTRKPRTPR
Sbjct  57   VRLKTTSVLV--------------------PKWESGFTRKPRTPR  81



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 64/97 (66%), Gaps = 10/97 (10%)
 Frame = +3

Query  267  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaas  446
            GKTARACD C  +RARW+C ADDAFLCQ+CD SVHSAN LA RH R+RL         A+
Sbjct  20   GKTARACDGCGRRRARWYCAADDAFLCQNCDSSVHSANPLARRHNRIRL-------KTAT  72

Query  447  llssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK  557
               +P +   D DDS P+W RGF RK RTPR  +  K
Sbjct  73   SSGAPDV---DSDDSAPSWLRGFKRKARTPRPHQHAK  106



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 76/134 (57%), Gaps = 21/134 (16%)
 Frame = +3

Query  234  SDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            SD+ ++  A+ GKTA ACD CL +RARW+C ADDAFLC +CD SVHSAN LA RH R+RL
Sbjct  5    SDELRSPGALGGKTAHACDGCLRRRARWYCAADDAFLCMACDASVHSANTLALRHHRLRL  64

Query  414  GtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES  593
                         SS   +  + DD+ P W  GF R+ RTP    R K   +G   +E  
Sbjct  65   ----------QTSSSSPPLSSNFDDALPPWLHGFKRRARTP----RVKPSPAGPPKLE--  108

Query  594  VNPVLPFVPEMGSD  635
                 P VP++ +D
Sbjct  109  -----PLVPDLEAD  117



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 8/106 (8%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M SS  +  A A+  K ARACD CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+R
Sbjct  1    MSSSLAKAAAGAMGSKAARACDGCLRRRARWYCAADDAFLCQACDASVHSANPLARRHER  60

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRN  542
            VRL     ++   +    P+    D+    PAW   F RKPRTPR 
Sbjct  61   VRL---RPTSPLQAGAGGPRARRGDEVV--PAW---FKRKPRTPRG  98



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 86/146 (59%), Gaps = 14/146 (10%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            + + AN + GKTARACD+C+ +RA WFC ADDAFLCQ+CD S+HSAN LA RH+RVRL T
Sbjct  4    ETQAANVMGGKTARACDACMRRRAHWFCAADDAFLCQTCDSSIHSANQLAIRHERVRLRT  63

Query  420  sssstaaasllssPKIVddddddSPP--AWHRGFTRKPRTPRNAKRT---KKQNSGGVA-  581
             S S +++   S    ++     +     W+ GFTRK RTPR   R    KK+    +A 
Sbjct  64   CSMSPSSSFSSSVHSQIEKSTGVNAGTLVWYEGFTRKTRTPRRLLRRSLQKKKVVNAIAN  123

Query  582  --------VEESVNPVLPFVPEMGSD  635
                    +  + N   P VPE+GS+
Sbjct  124  DDLDFDLDLNSTSNSNEPVVPELGSE  149



>ref|XP_010519197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X2 [Tarenaya 
hassleriana]
Length=448

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 86/146 (59%), Gaps = 14/146 (10%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            + + AN + GKTARACD+C+ +RA WFC ADDAFLCQ+CD S+HSAN LA RH+RVRL T
Sbjct  4    ETQAANVMGGKTARACDACMRRRAHWFCAADDAFLCQTCDSSIHSANQLAIRHERVRLRT  63

Query  420  sssstaaasllssPKIVddddddSPP--AWHRGFTRKPRTPRNAKRT---KKQNSGGVA-  581
             S S +++   S    ++     +     W+ GFTRK RTPR   R    KK+    +A 
Sbjct  64   CSMSPSSSFSSSVHSQIEKSTGVNAGTLVWYEGFTRKTRTPRRLLRRSLQKKKVVNAIAN  123

Query  582  --------VEESVNPVLPFVPEMGSD  635
                    +  + N   P VPE+GS+
Sbjct  124  DDLDFDLDLNSTSNSNEPVVPELGSE  149



>ref|XP_009409258.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=346

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 64/113 (57%), Gaps = 14/113 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            QR + +A+ GK ARAC  CL  RARW+C A  AFLCQ CD SVHSAN L  RHQRVRL T
Sbjct  8    QRPSPDAVGGKAARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTT  67

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +S              +  +  +S P+W  GF RK RT R   RT    +G +
Sbjct  68   TS--------------LVGEPGESSPSWLEGFERKARTSRPQHRTNMMAAGDL  106



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 74/140 (53%), Gaps = 24/140 (17%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  395
            M+   + + A    GKTA R CD C+  S RA W+C ADDAFLCQSCD S+HSAN LA R
Sbjct  1    MVVEVESRAAGVTGGKTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKR  60

Query  396  HQRVRLGtsssstaaasllssPKIVdddddd--SPPAWHRGFTRKPRTPRNAKRTKKQNS  569
            H+RVRL             SSP+++        +   W+ GF RK RTPR         S
Sbjct  61   HERVRL----------QSSSSPELLMKTKATDKTTSVWYEGFRRKARTPR---------S  101

Query  570  GGVAVEESVNPVLPFVPEMG  629
              + ++   N   P VPE+G
Sbjct  102  KLLQIQHVNNSNDPLVPELG  121



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 74/132 (56%), Gaps = 21/132 (16%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            QR +A A+  KTARACDSCL +RARW+C ADDA LCQ+CD SVHSAN LA RH R+RL  
Sbjct  9    QRSSAGALGAKTARACDSCLRRRARWYCAADDACLCQACDSSVHSANPLARRHHRLRL--  66

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
                       S         DD+PP W  GF RK RTPR     K   +G   +E    
Sbjct  67   --------KTTSFSPPSSASSDDAPPPWLHGFRRKARTPRG----KPAPAGPPKLE----  110

Query  600  PVLPFVPEMGSD  635
               P VP++ +D
Sbjct  111  ---PLVPDLEAD  119



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 78/132 (59%), Gaps = 6/132 (5%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            +RK A+A+ GKT RACD+C+ KRARW+C ADDAFLCQ+CD SV    L  S  ++    +
Sbjct  4    ERKLASAMGGKTTRACDNCIKKRARWYCPADDAFLCQNCDASVR---LKTSSLKQTSSPS  60

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVN  599
            SSS      L S   I       S P+WHRGFTRK RTPR  ++  K    G  + +  N
Sbjct  61   SSSDDYFPDLESPLSISSVSVSVSVPSWHRGFTRKARTPRQGRKASKSAGDGDVIRK--N  118

Query  600  PVLPFVPEMGSD  635
            P+   VPE+ SD
Sbjct  119  PI-HLVPEILSD  129



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 68/109 (62%), Gaps = 11/109 (10%)
 Frame = +3

Query  231  SSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVR  410
            S  Q+  A+AI+GK ARACD C+ +RARW+C ADD FLCQSCD SVHSAN +A RHQR R
Sbjct  14   SEKQQSAASAIAGKMARACDGCVRRRARWYCAADDVFLCQSCDSSVHSANPVARRHQRDR  73

Query  411  LGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTK  557
            L  ++S  ++     + +++          W     RK RTPR  ++TK
Sbjct  74   LKPATSYYSSFMEAKTEELIL--------GW---LKRKARTPRPRQQTK  111



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 64/113 (57%), Gaps = 14/113 (12%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGt  419
            QR + +A+ GK ARAC  CL  RARW+C A  AFLCQ CD SVHSAN L  RHQRVRL T
Sbjct  8    QRPSPDAVGGKAARACYGCLRHRARWYCTAHHAFLCQICDSSVHSANPLVRRHQRVRLTT  67

Query  420  sssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +S              +  +  +S P+W  GF RK RT R   RT    +G +
Sbjct  68   TS--------------LVGEPGESSPSWLEGFERKARTSRPQHRTNMMAAGDL  106



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 61/116 (53%), Gaps = 17/116 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M++    T   +  +TAR+CD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RV
Sbjct  1    MTNAGAATGAVLGARTARSCDGCMRRRARWHCPADDAFLCQACDTSVHSANPLARRHHRV  60

Query  408  RLGtsssstaaasllssPKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQNS  569
            RL               P          P  PAW  G  R+PRTPR+     K  +
Sbjct  61   RL---------------PSASCSSPPRDPDAPAWLHGLKRRPRTPRSKPGVSKHET  101



>gb|KHN16247.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=99

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 15/99 (15%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtss  425
            K A A+  KTA ACDSC+S+R RWFC ADDAFLC + +  VHSAN LAS H+R +L    
Sbjct  2    KVAGALGAKTALACDSCVSRRPRWFCAADDAFLCHASNTLVHSANQLASTHERAQL----  57

Query  426  sstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRN  542
                     +S K++     ++   WH GFT K RTPR+
Sbjct  58   -------QTASSKVM----TNTTHGWHSGFTSKARTPRH  85



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            A A+ GK ARACD+CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+R+RL   +S 
Sbjct  13   AAAVGGKEARACDACLRRRARWYCAADDAFLCQACDTSVHSANSLARRHERLRL-RPTSP  71

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
                   +      +  D+  PAW   F RK RTPR  +
Sbjct  72   LQTPPPPTPASAKRESHDEVVPAW---FKRKARTPRGGR  107



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 62/115 (54%), Gaps = 17/115 (15%)
 Frame = +3

Query  228  MSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            M+S    T  A+  +TAR+CD C+ +RARW C ADDAFLCQ+CDVSVHSAN LA RH RV
Sbjct  1    MTSAGAATGAALGARTARSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRV  60

Query  408  RLGtsssstaaasllssPKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQN  566
            RL               P          P  P W  G  R+PRTPR+     K N
Sbjct  61   RL---------------PSASCSSPPRDPDAPTWLHGLKRRPRTPRSKPGGSKSN  100



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 78/141 (55%), Gaps = 27/141 (19%)
 Frame = +3

Query  225  MMSSDQRKTANAISGK-TARACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  398
            M+   +R+ A+   GK  AR CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1    MVVDVERRAASVPGGKMVARGCDACMKRSRASWYCPADDAFLCQSCDSSIHSANHLAKRH  60

Query  399  QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +RVRL +SS                +  + +   W+ GF RK RTPRN          G+
Sbjct  61   ERVRLQSSSW--------------TETTEKTTSVWYEGFRRKARTPRNK---------GL  97

Query  579  AVEE--SVNPVLPFVPEMGSD  635
            A E+   +    P VP++G +
Sbjct  98   ASEKLLQMEANDPLVPDLGGE  118



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 72/140 (51%), Gaps = 26/140 (19%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  395
            M+   + + A     KTA R CD C+  S RA W+C ADDAFLCQSCD S+HSAN LA R
Sbjct  1    MVVEVESRAAGVTGVKTAARGCDVCMKRSSRASWYCPADDAFLCQSCDASIHSANNLAKR  60

Query  396  HQRVRLGtsssstaaasllssPKIVdddddd--SPPAWHRGFTRKPRTPRNAKRTKKQNS  569
            H+RVRL             SSP+++        +   W+ GF RK RTPR+ +     NS
Sbjct  61   HERVRL----------QSPSSPELLMKTKATDKTTSVWYEGFRRKARTPRSKQLQDVNNS  110

Query  570  GGVAVEESVNPVLPFVPEMG  629
                         P VPE+G
Sbjct  111  ND-----------PLVPELG  119



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            A A+ GK ARACD+CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL   +S 
Sbjct  13   AAAVGGKEARACDACLRRRARWYCAADDAFLCQVCDTSVHSANSLARRHERLRL-RPTSP  71

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAK  548
                   +      +  D+  PAW   F RK RTPR  +
Sbjct  72   LQTPPPPTPASANRESHDEVVPAW---FKRKARTPRGGR  107



>gb|EEE59793.1| hypothetical protein OsJ_12313 [Oryza sativa Japonica Group]
Length=167

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            +TARACD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RVRL ++SSS A++  
Sbjct  15   RTARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR  74

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRN  542
             ++      DD D+ PAW  G  R+PRTPR 
Sbjct  75   SAAAPRAGSDDPDA-PAWLHGLKRRPRTPRT  104



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 75/132 (57%), Gaps = 17/132 (13%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTA-RACDSCL--SKRARWFCVADDAFLCQSCDVSVHSANLLASR  395
            M+   + + A    GKTA R CD C+  S RA WFC ADDAFLCQSCD S+HSAN LA R
Sbjct  1    MVVEVESRAAGVTGGKTAARGCDVCMKRSSRASWFCPADDAFLCQSCDASIHSANSLAKR  60

Query  396  HQRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGG  575
            H+RVRL + SS        ++ K        +   W+ GF RK RTPR +K  + Q+   
Sbjct  61   HERVRLQSPSSPELLMKTKATDK--------TTSVWYEGFRRKARTPR-SKLLQIQD---  108

Query  576  VAVEESVNPVLP  611
              V  S +P++P
Sbjct  109  --VNNSNDPLVP  118



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            +TARACD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RVRL ++SSS A++  
Sbjct  15   RTARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR  74

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRN  542
             ++      DD D+ PAW  G  R+PRTPR 
Sbjct  75   SAAAPRAGSDDPDA-PAWLHGLKRRPRTPRT  104



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            +TARACD C+ +RARW C ADDAFLCQ+CD SVHSAN LA RH RVRL ++SSS A++  
Sbjct  15   RTARACDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR  74

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRN  542
             ++      DD D+ PAW  G  R+PRTPR 
Sbjct  75   SAAAPRAGSDDPDA-PAWLHGLKRRPRTPRT  104



>dbj|BAE98863.1| hypothetical protein [Arabidopsis thaliana]
Length=245

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 75/141 (53%), Gaps = 27/141 (19%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTA-RACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  398
            M+   + +TA+    K A R CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1    MVVDVESRTASVTGEKMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRH  60

Query  399  QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +RVRL +SS                +  D +   W+ GF RK RTPR         S   
Sbjct  61   ERVRLQSSSP--------------TETADKTTSVWYEGFRRKARTPR---------SKSC  97

Query  579  AVEE--SVNPVLPFVPEMGSD  635
            A E+   +    P VPE+G D
Sbjct  98   AFEKLLQIESNDPLVPELGGD  118



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            +TAR+CDSC+ +RARW C AD+AFLCQSCDVSVHSAN LA RH RVRL            
Sbjct  15   RTARSCDSCMRRRARWHCPADNAFLCQSCDVSVHSANPLARRHHRVRL------------  62

Query  450  lssPKIVddddddSP--PAWHRGFTRKPRTPRN  542
               P          P  P W  G  R+PRTPR+
Sbjct  63   ---PSASCSSPPRDPDAPTWLHGLKRRPRTPRS  92



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 76/138 (55%), Gaps = 20/138 (14%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTA-RACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  398
            M+   + +  +   GKTA R CD C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1    MVVDVESRAPSVTGGKTAARGCDLCMKRSRASWYCPADDAFLCQSCDASIHSANSLAKRH  60

Query  399  QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +RVRL +SSS        ++ K        +   W+ GF RK RTPRN            
Sbjct  61   ERVRLQSSSSPELPMKTKTAEK--------TTSVWYEGFRRKARTPRNKL---------F  103

Query  579  AVEE-SVNPVLPFVPEMG  629
             +E+ + N   P VP++G
Sbjct  104  QIEDVNKNSNDPLVPDLG  121



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 75/141 (53%), Gaps = 27/141 (19%)
 Frame = +3

Query  225  MMSSDQRKTANAISGK-TARACDSCLSK-RARWFCVADDAFLCQSCDVSVHSANLLASRH  398
            M+   + +TA+    K  AR CD+C+ + RA W+C ADDAFLCQSCD S+HSAN LA RH
Sbjct  1    MVVDVESRTASVTGEKMAARGCDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRH  60

Query  399  QRVRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGV  578
            +RVRL             SSP    +  D +   W+ GF RK RTPR         S   
Sbjct  61   ERVRL-----------QSSSP---TETADKTTSVWYEGFRRKARTPR---------SKSC  97

Query  579  AVEE--SVNPVLPFVPEMGSD  635
            A E+   +    P VPE+G D
Sbjct  98   AFEKLLQIESNDPLVPELGGD  118



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 68/132 (52%), Gaps = 22/132 (17%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M  S +     A+  K ARACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R
Sbjct  1    MSCSGKAAADGAMGSKAARACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHER  60

Query  405  VRLGtsssstaaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKR----------T  554
            VRL  +S             +         PAW   F RK RTPR+  +           
Sbjct  61   VRLRPTSPLAPRERRRGDEVV---------PAW---FKRKARTPRSQAKGVGRLLSRRLV  108

Query  555  KKQNSGGVAVEE  590
              ++SGG + EE
Sbjct  109  VPESSGGESPEE  120



>ref|XP_010479340.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X3 
[Camelina sativa]
Length=281

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+         
Sbjct  16   KQPRTCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVWLRTNEIQNN----  71

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
                         S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  72   -------VLQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRREDPRVPEIG  120

Query  630  SD  635
             +
Sbjct  121  GE  122



>ref|XP_010479339.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X2 
[Camelina sativa]
Length=287

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+         
Sbjct  16   KQPRTCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVWLRTNEIQNN----  71

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
                         S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  72   -------VLQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRREDPRVPEIG  120

Query  630  SD  635
             +
Sbjct  121  GE  122



>ref|XP_010479338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1 
[Camelina sativa]
Length=337

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+         
Sbjct  16   KQPRTCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVWLRTNEIQNN----  71

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
                         S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  72   -------VLQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRREDPRVPEIG  120

Query  630  SD  635
             +
Sbjct  121  GE  122



>ref|XP_010500456.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X2 
[Camelina sativa]
Length=330

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L            
Sbjct  10   KQPRPCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL----------RT  59

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
               P  V      S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  60   NEIPNNV-LQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRGEDPRVPEIG  114

Query  630  SD  635
             +
Sbjct  115  GE  116



>ref|XP_010500455.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8-like isoform X1 
[Camelina sativa]
Length=336

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R CD CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L            
Sbjct  10   KQPRPCDLCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL----------RT  59

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
               P  V      S P WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  60   NEIPNNV-LQGTTSHPVWHSGFRRKARTPRSRCEKKTQQK----IDDERRGEDPRVPEIG  114

Query  630  SD  635
             +
Sbjct  115  GE  116



>ref|XP_006393307.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 gb|ESQ30593.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=326

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 64/120 (53%), Gaps = 15/120 (13%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R C+ CL+K A WFC +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  10   KAQRDCELCLNKHAVWFCASDDAFLCHLCDESVHSANQVATKHERVCLRTNEIS------  63

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
                 I       S P WH GF RK RTPR     K Q +    +++      P VPE+G
Sbjct  64   -----IRVLQGTTSKPVWHSGFRRKARTPRARCEKKPQEN----IDDERRREDPRVPEIG  114



>ref|XP_006393308.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 dbj|BAJ34092.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30594.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=339

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 64/120 (53%), Gaps = 15/120 (13%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R C+ CL+K A WFC +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  23   KAQRDCELCLNKHAVWFCASDDAFLCHLCDESVHSANQVATKHERVCLRTNEIS------  76

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
                 I       S P WH GF RK RTPR     K Q +    +++      P VPE+G
Sbjct  77   -----IRVLQGTTSKPVWHSGFRRKARTPRARCEKKPQEN----IDDERRREDPRVPEIG  127



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 53/99 (54%), Gaps = 17/99 (17%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            R+CD C+ +RARW C ADDAFLCQ+CDVSVHSAN LA RH RVRL               
Sbjct  19   RSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRVRL---------------  63

Query  459  PKIVddddddSP--PAWHRGFTRKPRTPRNAKRTKKQNS  569
            P          P  P W  G  R+PRTPR+     K  +
Sbjct  64   PSASCSSPPCDPDAPTWLHGLKRRPRTPRSKPGGGKHEA  102



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 17/119 (14%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtssss  431
            ++A++GKTARACD C  +RARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL      
Sbjct  15   SSAVAGKTARACDGCARRRARWYCPADDAFLCQNCDFSVHSANPLARRHRRVRL------  68

Query  432  taaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVL  608
                      +  D D ++S P+W RGF RK RTPR A + +K  SG   +  +  P L
Sbjct  69   ----------RAADVDSEESSPSWLRGFKRKARTPR-AHQHEKTTSGARRLRPTTVPEL  116



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  258  AISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            A+  +TARACD C+ +RARW C ADDA+LCQ+CD SVHSAN LA RH RVRL
Sbjct  7    ALGARTARACDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRL  58



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  231  SSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVR  410
            S  Q+  A+AI+GK  RACD C+ ++ARW+C ADD FLCQ CD SVHS N +A RHQR+R
Sbjct  14   SEMQQSAASAIAGKMTRACDGCVRRQARWYCSADDVFLCQICDSSVHSPNPVARRHQRLR  73

Query  411  L  413
            L
Sbjct  74   L  74



>ref|XP_002894160.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70419.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 66/127 (52%), Gaps = 15/127 (12%)
 Frame = +3

Query  255  NAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssst  434
            N    K  RAC+ C +K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S 
Sbjct  5    NQTDVKQQRACELCKNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISN  64

Query  435  aaasllssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPF  614
                              S P WH GF RK RTPR   R +K+    +  E  +    P 
Sbjct  65   -----------YVLRGTTSNPVWHSGFRRKARTPR--VRCEKKPQEKIDDERRIED--PR  109

Query  615  VPEMGSD  635
            VPE+G +
Sbjct  110  VPEIGGE  116



>ref|XP_006305351.1| hypothetical protein CARUB_v10009731mg [Capsella rubella]
 gb|EOA38249.1| hypothetical protein CARUB_v10009731mg [Capsella rubella]
Length=326

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 62/122 (51%), Gaps = 18/122 (15%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  RACD C  K A W+C +DDAFLC  CD SVHSAN +A++H+RV L            
Sbjct  11   KQPRACDLCPDKHAVWYCASDDAFLCYVCDESVHSANHVATKHKRVCL------------  58

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
              +P  V      S P WH GF RK RTPR+    K Q       E+      P VPE+G
Sbjct  59   -RTPSDV-LGGTTSNPVWHSGFRRKARTPRSRYEKKTQEKK----EDERRREDPRVPEIG  112

Query  630  SD  635
             +
Sbjct  113  GE  114



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 72/127 (57%), Gaps = 16/127 (13%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL    ++ +++ L + 
Sbjct  23   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL--QPAAASSSPLHTP  80

Query  459  PKIVddddddSP------PAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEES--VNPVLPF  614
            P+     ++         PAW   F RK RTPR       ++ GG A+  S  +  V+P 
Sbjct  81   PRTGAAANNKRERHDEVVPAW---FRRKARTPRGG---HAKSVGGQALSRSRRLGVVVPH  134

Query  615  VPEMGSD  635
                G D
Sbjct  135  AAAGGGD  141



>dbj|BAC42037.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAO63366.1| At1g49130 [Arabidopsis thaliana]
Length=311

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  23   KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  82

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
             +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  83   TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  127

Query  630  SD  635
             +
Sbjct  128  GE  129



>gb|AAF69700.1|AC016041_5 F27J15.10 [Arabidopsis thaliana]
Length=313

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  10   KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  69

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
             +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  70   TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  114

Query  630  SD  635
             +
Sbjct  115  GE  116



>ref|NP_001031160.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
 sp|Q9M9B3.2|COL8_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 8 [Arabidopsis 
thaliana]
 dbj|BAH20052.1| AT1G49130 [Arabidopsis thaliana]
 gb|AEE32394.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
Length=319

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  16   KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  75

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
             +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  76   TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  120

Query  630  SD  635
             +
Sbjct  121  GE  122



>ref|NP_175339.2| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
 gb|AEE32393.1| zinc finger protein CONSTANS-LIKE 8 [Arabidopsis thaliana]
Length=326

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  RAC+ CL+K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S      
Sbjct  23   KQPRACELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISNDVRGG  82

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
             +   +           WH GF RK RTPR+    K Q      +++      P VPE+G
Sbjct  83   TTLTSV-----------WHSGFRRKARTPRSRYEKKPQQK----IDDERRREDPRVPEIG  127

Query  630  SD  635
             +
Sbjct  128  GE  129



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllssPK  464
            CD C+ +RARW C ADDA+LCQ+CD SVHSAN LA RH RVRL +SSS  A         
Sbjct  16   CDGCMRRRARWHCAADDAYLCQACDASVHSANPLARRHHRVRLPSSSSPAA--------T  67

Query  465  IVddddddSPPAWHRGFTRKPRTPRNAKRT  554
                  D   PAW  G  R+PRTPR+   T
Sbjct  68   SSLQHADPDEPAWVHGLKRRPRTPRSKPGT  97



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  459  PKIVddddddSPPAWHRGFTRKPRTPRN  542
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  459  PKIVddddddSPPAWHRGFTRKPRTPRN  542
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 8/88 (9%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            RACD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL       ++   L  
Sbjct  19   RACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL-----RPSSPPPLVP  73

Query  459  PKIVddddddSPPAWHRGFTRKPRTPRN  542
            P      D+  P AW   F RK RTPR+
Sbjct  74   PSGSGRRDEAVPAAW---FKRKARTPRS  98



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            RACD C+ +RARW+C ADDAFLCQSCD SVHSAN LA RH+R+RL
Sbjct  24   RACDGCMRRRARWYCAADDAFLCQSCDTSVHSANPLARRHERLRL  68



>ref|XP_001759088.1| predicted protein [Physcomitrella patens]
 gb|EDQ76157.1| predicted protein [Physcomitrella patens]
Length=574

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            TA AI+G+ +RACD C S+ ARW+C AD+A+LC  CD SVHSAN LASRH+RVRL
Sbjct  14   TAMAIAGRASRACDGCGSQGARWYCEADNAYLCSRCDRSVHSANALASRHERVRL  68



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            TA AI+G+ +RACD C S+RARW+C AD+A+LC  CD +VHSAN LA RH+RVRL
Sbjct  16   TAMAIAGRASRACDVCGSQRARWYCNADNAYLCYRCDQNVHSANALALRHERVRL  70



>gb|KFK36040.1| hypothetical protein AALP_AA4G070200 [Arabis alpina]
Length=330

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 11/87 (13%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasllss  458
            RAC+ C++K A W+C +DDAFLC  CD SVHSAN +A++H+RV L T+  S         
Sbjct  27   RACELCVNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCLRTNEISND-------  79

Query  459  PKIVddddddSPPAWHRGFTRKPRTPR  539
                      S P WH GF RK RTPR
Sbjct  80   ----VLRGTSSKPVWHSGFRRKTRTPR  102



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            TA AI+G+ +RACD C++K ARW+C AD A+LC+ CD+ VHSAN LA RH+RV L
Sbjct  12   TAMAIAGQASRACDVCMNKSARWYCGADRAYLCEKCDIQVHSANALAQRHERVPL  66



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CD CL +RARW+C ADDAFLCQ+CD SVHSAN LA RH+RVRL
Sbjct  24   CDGCLRRRARWYCAADDAFLCQACDTSVHSANPLARRHERVRL  66



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  20   CDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL  62



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  19   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  61



>ref|XP_001751672.1| predicted protein [Physcomitrella patens]
 gb|EDQ83107.1| predicted protein [Physcomitrella patens]
Length=538

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  219  ARMMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRH  398
            A  ++S    TA AI+G+ +RACD C +K ARW+C AD A+LC  CD  VHSAN LA RH
Sbjct  2    ATKVASRSMTTAIAIAGRASRACDVCANKSARWYCGADTAYLCDRCDTQVHSANALAKRH  61

Query  399  QRVRL  413
            +RVRL
Sbjct  62   ERVRL  66



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  22   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  64



>ref|XP_009144991.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Brassica rapa]
 emb|CDY66242.1| BnaA05g36570D [Brassica napus]
Length=314

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 63/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLGtsssstaaasl  449
            K  R C+ CL+K A W+C +DDAFLC  CD SVH AN +A++H RV L T+  S      
Sbjct  10   KRPRDCELCLNKHAVWYCASDDAFLCHVCDESVHRANQVATKHDRVCLKTNEISNGVLQG  69

Query  450  lssPKIVddddddSPPAWHRGFTRKPRTPRNAKRTKKQNSGGVAVEESVNPVLPFVPEMG  629
             +             P WH  F RKPRTPR   R +++  G V  E       P VPE+G
Sbjct  70   TAR-----------KPVWHSWFRRKPRTPR--VRCERKPQGKVDDERRREG--PHVPEIG  114

Query  630  SD  635
             +
Sbjct  115  GE  116



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CDSCL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  21   CDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRL  63



>ref|XP_001769217.1| predicted protein [Physcomitrella patens]
 gb|EDQ65929.1| predicted protein [Physcomitrella patens]
Length=646

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  252  ANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            A AI+G+ +RACD C S+RARW+C AD+A LC  CD SVHSAN LA RH+RVRL
Sbjct  15   AMAIAGRASRACDVCGSQRARWYCEADNAHLCNRCDQSVHSANALALRHERVRL  68



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CD CL +RARW+C ADDAFLCQ CD SVHSAN LA RH+R+RL
Sbjct  24   CDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRL  66



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  416
            TA AI+G+  R CD C  +RA+WFC AD+A+LC++CD SVH AN ++ RH+R R+G
Sbjct  17   TAMAIAGRALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRMG  72



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  270  KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            KT R CDSC   RARW+C ADDAFLC +CD ++HSAN +A RH RVRL
Sbjct  19   KTVRPCDSCGKGRARWYCAADDAFLCHACDGTIHSANSVARRHDRVRL  66



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRLG  416
            TA AI+G+  R CD C  +RA+WFC AD+A+LC++CD SVH AN ++ RH+R R+G
Sbjct  17   TAMAIAGRALRPCDVCGRERAKWFCKADEAYLCENCDGSVHGANAVSLRHERFRMG  72



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CD C+ +RARW+C ADDAFLCQ C+ SVHSAN LA RH+R+RL
Sbjct  88   CDGCMRRRARWYCAADDAFLCQGCETSVHSANPLARRHERLRL  130



>dbj|BAJ89584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  285  CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            CD C+ +RARW+C ADDAFLCQ C+ SVHSAN LA RH+R+RL
Sbjct  88   CDGCMRRRARWYCAADDAFLCQGCETSVHSANPLARRHERLRL  130



>emb|CDY07382.1| BnaA07g24610D [Brassica napus]
Length=44

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCD  359
             +  ANA+ GKTARACDSC+ KRARW+C ADDAFLC SCD
Sbjct  2    MKSLANAVGGKTARACDSCVKKRARWYCAADDAFLCHSCD  41



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            TA AI+G+ +RACD C   RARW+C  D+A LC+ CD +VHSAN LA  H+RVRL
Sbjct  17   TAMAIAGRDSRACDVCGLHRARWYCSVDNAHLCRRCDQNVHSANALALHHERVRL  71



>emb|CDY04231.1| BnaC06g25840D [Brassica napus]
Length=44

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  240  QRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCD  359
             +  ANA+ GKTARACD+C+ KRARW+C ADDAFLC  CD
Sbjct  2    MKSLANAVGGKTARACDNCVKKRARWYCAADDAFLCHFCD  41



>ref|XP_001765858.1| predicted protein [Physcomitrella patens]
 gb|EDQ69449.1| predicted protein [Physcomitrella patens]
Length=315

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  TANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            T  A +G+ +RACD C S+  RW+  A++ +LC  CD SVHSAN LASRH+ V L
Sbjct  10   TNMATAGRASRACDGCGSQEPRWYYEANNVYLCSRCDWSVHSANALASRHEHVLL  64



>ref|XP_010479901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            K  N  SG  ARACD+C S     +C AD A+LC +CD  VH+AN +ASRH+RVR+
Sbjct  3    KEENNESGNWARACDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRV  58


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            R C+SC S  A + C AD A LC +CD  +HSAN LA RHQRV
Sbjct  57   RVCESCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRV  99



>gb|ACF35197.1| COb, partial [Brassica nigra]
Length=339

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = +3

Query  243  RKTANAISGKT---ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            ++ +N I G+    ARACD+C+S     +C AD A+LC SCD  VHSAN +ASRH+RV
Sbjct  3    KQKSNNIDGEENNRARACDTCMSTVCTVYCHADSAYLCTSCDAEVHSANRVASRHKRV  60


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 2/55 (4%)
 Frame = +3

Query  249  TANAISGKTARA--CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            +AN ++ +  R   C+SC    A + C ADDA LC +CD  VHSAN +A RH RV
Sbjct  49   SANRVASRHKRVPVCESCECAPAAFLCEADDASLCTACDSEVHSANAIARRHHRV  103



>gb|ACF35201.1| COb, partial [Brassica nigra]
 gb|ACF35202.1| COb, partial [Brassica nigra]
Length=339

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = +3

Query  243  RKTANAISGKT---ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            ++ +N I G+    ARACD+C+S     +C AD A+LC SCD  VHSAN +ASRH+RV
Sbjct  3    KQKSNNIDGEENNRARACDTCMSTVCTVYCHADSAYLCTSCDAEVHSANRVASRHKRV  60


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 2/55 (4%)
 Frame = +3

Query  249  TANAISGKTARA--CDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            +AN ++ +  R   C+SC    A + C ADDA LC +CD  VHSAN +A RH RV
Sbjct  49   SANRVASRHKRVPVCESCECAPAAFLCEADDASLCTACDSEVHSANAIARRHHRV  103



>gb|AAC27695.1| CONSTANS homolog [Brassica napus]
 emb|CDY26469.1| BnaC09g41990D [Brassica napus]
Length=366

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M   +     N  + + ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+R
Sbjct  1    MFKQESNNICNRENNRGARACDTCGSTICTVYCHADSAYLCNSCDAQVHSANRVASRHKR  60

Query  405  VRL  413
            VR+
Sbjct  61   VRV  63


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADD  LC +CD+ VHSAN LA RHQRV
Sbjct  47   QVHSANRVASRHKRVRVCESCERAPAAFMCEADDVSLCTACDLEVHSANPLARRHQRV  104



>ref|XP_001417557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95850.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=422

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +3

Query  219  ARMMSSDQRKTANAISGKTARACDSC---LSKRARWFCVADDAFLCQSCDVSVHSANLLA  389
            AR  +SD+ +  +A    T  AC+SC     + A W+C  D+A+LC +CD  VH+AN +A
Sbjct  6    ARASASDRARAEDATRDATGAACESCPEGARRAASWYCAQDEAYLCDACDARVHAANAIA  65

Query  390  SRHQRVRLG  416
            S+H+R  LG
Sbjct  66   SKHERTALG  74



>dbj|BAL41877.1| CO, partial [Cardamine glauca]
Length=155

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  11   ARACDTCRSASCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  56


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV++
Sbjct  40   QVHSANRVASRHKRVRVCESCERAPAAYLCEADDASLCTACDSEVHSANPLARRHQRVQI  99



>ref|XP_010463643.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  246  KTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            K  N  SG  AR+CD+C S     +C AD A+LC +CD  VH+AN +ASRH+RVR+
Sbjct  3    KEENNESGNWARSCDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRV  58


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            R C SC S  A + C AD A LC +CD  +HSAN LA RHQRV
Sbjct  57   RVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRV  99



>dbj|BAL41876.1| CO, partial [Cardamine resedifolia]
Length=161

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSSPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41865.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANHVASRHKRVRV  62


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANHVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>gb|ACM69281.1| constans [Sinapis alba]
 gb|ACM69282.1| constans [Sinapis alba]
Length=372

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  MMSSDQRKTANAISGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQR  404
            M+  +    +N  + + ARACD+C       +C AD A+LC SCD  VHSAN +ASRH+R
Sbjct  1    MLKPESYNISNRENNRGARACDTCQLTICTVYCHADSAYLCTSCDAQVHSANRVASRHKR  60

Query  405  VRL  413
            VR+
Sbjct  61   VRV  63


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADD  LC +CD  VHSAN LA RHQRV
Sbjct  47   QVHSANRVASRHKRVRVCESCERAPAAFMCEADDVSLCTACDSEVHSANPLARRHQRV  104



>dbj|BAL41845.1| CO, partial [Cardamine nipponica]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC S  A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCESAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41869.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41873.1| CO, partial [Cardamine resedifolia]
 dbj|BAL41874.1| CO, partial [Cardamine resedifolia]
 dbj|BAL41875.1| CO, partial [Cardamine resedifolia]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41833.1| CO, partial [Cardamine nipponica]
 dbj|BAL41838.1| CO, partial [Cardamine nipponica]
 dbj|BAL41843.1| CO, partial [Cardamine nipponica]
 dbj|BAL41847.1| CO, partial [Cardamine nipponica]
 dbj|BAL41866.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41870.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41871.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41872.1| CO, partial [Cardamine bellidifolia subsp. alpina]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>ref|XP_010485483.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  SGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            SG  ARACD+C S     +C AD A+LC +CD  VH+AN +ASRH+RVR+
Sbjct  9    SGNWARACDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRV  58


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            R C SC S  A + C AD A LC +CD  +HSAN LA RHQRV
Sbjct  57   RVCQSCESAPAAFLCKADAASLCTTCDAEIHSANPLARRHQRV  99



>dbj|BAO24102.1| CONSTANS-like protein [Lemna aequinoctialis]
Length=352

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  267  GKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            G  AR CD C + +A  FC AD AFLC+ CDV +H AN LASRH+RV
Sbjct  17   GMGARECDCCKNSQALLFCRADSAFLCRGCDVKIHGANKLASRHERV  63



>dbj|BAL41832.1| CO, partial [Cardamine nipponica]
 dbj|BAL41834.1| CO, partial [Cardamine nipponica]
 dbj|BAL41835.1| CO, partial [Cardamine nipponica]
 dbj|BAL41836.1| CO, partial [Cardamine nipponica]
 dbj|BAL41837.1| CO, partial [Cardamine nipponica]
 dbj|BAL41850.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41852.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41853.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41854.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41855.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41856.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41857.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41858.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41859.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41860.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41861.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41862.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41863.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41864.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41867.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>ref|XP_010485482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Camelina sativa]
Length=346

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  SGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            SG  ARACD+C S     +C AD A+LC +CD  VH+AN +ASRH+RVR+
Sbjct  9    SGNWARACDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRV  58


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            R C SC S  A + C AD A LC +CD  +HSAN LA RHQRV
Sbjct  57   RVCQSCESAPAAFLCKADAASLCTTCDAEIHSANPLARRHQRV  99



>ref|XP_006299343.1| hypothetical protein CARUB_v10015501mg [Capsella rubella]
 gb|EOA32241.1| hypothetical protein CARUB_v10015501mg [Capsella rubella]
Length=344

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  SGKTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            SG  ARACD+C S     +C AD A+LC +CD  VH AN LASRH+RVR+
Sbjct  9    SGTWARACDTCRSAACTVYCEADSAYLCNTCDARVHVANRLASRHERVRV  58


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  279  RACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            R C SC S  A +FC AD A LC +CD  +HSAN LA RHQRV
Sbjct  57   RVCQSCESAPAAFFCKADAASLCTACDAEIHSANPLARRHQRV  99



>dbj|BAL41844.1| CO, partial [Cardamine nipponica]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPASFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41839.1| CO, partial [Cardamine nipponica]
 dbj|BAL41840.1| CO, partial [Cardamine nipponica]
 dbj|BAL41846.1| CO, partial [Cardamine nipponica]
 dbj|BAL41848.1| CO, partial [Cardamine nipponica]
 dbj|BAL41849.1| CO, partial [Cardamine nipponica]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41841.1| CO, partial [Cardamine nipponica]
 dbj|BAL41842.1| CO, partial [Cardamine nipponica]
Length=161

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41851.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41868.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  ARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRVRL  413
            ARACD+C S     +C AD A+LC SCD  VHSAN +ASRH+RVR+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRV  62


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +3

Query  240  QRKTANAISG--KTARACDSCLSKRARWFCVADDAFLCQSCDVSVHSANLLASRHQRV  407
            Q  +AN ++   K  R C+SC    A + C ADDA LC +CD  VHSAN LA RHQRV
Sbjct  46   QVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125